Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

CASP8 and FADD-like apoptosis regulator

Gene

CFLAR

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Apoptosis regulator protein which may function as a crucial link between cell survival and cell death pathways in mammalian cells. Acts as an inhibitor of TNFRSF6 mediated apoptosis. A proteolytic fragment (p43) is likely retained in the death-inducing signaling complex (DISC) thereby blocking further recruitment and processing of caspase-8 at the complex. Full length and shorter isoforms have been shown either to induce apoptosis or to reduce TNFRSF-triggered apoptosis. Lacks enzymatic (caspase) activity.1 Publication

GO - Molecular functioni

  • cysteine-type endopeptidase activity involved in execution phase of apoptosis Source: GO_Central
  • enzyme activator activity Source: UniProtKB
  • protease binding Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Apoptosis, Host-virus interaction

Enzyme and pathway databases

BioCyciZFISH:ENSG00000003402-MONOMER.
ReactomeiR-HSA-3371378. Regulation by c-FLIP.
R-HSA-5213460. RIPK1-mediated regulated necrosis.
R-HSA-5218900. CASP8 activity is inhibited.
R-HSA-69416. Dimerization of procaspase-8.
R-HSA-75158. TRAIL signaling.
SignaLinkiO15519.
SIGNORiO15519.

Protein family/group databases

MEROPSiC14.971.

Names & Taxonomyi

Protein namesi
Recommended name:
CASP8 and FADD-like apoptosis regulator
Alternative name(s):
Caspase homolog
Short name:
CASH
Caspase-eight-related protein
Short name:
Casper
Caspase-like apoptosis regulatory protein
Short name:
CLARP
Cellular FLICE-like inhibitory protein
Short name:
c-FLIP
FADD-like antiapoptotic molecule 1
Short name:
FLAME-1
Inhibitor of FLICE
Short name:
I-FLICE
MACH-related inducer of toxicity
Short name:
MRIT
Usurpin
Cleaved into the following 2 chains:
Gene namesi
Name:CFLAR
Synonyms:CASH, CASP8AP1, CLARP, MRIT
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:1876. CFLAR.

Subcellular locationi

GO - Cellular componenti

  • CD95 death-inducing signaling complex Source: Ensembl
  • cytoplasm Source: UniProtKB
  • cytosol Source: Reactome
  • death-inducing signaling complex Source: UniProtKB
  • membrane raft Source: Ensembl
  • ripoptosome Source: UniProtKB
Complete GO annotation...

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi360Y → F: Decreases apoptosis-inducing activity. Reduces interaction with caspase-3 and proteolytic processing. 1 Publication1
Mutagenesisi376D → N or A: Abolishes proteolytic processing. 1 Publication1

Organism-specific databases

DisGeNETi8837.
OpenTargetsiENSG00000003402.
PharmGKBiPA26425.

Chemistry databases

ChEMBLiCHEMBL1955713.

Polymorphism and mutation databases

BioMutaiCFLAR.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000046781 – 376CASP8 and FADD-like apoptosis regulator subunit p43Add BLAST376
ChainiPRO_0000004679377 – 480CASP8 and FADD-like apoptosis regulator subunit p12Sequence analysisAdd BLAST104

Post-translational modificationi

Proteolytically processed; probably by caspase-8. Processing likely occurs at the DISC and generates subunit p43 and p12.

Proteomic databases

EPDiO15519.
MaxQBiO15519.
PaxDbiO15519.
PeptideAtlasiO15519.
PRIDEiO15519.

PTM databases

iPTMnetiO15519.
PhosphoSitePlusiO15519.

Expressioni

Tissue specificityi

Widely expressed. Higher expression in skeletal muscle, pancreas, heart, kidney, placenta, and peripheral blood leukocytes. Also detected in diverse cell lines. Isoform 8 is predominantly expressed in testis and skeletal muscle.

Inductioni

Repressed by IL2/interleukin-2 after TCR stimulation, during progression to the S phase of the cell cycle.1 Publication

Gene expression databases

BgeeiENSG00000003402.
ExpressionAtlasiO15519. baseline and differential.
GenevisibleiO15519. HS.

Organism-specific databases

HPAiCAB022157.
CAB025216.
HPA019044.

Interactioni

Subunit structurei

TNFRSF6 stimulation triggers recruitment to the death-inducing signaling complex (DISC) formed by TNFRSF6, FADD and caspase-8. A proteolytic fragment (p43) stays associated with the DISC. Also interacts with caspase-10, caspase-3, TRAF1, TRAF2 and Bcl-X(L) (in vitro). Interacts with HBV protein X.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
CASP10Q928513EBI-514941,EBI-495095
CASP10Q92851-43EBI-4478097,EBI-6621134
CASP8Q147909EBI-514941,EBI-78060
MAP2K1Q027503EBI-4567563,EBI-492564
MAP2K7O147332EBI-4567563,EBI-492605
TRAF1Q130775EBI-514941,EBI-359224

GO - Molecular functioni

  • protease binding Source: UniProtKB

Protein-protein interaction databases

BioGridi114364. 39 interactors.
DIPiDIP-27629N.
IntActiO15519. 30 interactors.
MINTiMINT-1529273.
STRINGi9606.ENSP00000312455.

Structurei

Secondary structure

1480
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi67 – 71Combined sources5
Beta strandi239 – 241Combined sources3
Beta strandi249 – 260Combined sources12
Helixi266 – 274Combined sources9
Beta strandi276 – 283Combined sources8
Helixi286 – 297Combined sources12
Helixi300 – 304Combined sources5
Beta strandi306 – 317Combined sources12
Helixi333 – 340Combined sources8
Turni342 – 344Combined sources3
Helixi346 – 348Combined sources3
Beta strandi353 – 361Combined sources9
Beta strandi400 – 409Combined sources10
Helixi410 – 412Combined sources3
Helixi422 – 433Combined sources12
Helixi439 – 454Combined sources16
Helixi459 – 461Combined sources3
Beta strandi463 – 469Combined sources7

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2N5RNMR-A62-73[»]
3H11X-ray1.90A209-480[»]
3H13X-ray2.20A209-480[»]
ProteinModelPortaliO15519.
SMRiO15519.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO15519.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini1 – 73DED 1PROSITE-ProRule annotationAdd BLAST73
Domaini92 – 170DED 2PROSITE-ProRule annotationAdd BLAST79

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 435Not proteolytically processed and involved in apoptosis inhibitionAdd BLAST435
Regioni1 – 305Interaction with caspase-8 propeptideAdd BLAST305
Regioni1 – 227Interaction with FADDAdd BLAST227
Regioni1 – 195Interaction with caspase-8Add BLAST195
Regioni192 – 480Interaction with TRAF1 and TRAF2Add BLAST289
Regioni192 – 435Interaction with caspase-3Add BLAST244
Regioni217 – 480Interaction with caspase-8 subunits p18 and p10Add BLAST264
Regioni263 – 358CaspaseAdd BLAST96
Regioni370 – 480Interaction with caspase-8Add BLAST111

Domaini

The caspase domain lacks the active sites residues involved in catalysis.

Sequence similaritiesi

Belongs to the peptidase C14A family.Curated
Contains 2 DED (death effector) domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG3573. Eukaryota.
ENOG410ZQIE. LUCA.
GeneTreeiENSGT00530000064199.
HOGENOMiHOG000069972.
HOVERGENiHBG050918.
InParanoidiO15519.
KOiK04724.
OMAiYDWNSRV.
OrthoDBiEOG091G05YD.
PhylomeDBiO15519.
TreeFamiTF352765.

Family and domain databases

CDDicd00032. CASc. 1 hit.
Gene3Di1.10.533.10. 3 hits.
3.40.50.1460. 1 hit.
InterProiIPR029030. Caspase-like_dom.
IPR011029. DEATH-like_dom.
IPR001875. DED_dom.
IPR001309. Pept_C14_p20.
IPR015917. Pept_C14A.
[Graphical view]
PfamiPF01335. DED. 2 hits.
[Graphical view]
SMARTiSM00115. CASc. 1 hit.
SM00031. DED. 2 hits.
[Graphical view]
SUPFAMiSSF47986. SSF47986. 2 hits.
SSF52129. SSF52129. 1 hit.
PROSITEiPS50208. CASPASE_P20. 1 hit.
PS50168. DED. 2 hits.
[Graphical view]

Sequences (15)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 15 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O15519-1) [UniParc]FASTAAdd to basket
Also known as: FLIP-L, CLARP1, MRIT alpha-1, CASH alpha, I-FLICE 1, FLAME-1 gamma, Usurpin alpha

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSAEVIHQVE EALDTDEKEM LLFLCRDVAI DVVPPNVRDL LDILRERGKL
60 70 80 90 100
SVGDLAELLY RVRRFDLLKR ILKMDRKAVE THLLRNPHLV SDYRVLMAEI
110 120 130 140 150
GEDLDKSDVS SLIFLMKDYM GRGKISKEKS FLDLVVELEK LNLVAPDQLD
160 170 180 190 200
LLEKCLKNIH RIDLKTKIQK YKQSVQGAGT SYRNVLQAAI QKSLKDPSNN
210 220 230 240 250
FRLHNGRSKE QRLKEQLGAQ QEPVKKSIQE SEAFLPQSIP EERYKMKSKP
260 270 280 290 300
LGICLIIDCI GNETELLRDT FTSLGYEVQK FLHLSMHGIS QILGQFACMP
310 320 330 340 350
EHRDYDSFVC VLVSRGGSQS VYGVDQTHSG LPLHHIRRMF MGDSCPYLAG
360 370 380 390 400
KPKMFFIQNY VVSEGQLEDS SLLEVDGPAM KNVEFKAQKR GLCTVHREAD
410 420 430 440 450
FFWSLCTADM SLLEQSHSSP SLYLQCLSQK LRQERKRPLL DLHIELNGYM
460 470 480
YDWNSRVSAK EKYYVWLQHT LRKKLILSYT
Length:480
Mass (Da):55,344
Last modified:January 1, 1998 - v1
Checksum:i8C6D7E92AE1EB672
GO
Isoform 2 (identifier: O15519-2) [UniParc]FASTAAdd to basket
Also known as: FLIP-S, CLARP2, MRIT beta-1, CASH beta

The sequence of this isoform differs from the canonical sequence as follows:
     203-221: LHNGRSKEQRLKEQLGAQQ → MITPYAHCPDLKILGNCSM
     222-480: Missing.

Show »
Length:221
Mass (Da):25,379
Checksum:i12774D7AB3E53263
GO
Isoform 3 (identifier: O15519-3) [UniParc]FASTAAdd to basket
Also known as: MRIT alpha-2

The sequence of this isoform differs from the canonical sequence as follows:
     1-96: Missing.
     436-480: KRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT → GTIPGSGITESKDMHFSSLGCILLDVL

Show »
Length:366
Mass (Da):41,319
Checksum:iB5DB6C8A18608582
GO
Isoform 4 (identifier: O15519-4) [UniParc]FASTAAdd to basket
Also known as: I-FLICE 2

The sequence of this isoform differs from the canonical sequence as follows:
     1-245: Missing.

Show »
Length:235
Mass (Da):27,055
Checksum:i1B34FA73556DC390
GO
Isoform 5 (identifier: O15519-5) [UniParc]FASTAAdd to basket
Also known as: I-FLICE 3

The sequence of this isoform differs from the canonical sequence as follows:
     449-480: YMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT → L

Show »
Length:449
Mass (Da):51,390
Checksum:i8AC8D85BA2F72F7E
GO
Isoform 6 (identifier: O15519-6) [UniParc]FASTAAdd to basket
Also known as: I-FLICE 4

The sequence of this isoform differs from the canonical sequence as follows:
     2-30: SAEVIHQVEEALDTDEKEMLLFLCRDVAI → LERPPVCSKV
     453-480: WNSRVSAKEKYYVWLQHTLRKKLILSYT → SLEHTGGRY

Show »
Length:442
Mass (Da):50,661
Checksum:iB20A318B728B2543
GO
Isoform 7 (identifier: O15519-7) [UniParc]FASTAAdd to basket
Also known as: I-FLICE 5

The sequence of this isoform differs from the canonical sequence as follows:
     1-96: Missing.
     203-221: LHNGRSKEQRLKEQLGAQQ → E
     436-480: KRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT → GTIPGSGITESKDMHFSSLGCILLDVL

Show »
Length:348
Mass (Da):39,245
Checksum:iE9F524387399F9CA
GO
Isoform 8 (identifier: O15519-8) [UniParc]FASTAAdd to basket
Also known as: FLAME-1 alpha

The sequence of this isoform differs from the canonical sequence as follows:
     203-237: Missing.

Show »
Length:445
Mass (Da):51,330
Checksum:i91CD549119606DB2
GO
Isoform 9 (identifier: O15519-9) [UniParc]FASTAAdd to basket
Also known as: FLAME-1 beta

The sequence of this isoform differs from the canonical sequence as follows:
     203-237: Missing.
     267-305: LRDTFTSLGY...FACMPEHRDY → CGVRGPAGGQ...ARAVHSSPRS
     306-480: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:270
Mass (Da):30,399
Checksum:i230E9C0C0ADD1003
GO
Isoform 10 (identifier: O15519-10) [UniParc]FASTAAdd to basket
Also known as: FLAME-1 delta

The sequence of this isoform differs from the canonical sequence as follows:
     266-300: LLRDTFTSLGYEVQKFLHLSMHGISQILGQFACMP → NAHSWIFTLNSMATCMIGTAEFLPRRNIMFGCSTL
     301-480: Missing.

Show »
Length:300
Mass (Da):34,384
Checksum:iF6A777C2BA1469EF
GO
Isoform 11 (identifier: O15519-11) [UniParc]FASTAAdd to basket
Also known as: Usurpin beta

The sequence of this isoform differs from the canonical sequence as follows:
     436-480: KRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT → GTIPGSGITESKDMHFSSLGCILLDVL

Show »
Length:462
Mass (Da):52,551
Checksum:iD4E0109CBA47EAA3
GO
Isoform 12 (identifier: O15519-12) [UniParc]FASTAAdd to basket
Also known as: Usurpin gamma

The sequence of this isoform differs from the canonical sequence as follows:
     265-292: ELLRDTFTSLGYEVQKFLHLSMHGISQI → GWSAMAQSQLTAISTSQVQAILLPQPPE
     293-480: Missing.

Show »
Length:292
Mass (Da):33,273
Checksum:i542E30BD5169F336
GO
Isoform 13 (identifier: O15519-13) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     203-480: Missing.

Show »
Length:202
Mass (Da):23,289
Checksum:i67D3C756AFD14F94
GO
Isoform 14 (identifier: O15519-14) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     436-480: Missing.

Show »
Length:435
Mass (Da):49,778
Checksum:iB37ED523D7738376
GO
Isoform 15 (identifier: O15519-15) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-96: Missing.

Show »
Length:384
Mass (Da):44,112
Checksum:i846E6372DB81F0F6
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti130 – 132SFL → ISW in AAC15825 (PubMed:9380701).Curated3
Sequence conflicti130 – 132SFL → ISW in AAC15826 (PubMed:9380701).Curated3
Sequence conflicti343D → E in AAC15825 (PubMed:9380701).Curated1
Sequence conflicti364E → D in AAB99794 (Ref. 6) Curated1
Sequence conflicti366 – 368QLE → PAG in AAC15825 (PubMed:9380701).Curated3
Sequence conflicti369D → N in CAA74366 (PubMed:9289491).Curated1
Sequence conflicti372L → F in AAB99793 (Ref. 6) Curated1
Sequence conflicti373 – 374LE → WR in AAC15825 (PubMed:9380701).Curated2

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_048619203L → I.Corresponds to variant rs13424615dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0008251 – 245Missing in isoform 4. 1 PublicationAdd BLAST245
Alternative sequenceiVSP_0008241 – 96Missing in isoform 3, isoform 7 and isoform 15. 3 PublicationsAdd BLAST96
Alternative sequenceiVSP_0008262 – 30SAEVI…RDVAI → LERPPVCSKV in isoform 6. 1 PublicationAdd BLAST29
Alternative sequenceiVSP_000831203 – 480Missing in isoform 13. 1 PublicationAdd BLAST278
Alternative sequenceiVSP_000830203 – 237Missing in isoform 8 and isoform 9. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_000828203 – 221LHNGR…LGAQQ → MITPYAHCPDLKILGNCSM in isoform 2. 4 PublicationsAdd BLAST19
Alternative sequenceiVSP_000827203 – 221LHNGR…LGAQQ → E in isoform 7. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_000829222 – 480Missing in isoform 2. 4 PublicationsAdd BLAST259
Alternative sequenceiVSP_000832265 – 292ELLRD…GISQI → GWSAMAQSQLTAISTSQVQA ILLPQPPE in isoform 12. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_000834266 – 300LLRDT…FACMP → NAHSWIFTLNSMATCMIGTA EFLPRRNIMFGCSTL in isoform 10. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_000836267 – 305LRDTF…EHRDY → CGVRGPAGGQQPLGGGWASD EECGIQGSEARAVHSSPRS in isoform 9. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_000833293 – 480Missing in isoform 12. 1 PublicationAdd BLAST188
Alternative sequenceiVSP_000835301 – 480Missing in isoform 10. 1 PublicationAdd BLAST180
Alternative sequenceiVSP_000837306 – 480Missing in isoform 9. 1 PublicationAdd BLAST175
Alternative sequenceiVSP_000838436 – 480KRPLL…ILSYT → GTIPGSGITESKDMHFSSLG CILLDVL in isoform 11, isoform 7 and isoform 3. 4 PublicationsAdd BLAST45
Alternative sequenceiVSP_000839436 – 480Missing in isoform 14. 1 PublicationAdd BLAST45
Alternative sequenceiVSP_000840449 – 480YMYDW…ILSYT → L in isoform 5. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_000841453 – 480WNSRV…ILSYT → SLEHTGGRY in isoform 6. 1 PublicationAdd BLAST28

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF010127 mRNA. Translation: AAB64110.1.
U85059 mRNA. Translation: AAB82648.1.
U97074 mRNA. Translation: AAC51622.1.
U97075 mRNA. Translation: AAC51623.1.
AF009616 mRNA. Translation: AAB70909.1.
AF009617 mRNA. Translation: AAB70910.1.
AF009618 mRNA. Translation: AAB70911.1.
AF009619 mRNA. Translation: AAB70912.1.
AF041458 mRNA. Translation: AAB99790.1.
AF041459 mRNA. Translation: AAB99791.1.
AF041462 mRNA. Translation: AAB99794.1.
AF041461 mRNA. Translation: AAB99793.1.
AF041460 mRNA. Translation: AAB99792.1.
Y14039 mRNA. Translation: CAA74366.1.
Y14040 mRNA. Translation: CAA74367.1.
AF005774 mRNA. Translation: AAC15825.1.
AF005775 mRNA. Translation: AAC15826.1.
AF015450 mRNA. Translation: AAC16439.1.
AF015451 mRNA. Translation: AAC16440.1.
AF015452 mRNA. Translation: AAC16441.1.
AB038972 Genomic DNA. Translation: BAB32551.1.
AB038972 Genomic DNA. Translation: BAB32552.1.
BT006751 mRNA. Translation: AAP35397.1.
AK289913 mRNA. Translation: BAF82602.1.
AK296036 mRNA. Translation: BAG58802.1.
AK315208 mRNA. Translation: BAG37645.1.
AK315924 mRNA. Translation: BAH14295.1.
AC007283 Genomic DNA. Translation: AAY24290.1.
CH471063 Genomic DNA. Translation: EAW70237.1.
CH471063 Genomic DNA. Translation: EAW70244.1.
BC001602 mRNA. Translation: AAH01602.1.
CCDSiCCDS2337.1. [O15519-1]
CCDS46487.1. [O15519-2]
CCDS56157.1. [O15519-8]
CCDS56158.1. [O15519-15]
CCDS59436.1. [O15519-3]
CCDS77505.1. [O15519-11]
RefSeqiNP_001120655.1. NM_001127183.2. [O15519-1]
NP_001120656.1. NM_001127184.2. [O15519-2]
NP_001189444.1. NM_001202515.1. [O15519-4]
NP_001189445.1. NM_001202516.1. [O15519-8]
NP_001189446.1. NM_001202517.1. [O15519-15]
NP_001189447.1. NM_001202518.1. [O15519-3]
NP_001189448.1. NM_001202519.1. [O15519-3]
NP_001294971.1. NM_001308042.1. [O15519-11]
NP_003870.4. NM_003879.5. [O15519-1]
XP_016860679.1. XM_017005190.1. [O15519-1]
XP_016860680.1. XM_017005191.1. [O15519-1]
XP_016860681.1. XM_017005192.1. [O15519-11]
XP_016860682.1. XM_017005193.1. [O15519-11]
XP_016860683.1. XM_017005194.1. [O15519-11]
XP_016860684.1. XM_017005195.1. [O15519-15]
XP_016860685.1. XM_017005196.1. [O15519-4]
XP_016860686.1. XM_017005197.1. [O15519-2]
XP_016860687.1. XM_017005198.1. [O15519-2]
UniGeneiHs.390736.
Hs.731912.

Genome annotation databases

EnsembliENST00000309955; ENSP00000312455; ENSG00000003402. [O15519-1]
ENST00000341222; ENSP00000339335; ENSG00000003402. [O15519-2]
ENST00000341582; ENSP00000345807; ENSG00000003402. [O15519-8]
ENST00000342795; ENSP00000342809; ENSG00000003402. [O15519-12]
ENST00000423241; ENSP00000399420; ENSG00000003402. [O15519-1]
ENST00000440180; ENSP00000406775; ENSG00000003402. [O15519-2]
ENST00000443227; ENSP00000413270; ENSG00000003402. [O15519-15]
ENST00000457277; ENSP00000411535; ENSG00000003402. [O15519-11]
ENST00000479953; ENSP00000471805; ENSG00000003402. [O15519-3]
GeneIDi8837.
KEGGihsa:8837.
UCSCiuc002uwz.4. human. [O15519-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF010127 mRNA. Translation: AAB64110.1.
U85059 mRNA. Translation: AAB82648.1.
U97074 mRNA. Translation: AAC51622.1.
U97075 mRNA. Translation: AAC51623.1.
AF009616 mRNA. Translation: AAB70909.1.
AF009617 mRNA. Translation: AAB70910.1.
AF009618 mRNA. Translation: AAB70911.1.
AF009619 mRNA. Translation: AAB70912.1.
AF041458 mRNA. Translation: AAB99790.1.
AF041459 mRNA. Translation: AAB99791.1.
AF041462 mRNA. Translation: AAB99794.1.
AF041461 mRNA. Translation: AAB99793.1.
AF041460 mRNA. Translation: AAB99792.1.
Y14039 mRNA. Translation: CAA74366.1.
Y14040 mRNA. Translation: CAA74367.1.
AF005774 mRNA. Translation: AAC15825.1.
AF005775 mRNA. Translation: AAC15826.1.
AF015450 mRNA. Translation: AAC16439.1.
AF015451 mRNA. Translation: AAC16440.1.
AF015452 mRNA. Translation: AAC16441.1.
AB038972 Genomic DNA. Translation: BAB32551.1.
AB038972 Genomic DNA. Translation: BAB32552.1.
BT006751 mRNA. Translation: AAP35397.1.
AK289913 mRNA. Translation: BAF82602.1.
AK296036 mRNA. Translation: BAG58802.1.
AK315208 mRNA. Translation: BAG37645.1.
AK315924 mRNA. Translation: BAH14295.1.
AC007283 Genomic DNA. Translation: AAY24290.1.
CH471063 Genomic DNA. Translation: EAW70237.1.
CH471063 Genomic DNA. Translation: EAW70244.1.
BC001602 mRNA. Translation: AAH01602.1.
CCDSiCCDS2337.1. [O15519-1]
CCDS46487.1. [O15519-2]
CCDS56157.1. [O15519-8]
CCDS56158.1. [O15519-15]
CCDS59436.1. [O15519-3]
CCDS77505.1. [O15519-11]
RefSeqiNP_001120655.1. NM_001127183.2. [O15519-1]
NP_001120656.1. NM_001127184.2. [O15519-2]
NP_001189444.1. NM_001202515.1. [O15519-4]
NP_001189445.1. NM_001202516.1. [O15519-8]
NP_001189446.1. NM_001202517.1. [O15519-15]
NP_001189447.1. NM_001202518.1. [O15519-3]
NP_001189448.1. NM_001202519.1. [O15519-3]
NP_001294971.1. NM_001308042.1. [O15519-11]
NP_003870.4. NM_003879.5. [O15519-1]
XP_016860679.1. XM_017005190.1. [O15519-1]
XP_016860680.1. XM_017005191.1. [O15519-1]
XP_016860681.1. XM_017005192.1. [O15519-11]
XP_016860682.1. XM_017005193.1. [O15519-11]
XP_016860683.1. XM_017005194.1. [O15519-11]
XP_016860684.1. XM_017005195.1. [O15519-15]
XP_016860685.1. XM_017005196.1. [O15519-4]
XP_016860686.1. XM_017005197.1. [O15519-2]
XP_016860687.1. XM_017005198.1. [O15519-2]
UniGeneiHs.390736.
Hs.731912.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2N5RNMR-A62-73[»]
3H11X-ray1.90A209-480[»]
3H13X-ray2.20A209-480[»]
ProteinModelPortaliO15519.
SMRiO15519.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114364. 39 interactors.
DIPiDIP-27629N.
IntActiO15519. 30 interactors.
MINTiMINT-1529273.
STRINGi9606.ENSP00000312455.

Chemistry databases

ChEMBLiCHEMBL1955713.

Protein family/group databases

MEROPSiC14.971.

PTM databases

iPTMnetiO15519.
PhosphoSitePlusiO15519.

Polymorphism and mutation databases

BioMutaiCFLAR.

Proteomic databases

EPDiO15519.
MaxQBiO15519.
PaxDbiO15519.
PeptideAtlasiO15519.
PRIDEiO15519.

Protocols and materials databases

DNASUi8837.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000309955; ENSP00000312455; ENSG00000003402. [O15519-1]
ENST00000341222; ENSP00000339335; ENSG00000003402. [O15519-2]
ENST00000341582; ENSP00000345807; ENSG00000003402. [O15519-8]
ENST00000342795; ENSP00000342809; ENSG00000003402. [O15519-12]
ENST00000423241; ENSP00000399420; ENSG00000003402. [O15519-1]
ENST00000440180; ENSP00000406775; ENSG00000003402. [O15519-2]
ENST00000443227; ENSP00000413270; ENSG00000003402. [O15519-15]
ENST00000457277; ENSP00000411535; ENSG00000003402. [O15519-11]
ENST00000479953; ENSP00000471805; ENSG00000003402. [O15519-3]
GeneIDi8837.
KEGGihsa:8837.
UCSCiuc002uwz.4. human. [O15519-1]

Organism-specific databases

CTDi8837.
DisGeNETi8837.
GeneCardsiCFLAR.
HGNCiHGNC:1876. CFLAR.
HPAiCAB022157.
CAB025216.
HPA019044.
MIMi603599. gene.
neXtProtiNX_O15519.
OpenTargetsiENSG00000003402.
PharmGKBiPA26425.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3573. Eukaryota.
ENOG410ZQIE. LUCA.
GeneTreeiENSGT00530000064199.
HOGENOMiHOG000069972.
HOVERGENiHBG050918.
InParanoidiO15519.
KOiK04724.
OMAiYDWNSRV.
OrthoDBiEOG091G05YD.
PhylomeDBiO15519.
TreeFamiTF352765.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000003402-MONOMER.
ReactomeiR-HSA-3371378. Regulation by c-FLIP.
R-HSA-5213460. RIPK1-mediated regulated necrosis.
R-HSA-5218900. CASP8 activity is inhibited.
R-HSA-69416. Dimerization of procaspase-8.
R-HSA-75158. TRAIL signaling.
SignaLinkiO15519.
SIGNORiO15519.

Miscellaneous databases

ChiTaRSiCFLAR. human.
EvolutionaryTraceiO15519.
GeneWikiiCFLAR.
GenomeRNAii8837.
PROiO15519.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000003402.
ExpressionAtlasiO15519. baseline and differential.
GenevisibleiO15519. HS.

Family and domain databases

CDDicd00032. CASc. 1 hit.
Gene3Di1.10.533.10. 3 hits.
3.40.50.1460. 1 hit.
InterProiIPR029030. Caspase-like_dom.
IPR011029. DEATH-like_dom.
IPR001875. DED_dom.
IPR001309. Pept_C14_p20.
IPR015917. Pept_C14A.
[Graphical view]
PfamiPF01335. DED. 2 hits.
[Graphical view]
SMARTiSM00115. CASc. 1 hit.
SM00031. DED. 2 hits.
[Graphical view]
SUPFAMiSSF47986. SSF47986. 2 hits.
SSF52129. SSF52129. 1 hit.
PROSITEiPS50208. CASPASE_P20. 1 hit.
PS50168. DED. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCFLAR_HUMAN
AccessioniPrimary (citable) accession number: O15519
Secondary accession number(s): B4DJE0
, B7Z9F9, O14673, O14674, O14675, O15137, O15138, O15356, O15510, O43618, O43619, O43620, O60458, O60459, Q53TS6, Q54AF1, Q96TE4, Q9UEW1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: January 1, 1998
Last modified: November 30, 2016
This is version 175 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Peptidase families
    Classification of peptidase families and list of entries
  7. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.