Reviewed,
UniProtKB/Swiss-Prot O15527 (OGG1_HUMAN)
Last modified
June 16, 2009.
Version 106.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: N-glycosylase/DNA lyase Including the following 2 domains: 1- Recommended name: 8-oxoguanine DNA glycosylase EC=3.2.2.- 2- Recommended name: DNA-(apurinic or apyrimidinic site) lyase Short name=AP lyase EC=4.2.99.18 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 345 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | DNA repair enzyme that incises DNA at 8-oxoG residues. Excises 7,8-dihydro-8-oxoguanine and 2,6-diamino-4-hydroxy-5-N-methylformamidopyrimidine (FAPY) from damaged DNA. Has a beta-lyase activity that nicks DNA 3' to the lesion. |
| Catalytic activity | The C-O-P bond 3' to the apurinic or apyrimidinic site in DNA is broken by a beta-elimination reaction, leaving a 3'-terminal unsaturated sugar and a product with a terminal 5'-phosphate. |
| Subcellular location | Isoform 1A: Nucleus. Isoform 2A: Mitochondrion. |
| Tissue specificity | Ubiquitous. |
| Involvement in disease | Defects in OGG1 are associated with tumor formation. Defects in OGG1 are a cause of renal cell carcinoma (RCC1) [MIM:144700]. |
| Sequence similarities | Belongs to the type-1 OGG1 family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | DNA damage DNA repair |
| Cellular component | Mitochondrion Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Molecular function | Glycosidase Hydrolase Lyase |
| Technical term | 3D-structure Multifunctional enzyme |
| Gene Ontology (GO) | |
| Biological process | depurination Inferred from Experiment. Source: Reactome nucleotide-excision repairInferred from electronic annotation. Source: InterPro |
| Cellular component | mitochondrion Inferred from electronic annotation. Source: UniProtKB-KW nucleoplasm Ref.4Inferred from Experiment. Source: Reactome |
| Molecular function | damaged DNA binding Ref.4 Traceable author statement. Source: ProtInc oxidized purine base lesion DNA N-glycosylase activity Ref.6Inferred from Experiment. Source: Reactome protein bindingInferred from physical interaction. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 8 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1A (identifier: O15527-1) Also known as: Alpha; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 1B (identifier: O15527-2) The sequence of this isoform differs from the canonical sequence as follows: 317-345: VLFSADLRQSRHAQEPPAKRRKGSKGPEG → VSVPRCPP | ||||||
| Isoform 1C (identifier: O15527-3) The sequence of this isoform differs from the canonical sequence as follows: 317-345: VLFSADLRQSRHAQEPPAKRRKGSKGPEG → TPPSYRCCSV...VCTTRWGGGY | ||||||
| Isoform 2A (identifier: O15527-4) Also known as: Beta; The sequence of this isoform differs from the canonical sequence as follows: 317-345: VLFSADLRQSRHAQEPPAKRRKGSKGPEG → GLLGNAFDGH...HVMQASLLAL | ||||||
| Isoform 2B (identifier: O15527-5) The sequence of this isoform differs from the canonical sequence as follows: 250-345: VADCICLMAL...RRKGSKGPEG → GLLGNAFDGH...HVMQASLLAL | ||||||
| Isoform 2C (identifier: O15527-6) The sequence of this isoform differs from the canonical sequence as follows: 191-195: EVEAH → PWQCI 196-345: Missing. | ||||||
| Isoform 2D (identifier: O15527-7) The sequence of this isoform differs from the canonical sequence as follows: 317-345: VLFSADLRQSRHAQEPPAKRRKGSKGPEG → LCQVITTFMTFLGPHRLDQMPPEELQTSSSRLGGPPWQCI | ||||||
| Isoform 2E (identifier: O15527-8) The sequence of this isoform differs from the canonical sequence as follows: 317-345: VLFSADLRQSRHAQEPPAKRRKGSKGPEG → AGSDAS |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 345 | 345 | N-glycosylase/DNA lyase | PRO_0000058591 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 249 | 1 | Schiff-base intermediate with DNA Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 149 | 1 | DNA | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 154 | 1 | DNA | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 204 | 1 | DNA | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 266 | 1 | 8-oxoguanine; via carbonyl oxygen | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 268 | 1 | 8-oxoguanine | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 270 | 1 | DNA | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 287 | 1 | DNA | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 315 | 1 | 8-oxoguanine | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 319 | 1 | 8-oxoguanine | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 191 – 195 | 5 | EVEAH → PWQCI in isoform 2C. | VSP_003750 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 196 – 345 | 150 | Missing in isoform 2C. | VSP_003751 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 250 – 345 | 96 | VADCI…KGPEG → GLLGNAFDGHQLLRPLIFCQ DHLREGPPIGRGDSQGEELE PQLPSSLSSIPYGFCDHCWT KDVDDPPLVTHPSPGSRDGH MTQAWPVKVVSPLATVIGHV MQASLLAL in isoform 2B. | VSP_003749 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 317 – 345 | 29 | VLFSA…KGPEG → VSVPRCPP in isoform 1B. | VSP_003746 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 317 – 345 | 29 | VLFSA…KGPEG → TPPSYRCCSVPTCANPAMLR SHQQSAERVPKGRKARWGTL DKEIPQAPSPPFPTSLSPSP PSLMLGRGLPVTTSKARHPQ IKQSVCTTRWGGGY in isoform 1C. | VSP_003747 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 317 – 345 | 29 | VLFSA…KGPEG → GLLGNAFDGHQLLRPLIFCQ DHLREGPPIGRGDSQGEELE PQLPSSLSSIPYGFCDHCWT KDVDDPPLVTHPSPGSRDGH MTQAWPVKVVSPLATVIGHV MQASLLAL in isoform 2A. | VSP_003748 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 317 – 345 | 29 | VLFSA…KGPEG → LCQVITTFMTFLGPHRLDQM PPEELQTSSSRLGGPPWQCI in isoform 2D. | VSP_003752 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 317 – 345 | 29 | VLFSA…KGPEG → AGSDAS in isoform 2E. | VSP_003753 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 12 | 1 | G → E in kidney cancer; no effect on activity. Abolishes mitochondrial localization. Ref.27 | VAR_024831 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 46 | 1 | R → Q in kidney cancer; diminished activity. Ref.26 | VAR_009519 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 85 | 1 | A → S in lung cancer. dbSNP rs17050550. Ref.24 | VAR_024832 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 131 | 1 | R → Q in lung cancer; loss of activity. Ref.24 | VAR_024833 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 154 | 1 | R → H in gastric cancer; No effect on base-excision activity. Alters substrate specificity and strongly increases mutagenic mis-repair. dbSNP rs56053615. Ref.26 Ref.17 Ref.23 | VAR_009520 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 229 | 1 | R → Q: dbSNP rs1805373. Ref.13 | VAR_014487 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 232 | 1 | S → T in kidney cancer. Ref.24 | VAR_024834 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 288 | 1 | A → V: dbSNP rs3219012. Ref.13 | VAR_018890 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 320 | 1 | S → T: dbSNP rs1801128. | VAR_014488 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 322 | 1 | D → N: dbSNP rs3219014. Ref.13 | VAR_018891 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 326 | 1 | S → C Common polymorphism in the Japanese population. dbSNP rs1052133. Ref.13 Ref.12 Ref.15 Ref.25 | VAR_009521 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 249 | 1 | K → Q: Loss of activity. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 268 | 1 | D → E or Q: No effect on activity. Ref.19 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 268 | 1 | D → N: Decreases activity about 65-fold. Ref.19 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 47 | 1 | W → WW in CAA10351. Ref.9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 308 | 1 | G → E in CAA10351. Ref.9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 316 | 1 | A → ATPPSLQ Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 16 – 18 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 20 – 22 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 24 – 27 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 30 – 32 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 35 – 38 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 39 – 42 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 48 – 51 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 54 – 58 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 60 – 68 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 70 – 78 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 90 – 99 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 100 – 103 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 106 – 116 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 118 – 124 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 137 – 145 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 146 – 149 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 152 – 166 | 15 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 169 – 173 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 176 – 179 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 184 – 187 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 192 – 198 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 204 – 217 | 14 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 221 – 227 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 228 – 230 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 233 – 240 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 248 – 258 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 269 – 279 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 284 – 287 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 293 – 307 | 15 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 311 – 323 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and characterization of mammalian 8-hydroxyguanine-specific DNA glycosylase/apurinic, apyrimidinic lyase, a functional mutM homologue." Aburatani H., Hippo Y., Ishida T., Takashima R., Matsuba C., Kodama T., Takao M., Yasui A., Yamamoto K., Asano M., Fukasawa K., Yoshinari T., Inoue H., Otsuka E., Nishimura S. Cancer Res. 57:2151-2156(1997) [PubMed: 9187114] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1A; 1B AND 2). Tissue: Colon. |
| [2] | "Cloning and characterization of a mammalian 8-oxoguanine DNA glycosylase." Rosenquist T.A., Zharkov D.O., Grollman A.P. Proc. Natl. Acad. Sci. U.S.A. 94:7429-7434(1997) [PubMed: 9207108] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1A). |
| [3] | "Molecular cloning and functional expression of a human cDNA encoding the antimutator enzyme 8-hydroxyguanine-DNA glycosylase." Roldan-Arjona T., Wei Y.-F., Carter K.C., Klungland A., Anselmino C., Wang R.-P., Augustus M., Lindahl T. Proc. Natl. Acad. Sci. U.S.A. 94:8016-8020(1997) [PubMed: 9223306] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [4] | "Cloning and characterization of hOGG1, a human homolog of the OGG1 gene of Saccharomyces cerevisiae." Radicella J.P., Dherin C., Desmaze C., Fox M.S., Boiteux S. Proc. Natl. Acad. Sci. U.S.A. 94:8010-8015(1997) [PubMed: 9223305] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1A). |
| [5] | "A mammalian DNA repair enzyme that excises oxidatively damaged guanines maps to a locus frequently lost in lung cancer." Lu R., Nash H.M., Verdine G.L. Curr. Biol. 7:397-407(1997) [PubMed: 9197244] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1A), ACTIVE SITE, MUTAGENESIS OF LYS-249. |
| [6] | "Cloning of a human homolog of the yeast OGG1 gene that is involved in the repair of oxidative DNA damage." Arai K., Morishita K., Shinmura K., Kohno T., Taniwaki M., Ohwada S., Yokota J. Oncogene 14:2857-2861(1997) [PubMed: 9190902] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1A). |
| [7] | "Augmented expression of a human gene for 8-oxoguanine DNA glycosylase (MutM) in B lymphocytes of the dark zone in lymph node germinal centers." Kuo F.C., Sklar J.L. J. Exp. Med. 186:1547-1556(1997) [PubMed: 9348312] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1A). |
| [8] | "Opposite base-dependent reactions of a human base excision repair enzyme on DNA containing 7,8-dihydro-8-oxoguanine and abasic sites." Bjoras M., Luna L., Johnsen B.E., Hoff E., Haug T., Rognes T., Seeberg E. EMBO J. 16:6314-6322(1997) [PubMed: 9321410] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1A). |
| [9] | "Genomic structure and promoter characterization of the human 8-OH-guanine glycosylase gene (OGG1) gene." Dhenaut A., Boiteux S., Radicella J. Submitted (DEC-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [10] | "Structure and chromosome location of human OGG1." Ishida T., Hippo Y., Nakahori Y., Matsushita I., Kodama T., Nishimura S., Aburatani H. Cytogenet. Cell Genet. 85:232-236(1999) [PubMed: 10449904] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING. |
| [11] | "Expression and differential intracellular localization of two major forms of human 8-Oxoguanine DNA glycosylase encoded by alternatively spliced OGG1 mRNAs." Nishioka K., Ohtsubo T., Oda H., Fujiwara T., Kang D., Sugimachi K., Nakabeppu Y. Mol. Biol. Cell 10:1637-1652(1999) [PubMed: 10233168] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING. |
| [12] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1A), VARIANT CYS-326. Tissue: Brain. |
| [13] | NIEHS SNPs program Submitted (JUN-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS GLN-229; VAL-288; ASN-322 AND CYS-326. |
| [14] | "The DNA sequence, annotation and analysis of human chromosome 3." Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J. Gibbs R.A.Nature 440:1194-1198(2006) [PubMed: 16641997] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [15] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA], VARIANT CYS-326. Tissue: Eye. |
| [16] | "The human OGG1 gene: structure, functions, and its implication in the process of carcinogenesis." Boiteux S., Radicella J.P. Arch. Biochem. Biophys. 377:1-8(2000) [PubMed: 10775435] [Abstract] Cited for: REVIEW. |
| [17] | "Structural basis for recognition and repair of the endogenous mutagen 8-oxoguanine in DNA." Bruner S.D., Norman D.P.G., Verdine G.L. Nature 403:859-866(2000) [PubMed: 10706276] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.1 ANGSTROMS) OF 12-327 OF MUTANT GLN-247 IN COMPLEX WITH DNA, CHARACTERIZATION OF VARIANT HIS-154. |
| [18] | "Reciprocal 'flipping'; underlies substrate recognition and catalytic activation by the human 8-oxo-guanine DNA glycosylase." Bjoras M., Seeberg E., Luna L., Pearl L.H., Barrett T.E. J. Mol. Biol. 317:171-177(2002) [PubMed: 11902834] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.15 ANGSTROMS) IN COMPLEX WITH DNA AND 8-OXO-GUANINE. |
| [19] | "Structural and biochemical exploration of a critical amino acid in human 8-oxoguanine glycosylase." Norman D.P.G., Chung S.J., Verdine G.L. Biochemistry 42:1564-1572(2003) [PubMed: 12578369] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.2 ANGSTROMS) OF 12-327 OF MUTANTS ASN-268; GLU-268 AND GLN-268 IN COMPLEX WITH DNA, MUTAGENESIS OF ASP-268. |
| [20] | "Product-assisted catalysis in base-excision DNA repair." Fromme J.C., Bruner S.D., Yang W., Karplus M., Verdine G.L. Nat. Struct. Biol. 10:204-211(2003) [PubMed: 12592398] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.35 ANGSTROMS) OF 12-327 IN COMPLEX WITH DNA AND 8-OXO-GUANINE. |
| [21] | "Structures of end products resulting from lesion processing by a DNA glycosylase/lyase." Chung S.J., Verdine G.L. Chem. Biol. 11:1643-1649(2004) [PubMed: 15610848] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.9 ANGSTROMS) OF 12-325 OF MUTANT GLU-268 IN COMPLEX WITH DNA. |
| [22] | "Structural characterization of human 8-oxoguanine DNA glycosylase variants bearing active site mutations." Radom C.T., Banerjee A., Verdine G.L. J. Biol. Chem. 282:9182-9194(2007) [PubMed: 17114185] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.57 ANGSTROMS) OF 12-327 OF MUTANTS ALA-42/ALA-270/ALA-315/PHE-315 IN COMPLEXES WITH DNA. |
| [23] | "Infrequent mutations of the hOGG1 gene, that is involved in the excision of 8-hydroxyguanine in damaged DNA, in human gastric cancer." Shinmura K., Kohno T., Kasai H., Koda K., Sugimura H., Yokota J. Jpn. J. Cancer Res. 89:825-828(1998) [PubMed: 9765618] [Abstract] Cited for: VARIANT HIS-154. |
| [24] | "Mutations in OGG1, a gene involved in the repair of oxidative DNA damage, are found in human lung and kidney tumours." Chevillard S., Radicella J.P., Levalois C., Lebeau J., Poupon M.-F., Oudard S., Dutrillaux B., Boiteux S. Oncogene 16:3083-3086(1998) [PubMed: 9662341] [Abstract] Cited for: VARIANTS SER-85; GLN-131 AND THR-232, CHARACTERIZATION OF VARIANT GLN-131. |
| [25] | "Excision of oxidatively damaged DNA bases by the human alpha-hOgg1 protein and the polymorphic alpha-hOgg1(Ser326Cys) protein which is frequently found in human populations." Dherin C., Radicella J.P., Dizdaroglu M., Boiteux S. Nucleic Acids Res. 27:4001-4007(1999) [PubMed: 10497264] [Abstract] Cited for: CHARACTERIZATION OF VARIANT CYS-326. |
| [26] | "Effect of single mutations in the OGG1 gene found in human tumors on the substrate specificity of the ogg1 protein." Audebert M., Radicella J.P., Dizdaroglu M. Nucleic Acids Res. 28:2672-2678(2000) [PubMed: 10908322] [Abstract] Cited for: CHARACTERIZATION OF VARIANTS GLN-46 AND HIS-154. |
| [27] | "Mitochondrial targeting of human 8-oxoguanine DNA glycosylase hOGG1 is impaired by a somatic mutation found in kidney cancer." Audebert M., Charbonnier J.-B., Boiteux S., Radicella J.P. DNA Repair 1:497-505(2002) [PubMed: 12509224] [Abstract] Cited for: CHARACTERIZATION OF VARIANT GLU-12. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| U96710 mRNA. Translation: AAB81132.1. Y11838 mRNA. Translation: CAA72536.1. Y11731 mRNA. Translation: CAA72414.1. AB000410 mRNA. Translation: BAA19103.1. AF003595 mRNA. Translation: AAB61340.1. U88527 mRNA. Translation: AAB68614.1. U88620 mRNA. Translation: AAB68615.1. Y13277 mRNA. Translation: CAA73726.1. AF026691 mRNA. Translation: AAB84013.1. AJ131341 Genomic DNA. Translation: CAA10351.1. AF088282 Genomic DNA. Translation: AAD41680.1. AF088282 Genomic DNA. Translation: AAD41681.1. AF088282 Genomic DNA. Translation: AAD41682.1. AB019528 mRNA. Translation: BAA76635.1. AB019529 mRNA. Translation: BAA76636.1. AB019530 mRNA. Translation: BAA76637.1. AB019531 mRNA. Translation: BAA76638.1. AB019532 mRNA. Translation: BAA76639.1. AK289858 mRNA. Translation: BAF82547.1. AF521807 Genomic DNA. Translation: AAM74236.1. AC022382 Genomic DNA. No translation available. BC000657 mRNA. Translation: AAH00657.1. | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00007312. IPI00025730. IPI00026574. IPI00220178. IPI00220179. IPI00220180. IPI00294126. IPI00303869. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | T45069. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_002533.1. NP_058212.1. NP_058213.1. NP_058214.1. NP_058434.1. NP_058436.1. NP_058437.1. NP_058438.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.380271 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | O15527. 3 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | O15527. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENSG00000114026. Homo sapiens. [Contig view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 4968. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:4968. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC03P009772. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| H-InvDB | HIX0003031. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:8125. OGG1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 144700. phenotype. 601982. gene. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Orphanet | 151. Renal cell carcinoma, familial. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA31912. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | O15527. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMA | O15527. GLRLIRQ. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| BRENDA | 4.2.99.18. 247. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_216. DNA Repair. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | O15527. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | O15527. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000114026. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR003265. HhH-GPD_domain. IPR004577. Ogg. IPR012904. OGG_N. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00730. HhH-GPD. 1 hit. PF07934. OGG_N. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00478. ENDO3c. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| TIGRFAMs | TIGR00588. ogg. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other Resources | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 19116. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | OGG1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O15527 Secondary accession number(s): A8K1E3 Q9Y6C4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


