O15519 (CFLAR_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 136.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: CASP8 and FADD-like apoptosis regulator Alternative name(s): Caspase homolog Short name=CASH Caspase-eight-related protein Short name=Casper Caspase-like apoptosis regulatory protein Short name=CLARP Cellular FLICE-like inhibitory protein Short name=c-FLIP FADD-like antiapoptotic molecule 1 Short name=FLAME-1 Inhibitor of FLICE Short name=I-FLICE MACH-related inducer of toxicity Short name=MRIT Usurpin Cleaved into the following 2 chains: | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 480 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Apoptosis regulator protein which may function as a crucial link between cell survival and cell death pathways in mammalian cells. Acts as an inhibitor of TNFRSF6 mediated apoptosis. A proteolytic fragment (p43) is likely retained in the death-inducing signaling complex (DISC) thereby blocking further recruitment and processing of caspase-8 at the complex. Full length and shorter isoforms have been shown either to induce apoptosis or to reduce TNFRSF-triggered apoptosis. Lacks enzymatic (caspase) activity. Ref.16 |
| Subunit structure | TNFRSF6 stimulation triggers recruitment to the death-inducing signaling complex (DISC) formed by TNFRSF6, FADD and caspase-8. A proteolytic fragment (p43) stays associated with the DISC. Also interacts with caspase-10, caspase-3, TRAF1, TRAF2 and Bcl-X(L) (in vitro). Interacts with HBV protein X. Ref.18 |
| Tissue specificity | Widely expressed. Higher expression in skeletal muscle, pancreas, heart, kidney, placenta, and peripheral blood leukocytes. Also detected in diverse cell lines. Isoform 8 is predominantly expressed in testis and skeletal muscle. |
| Induction | Repressed by IL2/interleukin-2 after TCR stimulation, during progression to the S phase of the cell cycle. Ref.17 |
| Domain | The caspase domain lacks the active sites residues involved in catalysis. |
| Post-translational modification | Proteolytically processed; probably by caspase-8. Processing likely occurs at the DISC and generates subunit p43 and p12. |
| Sequence similarities | Belongs to the peptidase C14A family. Contains 2 DED (death effector) domains. |
Ontologies
Alternative products
| This entry describes 15 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O15519-1) Also known as: FLIP-L; CLARP1; MRIT alpha-1; CASH alpha; I-FLICE 1; FLAME-1 gamma; Usurpin alpha; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O15519-2) Also known as: FLIP-S; CLARP2; MRIT beta-1; CASH beta; The sequence of this isoform differs from the canonical sequence as follows: 203-221: LHNGRSKEQRLKEQLGAQQ → MITPYAHCPDLKILGNCSM 222-480: Missing. | ||||||
| Isoform 3 (identifier: O15519-3) Also known as: MRIT alpha-2; The sequence of this isoform differs from the canonical sequence as follows: 1-96: Missing. 436-480: KRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT → GTIPGSGITESKDMHFSSLGCILLDVL | ||||||
| Isoform 4 (identifier: O15519-4) Also known as: I-FLICE 2; The sequence of this isoform differs from the canonical sequence as follows: 1-245: Missing. | ||||||
| Isoform 5 (identifier: O15519-5) Also known as: I-FLICE 3; The sequence of this isoform differs from the canonical sequence as follows: 449-480: YMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT → L | ||||||
| Isoform 6 (identifier: O15519-6) Also known as: I-FLICE 4; The sequence of this isoform differs from the canonical sequence as follows: 2-30: SAEVIHQVEEALDTDEKEMLLFLCRDVAI → LERPPVCSKV 453-480: WNSRVSAKEKYYVWLQHTLRKKLILSYT → SLEHTGGRY | ||||||
| Isoform 7 (identifier: O15519-7) Also known as: I-FLICE 5; The sequence of this isoform differs from the canonical sequence as follows: 1-96: Missing. 203-221: LHNGRSKEQRLKEQLGAQQ → E 436-480: KRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT → GTIPGSGITESKDMHFSSLGCILLDVL | ||||||
| Isoform 8 (identifier: O15519-8) Also known as: FLAME-1 alpha; The sequence of this isoform differs from the canonical sequence as follows: 203-237: Missing. | ||||||
| Isoform 9 (identifier: O15519-9) Also known as: FLAME-1 beta; The sequence of this isoform differs from the canonical sequence as follows: 203-237: Missing. 267-305: LRDTFTSLGY...FACMPEHRDY → CGVRGPAGGQ...ARAVHSSPRS 306-480: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 10 (identifier: O15519-10) Also known as: FLAME-1 delta; The sequence of this isoform differs from the canonical sequence as follows: 266-300: LLRDTFTSLGYEVQKFLHLSMHGISQILGQFACMP → NAHSWIFTLNSMATCMIGTAEFLPRRNIMFGCSTL 301-480: Missing. | ||||||
| Isoform 11 (identifier: O15519-11) Also known as: Usurpin beta; The sequence of this isoform differs from the canonical sequence as follows: 436-480: KRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT → GTIPGSGITESKDMHFSSLGCILLDVL | ||||||
| Isoform 12 (identifier: O15519-12) Also known as: Usurpin gamma; The sequence of this isoform differs from the canonical sequence as follows: 265-292: ELLRDTFTSLGYEVQKFLHLSMHGISQI → GWSAMAQSQLTAISTSQVQAILLPQPPE 293-480: Missing. | ||||||
| Isoform 13 (identifier: O15519-13) The sequence of this isoform differs from the canonical sequence as follows: 203-480: Missing. | ||||||
| Isoform 14 (identifier: O15519-14) The sequence of this isoform differs from the canonical sequence as follows: 436-480: Missing. | ||||||
| Isoform 15 (identifier: O15519-15) The sequence of this isoform differs from the canonical sequence as follows: 1-96: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 376 | 376 | CASP8 and FADD-like apoptosis regulator subunit p43 | PRO_0000004678 | ||||||||||||||||||||||||||||||||||||||
| Chain | 377 – 480 | 104 | CASP8 and FADD-like apoptosis regulator subunit p12 Potential | PRO_0000004679 | ||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||
| Domain | 1 – 73 | 73 | DED 1 | |||||||||||||||||||||||||||||||||||||||
| Domain | 92 – 170 | 79 | DED 2 | |||||||||||||||||||||||||||||||||||||||
| Region | 1 – 435 | 435 | Not proteolytically processed and involved in apoptosis inhibition | |||||||||||||||||||||||||||||||||||||||
| Region | 1 – 305 | 305 | Interaction with caspase-8 propeptide | |||||||||||||||||||||||||||||||||||||||
| Region | 1 – 227 | 227 | Interaction with FADD | |||||||||||||||||||||||||||||||||||||||
| Region | 1 – 195 | 195 | Interaction with caspase-8 | |||||||||||||||||||||||||||||||||||||||
| Region | 192 – 480 | 289 | Interaction with TRAF1 and TRAF2 | |||||||||||||||||||||||||||||||||||||||
| Region | 192 – 435 | 244 | Interaction with caspase-3 | |||||||||||||||||||||||||||||||||||||||
| Region | 217 – 480 | 264 | Interaction with caspase-8 subunits p18 and p10 | |||||||||||||||||||||||||||||||||||||||
| Region | 263 – 358 | 96 | Caspase | |||||||||||||||||||||||||||||||||||||||
| Region | 370 – 480 | 111 | Interaction with caspase-8 | |||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 245 | 245 | Missing in isoform 4. | VSP_000825 | ||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 96 | 96 | Missing in isoform 3, isoform 7 and isoform 15. | VSP_000824 | ||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 2 – 30 | 29 | SAEVI…RDVAI → LERPPVCSKV in isoform 6. | VSP_000826 | ||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 203 – 480 | 278 | Missing in isoform 13. | VSP_000831 | ||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 203 – 237 | 35 | Missing in isoform 8 and isoform 9. | VSP_000830 | ||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 203 – 221 | 19 | LHNGR…LGAQQ → MITPYAHCPDLKILGNCSM in isoform 2. | VSP_000828 | ||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 203 – 221 | 19 | LHNGR…LGAQQ → E in isoform 7. | VSP_000827 | ||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 222 – 480 | 259 | Missing in isoform 2. | VSP_000829 | ||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 265 – 292 | 28 | ELLRD…GISQI → GWSAMAQSQLTAISTSQVQA ILLPQPPE in isoform 12. | VSP_000832 | ||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 266 – 300 | 35 | LLRDT…FACMP → NAHSWIFTLNSMATCMIGTA EFLPRRNIMFGCSTL in isoform 10. | VSP_000834 | ||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 267 – 305 | 39 | LRDTF…EHRDY → CGVRGPAGGQQPLGGGWASD EECGIQGSEARAVHSSPRS in isoform 9. | VSP_000836 | ||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 293 – 480 | 188 | Missing in isoform 12. | VSP_000833 | ||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 301 – 480 | 180 | Missing in isoform 10. | VSP_000835 | ||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 306 – 480 | 175 | Missing in isoform 9. | VSP_000837 | ||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 436 – 480 | 45 | KRPLL…ILSYT → GTIPGSGITESKDMHFSSLG CILLDVL in isoform 11, isoform 7 and isoform 3. | VSP_000838 | ||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 436 – 480 | 45 | Missing in isoform 14. | VSP_000839 | ||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 449 – 480 | 32 | YMYDW…ILSYT → L in isoform 5. | VSP_000840 | ||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 453 – 480 | 28 | WNSRV…ILSYT → SLEHTGGRY in isoform 6. | VSP_000841 | ||||||||||||||||||||||||||||||||||||||
| Natural variant | 203 | 1 | L → I. Corresponds to variant rs13424615 [ dbSNP | Ensembl ]. | VAR_048619 | ||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 360 | 1 | Y → F: Decreases apoptosis-inducing activity. Reduces interaction with caspase-3 and proteolytic processing. Ref.1 | |||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 376 | 1 | D → N or A: Abolishes proteolytic processing. Ref.4 | |||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 130 – 132 | 3 | SFL → ISW in AAC15825. Ref.8 | |||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 130 – 132 | 3 | SFL → ISW in AAC15826. Ref.8 | |||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 343 | 1 | D → E in AAC15825. Ref.8 | |||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 364 | 1 | E → D in AAB99794. Ref.6 | |||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 366 – 368 | 3 | QLE → PAG in AAC15825. Ref.8 | |||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 369 | 1 | D → N in CAA74366. Ref.7 | |||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 372 | 1 | L → F in AAB99793. Ref.6 | |||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 373 – 374 | 2 | LE → WR in AAC15825. Ref.8 | |||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 239 – 241 | 3 | ||||||||||||||||||||||||||||||||||||||||
| Beta strand | 249 – 260 | 12 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 266 – 274 | 9 | ||||||||||||||||||||||||||||||||||||||||
| Beta strand | 276 – 283 | 8 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 286 – 297 | 12 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 300 – 304 | 5 | ||||||||||||||||||||||||||||||||||||||||
| Beta strand | 306 – 317 | 12 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 333 – 340 | 8 | ||||||||||||||||||||||||||||||||||||||||
| Turn | 342 – 344 | 3 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 346 – 348 | 3 | ||||||||||||||||||||||||||||||||||||||||
| Beta strand | 353 – 361 | 9 | ||||||||||||||||||||||||||||||||||||||||
| Beta strand | 400 – 409 | 10 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 410 – 412 | 3 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 422 – 433 | 12 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 439 – 454 | 16 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 459 – 461 | 3 | ||||||||||||||||||||||||||||||||||||||||
| Beta strand | 463 – 469 | 7 | ||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Casper is a FADD- and caspase-related inducer of apoptosis." Shu H.-B., Halpin D.R., Goeddel D.V. Immunity 6:751-763(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 13 AND 14), MUTAGENESIS OF TYR-360. Tissue: Embryonic kidney and Umbilical vein endothelial cell. |
| [2] | "MRIT, a novel death-effector domain-containing protein, interacts with caspases and BclXL and initiates cell death." Han D.K.M., Chaudhary P.M., Wright M.E., Friedman C., Trask B.J., Riedel R.T., Baskin D.G., Schwartz S.M., Hood L. Proc. Natl. Acad. Sci. U.S.A. 94:11333-11338(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3). |
| [3] | "Inhibition of death receptor signals by cellular FLIP." Irmler M., Thome M., Hahne M., Schneider P., Hofmann K., Steiner V., Bodmer J.-L., Schroeter M., Burns K., Mattmann C., Rimoldi D., French L.E., Tschopp J. Nature 388:190-195(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). Tissue: Peripheral blood lymphocyte. |
| [4] | "FLAME-1, a novel FADD-like anti-apoptotic molecule that regulates Fas/TNFR1-induced apoptosis." Srinivasula S.M., Ahmad M., Ottilie S., Bullrich F., Banks S., Wang Y., Fernandes-Alnemri T., Croce C.M., Litwack G., Tomaselli K.J., Armstrong R.C., Alnemri E.S. J. Biol. Chem. 272:18542-18545(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 8; 9 AND 10), MUTAGENESIS OF ASP-376. Tissue: T-cell. |
| [5] | "I-FLICE, a novel inhibitor of tumor necrosis factor receptor-1- and CD-95-induced apoptosis." Hu S., Vincenz C., Ni J., Gentz R., Dixit V.M. J. Biol. Chem. 272:17255-17257(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Umbilical vein endothelial cell. |
| [6] | Hu S., Dixit V.M. Submitted (JAN-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 4; 5; 6 AND 7). |
| [7] | "CASH, a novel caspase homologue with death effector domains." Goltsev Y.V., Kovalenko A.V., Arnold E., Varfolomeev E.E., Brodianskii V.M., Wallach D. J. Biol. Chem. 272:19641-19644(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). Tissue: Skin fibroblast. |
| [8] | "CLARP, a death effector domain-containing protein interacts with caspase-8 and regulates apoptosis." Inohara N., Koseki T., Hu Y., Chen S., Nunez G. Proc. Natl. Acad. Sci. U.S.A. 94:10717-10722(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). Tissue: Colon carcinoma. |
| [9] | "Cell death attenuation by 'Usurpin', a mammalian DED-caspase homologue that precludes caspase-8 recruitment and activation by the CD-95 (Fas, APO-1) receptor complex." Rasper D.M., Vaillancourt J.P., Hadano S., Houtzager V.M., Seiden I., Keen S.L.C., Tawa P., Xanthoudakis S., Nasir J., Martindale D., Koop B.F., Peterson E.P., Thornberry N.A., Huang J., MacPherson D.P., Black S.C., Hornung F., Lenardo M.J. Nicholson D.W.Cell Death Differ. 5:271-288(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 11 AND 12). Tissue: Kidney. |
| [10] | "Cloning and characterization of three novel genes, ALS2CR1, ALS2CR2, and ALS2CR3, in the juvenile amyotrophic lateral sclerosis (ALS2) critical region at chromosome 2q33-q34: candidate genes for ALS2." Hadano S., Yanagisawa Y., Skaug J., Fichter K., Nasir J., Martindale D., Koop B.F., Scherer S.W., Nicholson D.W., Rouleau G.A., Ikeda J.-E., Hayden M.R. Genomics 71:200-213(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [11] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [12] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3 AND 15). Tissue: Cerebellum, Corpus callosum and Subthalamic nucleus. |
| [13] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [14] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [15] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Lymph. |
| [16] | "The role of c-FLIP in modulation of CD95-induced apoptosis." Scaffidi C., Schmitz I., Krammer P.H., Peter M.E. J. Biol. Chem. 274:1541-1548(1999) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [17] | "Cell cycle-dependent regulation of FLIP levels and susceptibility to Fas-mediated apoptosis." Algeciras-Schimnich A., Griffith T.S., Lynch D.H., Paya C.V. J. Immunol. 162:5205-5211(1999) [PubMed] [Europe PMC] [Abstract] Cited for: INDUCTION. |
| [18] | "Pro-apoptotic function of HBV X protein is mediated by interaction with c-FLIP and enhancement of death-inducing signal." Kim K.H., Seong B.L. EMBO J. 22:2104-2116(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH HBV PROTEIN X. |
| [19] | "An unappreciated role for RNA surveillance." Hillman R.T., Green R.E., Brenner S.E. Genome Biol. 5:R8.1-R8.16(2004) [PubMed] [Europe PMC] [Abstract] Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S). |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF010127 mRNA. Translation: AAB64110.1. U85059 mRNA. Translation: AAB82648.1. U97074 mRNA. Translation: AAC51622.1. U97075 mRNA. Translation: AAC51623.1. AF009616 mRNA. Translation: AAB70909.1. AF009617 mRNA. Translation: AAB70910.1. AF009618 mRNA. Translation: AAB70911.1. AF009619 mRNA. Translation: AAB70912.1. AF041458 mRNA. Translation: AAB99790.1. AF041459 mRNA. Translation: AAB99791.1. AF041462 mRNA. Translation: AAB99794.1. AF041461 mRNA. Translation: AAB99793.1. AF041460 mRNA. Translation: AAB99792.1. Y14039 mRNA. Translation: CAA74366.1. Y14040 mRNA. Translation: CAA74367.1. AF005774 mRNA. Translation: AAC15825.1. AF005775 mRNA. Translation: AAC15826.1. AF015450 mRNA. Translation: AAC16439.1. AF015451 mRNA. Translation: AAC16440.1. AF015452 mRNA. Translation: AAC16441.1. AB038972 Genomic DNA. Translation: BAB32551.1. AB038972 Genomic DNA. Translation: BAB32552.1. BT006751 mRNA. Translation: AAP35397.1. AK289913 mRNA. Translation: BAF82602.1. AK296036 mRNA. Translation: BAG58802.1. AK315208 mRNA. Translation: BAG37645.1. AK315924 mRNA. Translation: BAH14295.1. AC007283 Genomic DNA. Translation: AAY24290.1. CH471063 Genomic DNA. Translation: EAW70237.1. CH471063 Genomic DNA. Translation: EAW70244.1. BC001602 mRNA. Translation: AAH01602.1. | ||||||||||||||||||
| IPI | IPI00007287. IPI00216956. IPI00216957. IPI00216959. IPI00216960. IPI00216962. IPI00216963. IPI00219239. IPI00219241. IPI00219242. IPI00219243. IPI00394836. IPI00414806. IPI00978912. | ||||||||||||||||||
| RefSeq | NP_001120655.1. NM_001127183.2. NP_001120656.1. NM_001127184.2. NP_001189444.1. NM_001202515.1. NP_001189445.1. NM_001202516.1. NP_001189446.1. NM_001202517.1. NP_001189447.1. NM_001202518.1. NP_001189448.1. NM_001202519.1. NP_003870.4. NM_003879.5. | ||||||||||||||||||
| UniGene | Hs.390736. Hs.731912. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | O15519. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| DIP | DIP-27629N. | ||||||||||||||||||
| IntAct | O15519. 13 interactions. | ||||||||||||||||||
| MINT | MINT-1529273. | ||||||||||||||||||
Protein family/group databases | |||||||||||||||||||
| MEROPS | C14.971. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | O15519. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PaxDb | O15519. | ||||||||||||||||||
| PRIDE | O15519. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| DNASU | 8837. | ||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000309955; ENSP00000312455; ENSG00000003402. ENST00000340870; ENSP00000339326; ENSG00000003402. ENST00000341222; ENSP00000339335; ENSG00000003402. ENST00000341582; ENSP00000345807; ENSG00000003402. ENST00000342795; ENSP00000342809; ENSG00000003402. ENST00000423241; ENSP00000399420; ENSG00000003402. ENST00000440180; ENSP00000406775; ENSG00000003402. ENST00000443227; ENSP00000413270; ENSG00000003402. ENST00000457277; ENSP00000411535; ENSG00000003402. ENST00000479953; ENSP00000471805; ENSG00000003402. | ||||||||||||||||||
| GeneID | 8837. | ||||||||||||||||||
| KEGG | hsa:8837. | ||||||||||||||||||
| UCSC | uc002uwz.3. human. uc002uxb.4. human. uc002uxc.4. human. uc002uxf.3. human. uc002uxg.3. human. uc010fsz.3. human. uc010zhk.2. human. uc021vuw.1. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 8837. | ||||||||||||||||||
| GeneCards | GC02P201980. | ||||||||||||||||||
| HGNC | HGNC:1876. CFLAR. | ||||||||||||||||||
| HPA | CAB022157. CAB025216. HPA019044. | ||||||||||||||||||
| MIM | 603599. gene. | ||||||||||||||||||
| neXtProt | NX_O15519. | ||||||||||||||||||
| PharmGKB | PA26425. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | NOG331323. | ||||||||||||||||||
| HOVERGEN | HBG050918. | ||||||||||||||||||
| InParanoid | O15519. | ||||||||||||||||||
| KO | K04724. | ||||||||||||||||||
| OMA | YDWNSRV. | ||||||||||||||||||
| OrthoDB | EOG4DJJX0. | ||||||||||||||||||
| PhylomeDB | O15519. | ||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||
| Pathway_Interaction_DB | faspathway. FAS signaling pathway (CD95). hivnefpathway. HIV-1 Nef: Negative effector of Fas and TNF-alpha. trail_pathway. TRAIL signaling pathway. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | O15519. | ||||||||||||||||||
| Bgee | O15519. | ||||||||||||||||||
| Genevestigator | O15519. | ||||||||||||||||||
| GermOnline | ENSG00000003402. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| Gene3D | 1.10.533.10. 3 hits. | ||||||||||||||||||
| InterPro | IPR011029. DEATH-like_dom. IPR001875. DED. IPR011600. Pept_C14_cat. IPR001309. Pept_C14_ICE_p20. IPR002398. Pept_C14_p45. IPR015917. Pept_C14_p45_core. [Graphical view] | ||||||||||||||||||
| PANTHER | PTHR10454. PTHR10454. 1 hit. | ||||||||||||||||||
| Pfam | PF01335. DED. 2 hits. PF00656. Peptidase_C14. 1 hit. [Graphical view] | ||||||||||||||||||
| SMART | SM00115. CASc. 1 hit. SM00031. DED. 2 hits. [Graphical view] | ||||||||||||||||||
| SUPFAM | SSF47986. DEATH_like. 2 hits. | ||||||||||||||||||
| PROSITE | PS50208. CASPASE_P20. 1 hit. PS50168. DED. 2 hits. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| ChEMBL | CHEMBL1955713. | ||||||||||||||||||
| ChiTaRS | CFLAR. human. | ||||||||||||||||||
| EvolutionaryTrace | O15519. | ||||||||||||||||||
| GenomeRNAi | 8837. | ||||||||||||||||||
| NextBio | 33168. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | CFLAR_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O15519 Secondary accession number(s): B4DJE0 Q9UEW1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Peptidase families Classification of peptidase families and list of entries |
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
