O15527 (OGG1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 135.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: N-glycosylase/DNA lyase | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 345 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | DNA repair enzyme that incises DNA at 8-oxoG residues. Excises 7,8-dihydro-8-oxoguanine and 2,6-diamino-4-hydroxy-5-N-methylformamidopyrimidine (FAPY) from damaged DNA. Has a beta-lyase activity that nicks DNA 3' to the lesion. |
| Catalytic activity | The C-O-P bond 3' to the apurinic or apyrimidinic site in DNA is broken by a beta-elimination reaction, leaving a 3'-terminal unsaturated sugar and a product with a terminal 5'-phosphate. |
| Subcellular location | Nucleus › nucleoplasm. Nucleus speckle. Nucleus matrix. Note: Together with APEX1 is recruited to nuclear speckles in UVA-irradiated cells. Ref.17 Isoform 2A: Mitochondrion Ref.17. |
| Tissue specificity | Ubiquitous. |
| Involvement in disease | Defects in OGG1 may be a cause of renal cell carcinoma (RCC) [MIM:144700]. It is a heterogeneous group of sporadic or hereditary carcinoma derived from cells of the proximal renal tubular epithelium. It is subclassified into clear cell renal carcinoma (non-papillary carcinoma), papillary renal cell carcinoma, chromophobe renal cell carcinoma, collecting duct carcinoma with medullary carcinoma of the kidney, and unclassified renal cell carcinoma. |
| Sequence similarities | Belongs to the type-1 OGG1 family. |
| Sequence caution | The sequence AAB84013.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| SNRPF | P62306 | 1 | EBI-721675,EBI-356900 |
Alternative products
| This entry describes 8 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1A (identifier: O15527-1) Also known as: Alpha; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 1B (identifier: O15527-2) The sequence of this isoform differs from the canonical sequence as follows: 317-345: VLFSADLRQSRHAQEPPAKRRKGSKGPEG → VSVPRCPP | ||||||
| Isoform 1C (identifier: O15527-3) The sequence of this isoform differs from the canonical sequence as follows: 317-345: VLFSADLRQSRHAQEPPAKRRKGSKGPEG → TPPSYRCCSV...VCTTRWGGGY | ||||||
| Isoform 2A (identifier: O15527-4) Also known as: Beta; The sequence of this isoform differs from the canonical sequence as follows: 317-345: VLFSADLRQSRHAQEPPAKRRKGSKGPEG → GLLGNAFDGH...HVMQASLLAL | ||||||
| Isoform 2B (identifier: O15527-5) The sequence of this isoform differs from the canonical sequence as follows: 250-345: VADCICLMAL...RRKGSKGPEG → GLLGNAFDGH...HVMQASLLAL | ||||||
| Isoform 2C (identifier: O15527-6) The sequence of this isoform differs from the canonical sequence as follows: 191-195: EVEAH → PWQCI 196-345: Missing. | ||||||
| Isoform 2D (identifier: O15527-7) The sequence of this isoform differs from the canonical sequence as follows: 317-345: VLFSADLRQSRHAQEPPAKRRKGSKGPEG → LCQVITTFMTFLGPHRLDQMPPEELQTSSSRLGGPPWQCI | ||||||
| Isoform 2E (identifier: O15527-8) The sequence of this isoform differs from the canonical sequence as follows: 317-345: VLFSADLRQSRHAQEPPAKRRKGSKGPEG → AGSDAS |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 345 | 345 | N-glycosylase/DNA lyase | PRO_0000058591 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 249 | 1 | Schiff-base intermediate with DNA Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 149 | 1 | DNA | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 154 | 1 | DNA | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 204 | 1 | DNA | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 266 | 1 | 8-oxoguanine; via carbonyl oxygen | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 268 | 1 | 8-oxoguanine | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 270 | 1 | DNA | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 287 | 1 | DNA | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 315 | 1 | 8-oxoguanine | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 319 | 1 | 8-oxoguanine | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 191 – 195 | 5 | EVEAH → PWQCI in isoform 2C. | VSP_003750 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 196 – 345 | 150 | Missing in isoform 2C. | VSP_003751 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 250 – 345 | 96 | VADCI…KGPEG → GLLGNAFDGHQLLRPLIFCQ DHLREGPPIGRGDSQGEELE PQLPSSLSSIPYGFCDHCWT KDVDDPPLVTHPSPGSRDGH MTQAWPVKVVSPLATVIGHV MQASLLAL in isoform 2B. | VSP_003749 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 317 – 345 | 29 | VLFSA…KGPEG → VSVPRCPP in isoform 1B. | VSP_003746 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 317 – 345 | 29 | VLFSA…KGPEG → TPPSYRCCSVPTCANPAMLR SHQQSAERVPKGRKARWGTL DKEIPQAPSPPFPTSLSPSP PSLMLGRGLPVTTSKARHPQ IKQSVCTTRWGGGY in isoform 1C. | VSP_003747 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 317 – 345 | 29 | VLFSA…KGPEG → GLLGNAFDGHQLLRPLIFCQ DHLREGPPIGRGDSQGEELE PQLPSSLSSIPYGFCDHCWT KDVDDPPLVTHPSPGSRDGH MTQAWPVKVVSPLATVIGHV MQASLLAL in isoform 2A. | VSP_003748 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 317 – 345 | 29 | VLFSA…KGPEG → LCQVITTFMTFLGPHRLDQM PPEELQTSSSRLGGPPWQCI in isoform 2D. | VSP_003752 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 317 – 345 | 29 | VLFSA…KGPEG → AGSDAS in isoform 2E. | VSP_003753 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 12 | 1 | G → E Found in a kidney cancer sample; no effect on activity; abolishes mitochondrial localization. Ref.28 | VAR_024831 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 46 | 1 | R → Q Found in a clear cell renal cell carcinoma sample; somatic mutation; diminished activity. Ref.27 Corresponds to variant rs104893751 [ dbSNP | Ensembl ]. | VAR_009519 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 85 | 1 | A → S Found in a lung cancer sample. Ref.25 Corresponds to variant rs17050550 [ dbSNP | Ensembl ]. | VAR_024832 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 131 | 1 | R → Q Found in a lung cancer sample; loss of activity. Ref.25 | VAR_024833 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 154 | 1 | R → H Found in a gastric cancer sample; no effect on base-excision activity; alters substrate specificity and strongly increases mutagenic mis-repair. Ref.18 Ref.24 Ref.27 Corresponds to variant rs56053615 [ dbSNP | Ensembl ]. | VAR_009520 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 229 | 1 | R → Q. Ref.13 Corresponds to variant rs1805373 [ dbSNP | Ensembl ]. | VAR_014487 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 232 | 1 | S → T Found in a kidney cancer sample. Ref.25 | VAR_024834 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 288 | 1 | A → V. Ref.13 Corresponds to variant rs3219012 [ dbSNP | Ensembl ]. | VAR_018890 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 320 | 1 | S → T. Corresponds to variant rs1801128 [ dbSNP | Ensembl ]. | VAR_014488 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 322 | 1 | D → N. Ref.13 Corresponds to variant rs3219014 [ dbSNP | Ensembl ]. | VAR_018891 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 326 | 1 | S → C Common polymorphism in the Japanese population. Ref.12 Ref.13 Ref.15 Ref.26 Corresponds to variant rs1052133 [ dbSNP | Ensembl ]. | VAR_009521 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 249 | 1 | K → Q: Loss of activity. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 268 | 1 | D → E or Q: No effect on activity. Ref.20 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 268 | 1 | D → N: Decreases activity about 65-fold. Ref.20 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 47 | 1 | W → WW in CAA10351. Ref.9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 308 | 1 | G → E in CAA10351. Ref.9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 316 | 1 | A → ATPPSLQ in AAB81132. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 16 – 18 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 20 – 22 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 24 – 27 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 30 – 32 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 35 – 38 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 39 – 42 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 48 – 51 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 54 – 58 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 60 – 68 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 70 – 78 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 90 – 99 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 100 – 103 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 106 – 116 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 118 – 124 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 137 – 145 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 146 – 149 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 152 – 166 | 15 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 169 – 173 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 176 – 179 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 184 – 187 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 192 – 198 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 204 – 217 | 14 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 221 – 227 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 228 – 230 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 233 – 240 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 248 – 258 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 269 – 279 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 284 – 287 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 293 – 307 | 15 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 311 – 323 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and characterization of mammalian 8-hydroxyguanine-specific DNA glycosylase/apurinic, apyrimidinic lyase, a functional mutM homologue." Aburatani H., Hippo Y., Ishida T., Takashima R., Matsuba C., Kodama T., Takao M., Yasui A., Yamamoto K., Asano M., Fukasawa K., Yoshinari T., Inoue H., Otsuka E., Nishimura S. Cancer Res. 57:2151-2156(1997) [PubMed: 9187114] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1A; 1B AND 2A). Tissue: Colon. |
| [2] | "Cloning and characterization of a mammalian 8-oxoguanine DNA glycosylase." Rosenquist T.A., Zharkov D.O., Grollman A.P. Proc. Natl. Acad. Sci. U.S.A. 94:7429-7434(1997) [PubMed: 9207108] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1A). |
| [3] | "Molecular cloning and functional expression of a human cDNA encoding the antimutator enzyme 8-hydroxyguanine-DNA glycosylase." Roldan-Arjona T., Wei Y.-F., Carter K.C., Klungland A., Anselmino C., Wang R.-P., Augustus M., Lindahl T. Proc. Natl. Acad. Sci. U.S.A. 94:8016-8020(1997) [PubMed: 9223306] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2A). |
| [4] | "Cloning and characterization of hOGG1, a human homolog of the OGG1 gene of Saccharomyces cerevisiae." Radicella J.P., Dherin C., Desmaze C., Fox M.S., Boiteux S. Proc. Natl. Acad. Sci. U.S.A. 94:8010-8015(1997) [PubMed: 9223305] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1A). |
| [5] | "A mammalian DNA repair enzyme that excises oxidatively damaged guanines maps to a locus frequently lost in lung cancer." Lu R., Nash H.M., Verdine G.L. Curr. Biol. 7:397-407(1997) [PubMed: 9197244] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1A), ACTIVE SITE, MUTAGENESIS OF LYS-249. |
| [6] | "Cloning of a human homolog of the yeast OGG1 gene that is involved in the repair of oxidative DNA damage." Arai K., Morishita K., Shinmura K., Kohno T., Taniwaki M., Ohwada S., Yokota J. Oncogene 14:2857-2861(1997) [PubMed: 9190902] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1A). |
| [7] | "Augmented expression of a human gene for 8-oxoguanine DNA glycosylase (MutM) in B lymphocytes of the dark zone in lymph node germinal centers." Kuo F.C., Sklar J.L. J. Exp. Med. 186:1547-1556(1997) [PubMed: 9348312] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1A). |
| [8] | "Opposite base-dependent reactions of a human base excision repair enzyme on DNA containing 7,8-dihydro-8-oxoguanine and abasic sites." Bjoras M., Luna L., Johnsen B.E., Hoff E., Haug T., Rognes T., Seeberg E. EMBO J. 16:6314-6322(1997) [PubMed: 9321410] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1A). |
| [9] | "Genomic structure and promoter characterization of the human 8-OH-guanine glycosylase gene (OGG1) gene." Dhenaut A., Boiteux S., Radicella J. Submitted (DEC-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [10] | "Structure and chromosome location of human OGG1." Ishida T., Hippo Y., Nakahori Y., Matsushita I., Kodama T., Nishimura S., Aburatani H. Cytogenet. Cell Genet. 85:232-236(1999) [PubMed: 10449904] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING. |
| [11] | "Expression and differential intracellular localization of two major forms of human 8-Oxoguanine DNA glycosylase encoded by alternatively spliced OGG1 mRNAs." Nishioka K., Ohtsubo T., Oda H., Fujiwara T., Kang D., Sugimachi K., Nakabeppu Y. Mol. Biol. Cell 10:1637-1652(1999) [PubMed: 10233168] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING. |
| [12] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1A), VARIANT CYS-326. Tissue: Brain. |
| [13] | NIEHS SNPs program Submitted (JUN-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS GLN-229; VAL-288; ASN-322 AND CYS-326. |
| [14] | "The DNA sequence, annotation and analysis of human chromosome 3." Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J. Gibbs R.A.Nature 440:1194-1198(2006) [PubMed: 16641997] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [15] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA], VARIANT CYS-326. Tissue: Eye. |
| [16] | "The human OGG1 gene: structure, functions, and its implication in the process of carcinogenesis." Boiteux S., Radicella J.P. Arch. Biochem. Biophys. 377:1-8(2000) [PubMed: 10775435] [Abstract] Cited for: REVIEW. |
| [17] | "UVA irradiation induces relocalisation of the DNA repair protein hOGG1 to nuclear speckles." Campalans A., Amouroux R., Bravard A., Epe B., Radicella J.P. J. Cell Sci. 120:23-32(2007) [PubMed: 17148573] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [18] | "Structural basis for recognition and repair of the endogenous mutagen 8-oxoguanine in DNA." Bruner S.D., Norman D.P.G., Verdine G.L. Nature 403:859-866(2000) [PubMed: 10706276] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.1 ANGSTROMS) OF 12-327 OF MUTANT GLN-247 IN COMPLEX WITH DNA, CHARACTERIZATION OF VARIANT HIS-154. |
| [19] | "Reciprocal 'flipping'; underlies substrate recognition and catalytic activation by the human 8-oxo-guanine DNA glycosylase." Bjoras M., Seeberg E., Luna L., Pearl L.H., Barrett T.E. J. Mol. Biol. 317:171-177(2002) [PubMed: 11902834] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.15 ANGSTROMS) IN COMPLEX WITH DNA AND 8-OXO-GUANINE. |
| [20] | "Structural and biochemical exploration of a critical amino acid in human 8-oxoguanine glycosylase." Norman D.P.G., Chung S.J., Verdine G.L. Biochemistry 42:1564-1572(2003) [PubMed: 12578369] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.2 ANGSTROMS) OF 12-327 OF MUTANTS ASN-268; GLU-268 AND GLN-268 IN COMPLEX WITH DNA, MUTAGENESIS OF ASP-268. |
| [21] | "Product-assisted catalysis in base-excision DNA repair." Fromme J.C., Bruner S.D., Yang W., Karplus M., Verdine G.L. Nat. Struct. Biol. 10:204-211(2003) [PubMed: 12592398] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.35 ANGSTROMS) OF 12-327 IN COMPLEX WITH DNA AND 8-OXO-GUANINE. |
| [22] | "Structures of end products resulting from lesion processing by a DNA glycosylase/lyase." Chung S.J., Verdine G.L. Chem. Biol. 11:1643-1649(2004) [PubMed: 15610848] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.9 ANGSTROMS) OF 12-325 OF MUTANT GLU-268 IN COMPLEX WITH DNA. |
| [23] | "Structural characterization of human 8-oxoguanine DNA glycosylase variants bearing active site mutations." Radom C.T., Banerjee A., Verdine G.L. J. Biol. Chem. 282:9182-9194(2007) [PubMed: 17114185] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.57 ANGSTROMS) OF 12-327 OF MUTANTS ALA-42/ALA-270/ALA-315/PHE-315 IN COMPLEXES WITH DNA. |
| [24] | "Infrequent mutations of the hOGG1 gene, that is involved in the excision of 8-hydroxyguanine in damaged DNA, in human gastric cancer." Shinmura K., Kohno T., Kasai H., Koda K., Sugimura H., Yokota J. Jpn. J. Cancer Res. 89:825-828(1998) [PubMed: 9765618] [Abstract] Cited for: VARIANT HIS-154. |
| [25] | "Mutations in OGG1, a gene involved in the repair of oxidative DNA damage, are found in human lung and kidney tumours." Chevillard S., Radicella J.P., Levalois C., Lebeau J., Poupon M.-F., Oudard S., Dutrillaux B., Boiteux S. Oncogene 16:3083-3086(1998) [PubMed: 9662341] [Abstract] Cited for: VARIANTS SER-85; GLN-131 AND THR-232, CHARACTERIZATION OF VARIANT GLN-131. |
| [26] | "Excision of oxidatively damaged DNA bases by the human alpha-hOgg1 protein and the polymorphic alpha-hOgg1(Ser326Cys) protein which is frequently found in human populations." Dherin C., Radicella J.P., Dizdaroglu M., Boiteux S. Nucleic Acids Res. 27:4001-4007(1999) [PubMed: 10497264] [Abstract] Cited for: CHARACTERIZATION OF VARIANT CYS-326. |
| [27] | "Effect of single mutations in the OGG1 gene found in human tumors on the substrate specificity of the ogg1 protein." Audebert M., Radicella J.P., Dizdaroglu M. Nucleic Acids Res. 28:2672-2678(2000) [PubMed: 10908322] [Abstract] Cited for: CHARACTERIZATION OF VARIANTS GLN-46 AND HIS-154. |
| [28] | "Mitochondrial targeting of human 8-oxoguanine DNA glycosylase hOGG1 is impaired by a somatic mutation found in kidney cancer." Audebert M., Charbonnier J.-B., Boiteux S., Radicella J.P. DNA Repair 1:497-505(2002) [PubMed: 12509224] [Abstract] Cited for: CHARACTERIZATION OF VARIANT GLU-12. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U88527 mRNA. Translation: AAB68614.1. U88620 mRNA. Translation: AAB68615.1. U96710 mRNA. Translation: AAB81132.1. Y13277 mRNA. Translation: CAA73726.1. Y11731 mRNA. Translation: CAA72414.1. AF003595 mRNA. Translation: AAB61340.1. AB000410 mRNA. Translation: BAA19103.1. AF026691 mRNA. Translation: AAB84013.1. Different initiation. Y11838 mRNA. Translation: CAA72536.1. AJ131341 Genomic DNA. Translation: CAA10351.1. AF088282 Genomic DNA. Translation: AAD41680.1. AF088282 Genomic DNA. Translation: AAD41681.1. AF088282 Genomic DNA. Translation: AAD41682.1. AB019528 mRNA. Translation: BAA76635.1. AB019529 mRNA. Translation: BAA76636.1. AB019530 mRNA. Translation: BAA76637.1. AB019531 mRNA. Translation: BAA76638.1. AB019532 mRNA. Translation: BAA76639.1. AK289858 mRNA. Translation: BAF82547.1. AF521807 Genomic DNA. Translation: AAM74236.1. AC022382 Genomic DNA. No translation available. BC000657 mRNA. Translation: AAH00657.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00007312. IPI00025730. IPI00026574. IPI00220178. IPI00220179. IPI00220180. IPI00294126. IPI00303869. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | T45069. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_002533.1. NM_002542.5. NP_058212.1. NM_016819.3. NP_058213.1. NM_016820.3. NP_058214.1. NM_016821.2. NP_058434.1. NM_016826.2. NP_058436.1. NM_016827.2. NP_058437.1. NM_016828.2. NP_058438.1. NM_016829.2. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.380271. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | O15527. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMR | O15527. Positions 12-323. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | O15527. 2 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MINT | MINT-3292093. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | O15527. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | O15527. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | O15527. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000344629; ENSP00000342851; ENSG00000114026. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 4968. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:4968. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc003bsh.1. human. uc003bsi.1. human. uc003bsj.1. human. uc003bsk.1. human. uc003bsm.1. human. uc003bsn.1. human. uc003bso.1. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 4968. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC03P009791. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:8125. OGG1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB047301. HPA027514. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 144700. phenotype. 601982. gene. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_O15527. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Orphanet | 151. Familial renal cell carcinoma. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA31912. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | prNOG19735. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneTree | ENSGT00390000004314. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG001047. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMA | LFSFICT. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhylomeDB | O15527. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_216. DNA Repair. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | O15527. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | O15527. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | O15527. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000114026. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR011257. DNA_glycosylase. IPR003265. HhH-GPD_domain. IPR023170. HTH_base_excis_C. IPR004577. Ogg. IPR012904. OGG_N. IPR012294. TFIID_C/glycos_N. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene3D | G3DSA:1.10.340.30. DNA_glycosylase. 1 hit. G3DSA:1.10.1670.10. HTH_base_excis_C. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KO | K03660. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00730. HhH-GPD. 1 hit. PF07934. OGG_N. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00478. ENDO3c. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF48150. DNA_glycsylse. 1 hit. SSF55945. TFIID_C/glycos_N. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| TIGRFAMs | TIGR00588. Ogg. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 19116. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | OGG1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O15527 Secondary accession number(s): A8K1E3 Q9Y6C4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with