Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Alpha-2,8-sialyltransferase 8E

Gene

ST8SIA5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May be involved in the synthesis of gangliosides GD1c, GT1a, GQ1b and GT3 from GD1a, GT1b, GM1b and GD3 respectively.1 Publication

Pathwayi: protein glycosylation

This protein is involved in the pathway protein glycosylation, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein glycosylation and in Protein modification.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei192SubstrateBy similarity1
Active sitei348Proton donor/acceptorBy similarity1

GO - Molecular functioni

  • alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity Source: Reactome
  • sialyltransferase activity Source: ProtInc

GO - Biological processi

  • carbohydrate metabolic process Source: ProtInc
  • glycosphingolipid biosynthetic process Source: ProtInc
  • protein glycosylation Source: UniProtKB-UniPathway

Keywordsi

Molecular functionGlycosyltransferase, Transferase

Enzyme and pathway databases

ReactomeiR-HSA-4085001 Sialic acid metabolism
UniPathwayiUPA00378

Protein family/group databases

CAZyiGT29 Glycosyltransferase Family 29

Chemistry databases

SwissLipidsiSLP:000001361 [O15466-1]

Names & Taxonomyi

Protein namesi
Recommended name:
Alpha-2,8-sialyltransferase 8E (EC:2.4.99.-)
Alternative name(s):
Sialyltransferase 8E
Short name:
SIAT8-E
Sialyltransferase St8Sia V
Short name:
ST8SiaV
Gene namesi
Name:ST8SIA5
Synonyms:SIAT8E
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 18

Organism-specific databases

EuPathDBiHostDB:ENSG00000101638.13
HGNCiHGNC:17827 ST8SIA5
MIMi607162 gene
neXtProtiNX_O15466

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 17CytoplasmicSequence analysisAdd BLAST17
Transmembranei18 – 38Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST21
Topological domaini39 – 376LumenalSequence analysisAdd BLAST338

Keywords - Cellular componenti

Golgi apparatus, Membrane

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000101638
PharmGKBiPA38249

Polymorphism and mutation databases

BioMutaiST8SIA5

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001492961 – 376Alpha-2,8-sialyltransferase 8EAdd BLAST376

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi56N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi96N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi164 ↔ 313By similarity
Disulfide bondi178 ↔ 373By similarity
Glycosylationi241N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi284N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiO15466
PeptideAtlasiO15466
PRIDEiO15466
ProteomicsDBi48682

PTM databases

iPTMnetiO15466
PhosphoSitePlusiO15466

Expressioni

Tissue specificityi

Expressed in fetal and adult brain, adult heart and skeletal muscle.1 Publication

Gene expression databases

BgeeiENSG00000101638
CleanExiHS_ST8SIA5
ExpressionAtlasiO15466 baseline and differential
GenevisibleiO15466 HS

Organism-specific databases

HPAiHPA043813
HPA046771

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
APPBP2Q926243EBI-10182857,EBI-743771

Protein-protein interaction databases

BioGridi118954, 2 interactors
IntActiO15466, 1 interactor
STRINGi9606.ENSP00000321343

Structurei

3D structure databases

ProteinModelPortaliO15466
SMRiO15466
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni214 – 216Substrate bindingBy similarity3
Regioni300 – 302Substrate bindingBy similarity3

Sequence similaritiesi

Belongs to the glycosyltransferase 29 family.Curated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG2692 Eukaryota
ENOG410XT8P LUCA
GeneTreeiENSGT00550000074407
HOGENOMiHOG000090201
HOVERGENiHBG106106
InParanoidiO15466
KOiK03369
OMAiNSKCGKE
OrthoDBiEOG091G0CER
PhylomeDBiO15466
TreeFamiTF323961

Family and domain databases

Gene3Di3.90.1480.20, 1 hit
InterProiView protein in InterPro
IPR001675 Glyco_trans_29
IPR038578 GT29-like_sf
IPR012163 Sialyl_trans
PfamiView protein in Pfam
PF00777 Glyco_transf_29, 1 hit
PIRSFiPIRSF005557 Sialyl_trans, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O15466-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRYADPSANR DLLGSRTLLF IFICAFALVT LLQQILYGRN YIKRYFEFYE
60 70 80 90 100
GPFEYNSTRC LELRHEILEV KVLSMVKQSE LFDRWKSLQM CKWAMNISEA
110 120 130 140 150
NQFKSTLSRC CNAPAFLFTT QKNTPLGTKL KYEVDTSGIY HINQEIFRMF
160 170 180 190 200
PKDMPYYRSQ FKKCAVVGNG GILKNSRCGR EINSADFVFR CNLPPISEKY
210 220 230 240 250
TMDVGVKTDV VTVNPSIITE RFHKLEKWRR PFYRVLQVYE NASVLLPAFY
260 270 280 290 300
NTRNTDVSIR VKYVLDDFES PQAVYYFHPQ YLVNVSRYWL SLGVRAKRIS
310 320 330 340 350
TGLILVTAAL ELCEEVHLFG FWAFPMNPSG LYITHHYYDN VKPRPGFHAM
360 370
PSEIFNFLHL HSRGILRVHT GTCSCC
Length:376
Mass (Da):43,895
Last modified:September 23, 2008 - v2
Checksum:i15B57F3E06080236
GO
Isoform 2 (identifier: O15466-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     43-43: K → KRGLQFGWQSGDQLTNWTGLFNVTDDPAVQSGSDSSS

Note: No experimental confirmation available.
Show »
Length:412
Mass (Da):47,736
Checksum:iAA154B3E9DA1168B
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti8A → P in AAC51727 (PubMed:9199191).Curated1
Sequence conflicti347F → G in AAC51727 (PubMed:9199191).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_05666443K → KRGLQFGWQSGDQLTNWTGL FNVTDDPAVQSGSDSSS in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U91641 mRNA Translation: AAC51727.1
AK056270 mRNA Translation: BAG51661.1
AK293608 mRNA Translation: BAH11545.1
CR457037 mRNA Translation: CAG33318.1
AC064800 Genomic DNA No translation available.
AC090241 Genomic DNA No translation available.
AC090311 Genomic DNA No translation available.
CH471088 Genomic DNA Translation: EAX01483.1
BC108910 mRNA Translation: AAI08911.1
BC108911 mRNA Translation: AAI08912.1
CCDSiCCDS11930.1 [O15466-1]
CCDS77184.1 [O15466-2]
PIRiJC5600
RefSeqiNP_001294915.1, NM_001307986.1 [O15466-2]
NP_001294916.1, NM_001307987.1
NP_037437.2, NM_013305.5 [O15466-1]
UniGeneiHs.465025

Genome annotation databases

EnsembliENST00000315087; ENSP00000321343; ENSG00000101638 [O15466-1]
ENST00000538168; ENSP00000445492; ENSG00000101638 [O15466-2]
GeneIDi29906
KEGGihsa:29906
UCSCiuc002lcj.2 human [O15466-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiSIA8E_HUMAN
AccessioniPrimary (citable) accession number: O15466
Secondary accession number(s): B7Z1K9, Q6IAW7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 11, 2002
Last sequence update: September 23, 2008
Last modified: June 20, 2018
This is version 144 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 18
    Human chromosome 18: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  4. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health