Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Alpha-2,8-sialyltransferase 8E

Gene

ST8SIA5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May be involved in the synthesis of gangliosides GD1c, GT1a, GQ1b and GT3 from GD1a, GT1b, GM1b and GD3 respectively.1 Publication

Pathwayi: protein glycosylation

This protein is involved in the pathway protein glycosylation, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein glycosylation and in Protein modification.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei192 – 1921SubstrateBy similarity
Active sitei348 – 3481Proton donor/acceptorBy similarity

GO - Molecular functioni

  • alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity Source: Reactome
  • sialyltransferase activity Source: ProtInc

GO - Biological processi

  • carbohydrate metabolic process Source: ProtInc
  • glycosphingolipid biosynthetic process Source: ProtInc
  • protein glycosylation Source: UniProtKB-UniPathway
Complete GO annotation...

Keywords - Molecular functioni

Glycosyltransferase, Transferase

Enzyme and pathway databases

ReactomeiR-HSA-4085001. Sialic acid metabolism.
UniPathwayiUPA00378.

Protein family/group databases

CAZyiGT29. Glycosyltransferase Family 29.

Chemistry

SwissLipidsiSLP:000001361. [O15466-1]

Names & Taxonomyi

Protein namesi
Recommended name:
Alpha-2,8-sialyltransferase 8E (EC:2.4.99.-)
Alternative name(s):
Sialyltransferase 8E
Short name:
SIAT8-E
Sialyltransferase St8Sia V
Short name:
ST8SiaV
Gene namesi
Name:ST8SIA5
Synonyms:SIAT8E
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 18

Organism-specific databases

HGNCiHGNC:17827. ST8SIA5.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 1717CytoplasmicSequence analysisAdd
BLAST
Transmembranei18 – 3821Helical; Signal-anchor for type II membrane proteinSequence analysisAdd
BLAST
Topological domaini39 – 376338LumenalSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Golgi apparatus, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA38249.

Polymorphism and mutation databases

BioMutaiST8SIA5.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 376376Alpha-2,8-sialyltransferase 8EPRO_0000149296Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi56 – 561N-linked (GlcNAc...)Sequence analysis
Glycosylationi96 – 961N-linked (GlcNAc...)Sequence analysis
Disulfide bondi164 ↔ 313By similarity
Disulfide bondi178 ↔ 373By similarity
Glycosylationi241 – 2411N-linked (GlcNAc...)Sequence analysis
Glycosylationi284 – 2841N-linked (GlcNAc...)Sequence analysis

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

EPDiO15466.
PaxDbiO15466.
PeptideAtlasiO15466.
PRIDEiO15466.

PTM databases

iPTMnetiO15466.
PhosphoSiteiO15466.

Expressioni

Tissue specificityi

Expressed in fetal and adult brain, adult heart and skeletal muscle.1 Publication

Gene expression databases

BgeeiO15466.
CleanExiHS_ST8SIA5.
ExpressionAtlasiO15466. baseline and differential.
GenevisibleiO15466. HS.

Organism-specific databases

HPAiHPA043813.
HPA046771.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
APPBP2Q926243EBI-10182857,EBI-743771

Protein-protein interaction databases

BioGridi118954. 2 interactions.
IntActiO15466. 1 interaction.
STRINGi9606.ENSP00000321343.

Structurei

3D structure databases

ProteinModelPortaliO15466.
SMRiO15466. Positions 120-374.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni214 – 2163Substrate bindingBy similarity
Regioni300 – 3023Substrate bindingBy similarity

Sequence similaritiesi

Belongs to the glycosyltransferase 29 family.Curated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG2692. Eukaryota.
ENOG410XT8P. LUCA.
GeneTreeiENSGT00550000074407.
HOGENOMiHOG000090201.
HOVERGENiHBG106106.
InParanoidiO15466.
KOiK03369.
OMAiIFITHHY.
OrthoDBiEOG7SV0V9.
PhylomeDBiO15466.
TreeFamiTF323961.

Family and domain databases

InterProiIPR001675. Glyco_trans_29.
IPR012163. Sialyl_trans.
[Graphical view]
PfamiPF00777. Glyco_transf_29. 1 hit.
[Graphical view]
PIRSFiPIRSF005557. Sialyl_trans. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O15466-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRYADPSANR DLLGSRTLLF IFICAFALVT LLQQILYGRN YIKRYFEFYE
60 70 80 90 100
GPFEYNSTRC LELRHEILEV KVLSMVKQSE LFDRWKSLQM CKWAMNISEA
110 120 130 140 150
NQFKSTLSRC CNAPAFLFTT QKNTPLGTKL KYEVDTSGIY HINQEIFRMF
160 170 180 190 200
PKDMPYYRSQ FKKCAVVGNG GILKNSRCGR EINSADFVFR CNLPPISEKY
210 220 230 240 250
TMDVGVKTDV VTVNPSIITE RFHKLEKWRR PFYRVLQVYE NASVLLPAFY
260 270 280 290 300
NTRNTDVSIR VKYVLDDFES PQAVYYFHPQ YLVNVSRYWL SLGVRAKRIS
310 320 330 340 350
TGLILVTAAL ELCEEVHLFG FWAFPMNPSG LYITHHYYDN VKPRPGFHAM
360 370
PSEIFNFLHL HSRGILRVHT GTCSCC
Length:376
Mass (Da):43,895
Last modified:September 23, 2008 - v2
Checksum:i15B57F3E06080236
GO
Isoform 2 (identifier: O15466-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     43-43: K → KRGLQFGWQSGDQLTNWTGLFNVTDDPAVQSGSDSSS

Note: No experimental confirmation available.
Show »
Length:412
Mass (Da):47,736
Checksum:iAA154B3E9DA1168B
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti8 – 81A → P in AAC51727 (PubMed:9199191).Curated
Sequence conflicti347 – 3471F → G in AAC51727 (PubMed:9199191).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei43 – 431K → KRGLQFGWQSGDQLTNWTGL FNVTDDPAVQSGSDSSS in isoform 2. 1 PublicationVSP_056664

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U91641 mRNA. Translation: AAC51727.1.
AK056270 mRNA. Translation: BAG51661.1.
AK293608 mRNA. Translation: BAH11545.1.
CR457037 mRNA. Translation: CAG33318.1.
AC064800 Genomic DNA. No translation available.
AC090241 Genomic DNA. No translation available.
AC090311 Genomic DNA. No translation available.
CH471088 Genomic DNA. Translation: EAX01483.1.
BC108910 mRNA. Translation: AAI08911.1.
BC108911 mRNA. Translation: AAI08912.1.
CCDSiCCDS11930.1. [O15466-1]
CCDS77184.1. [O15466-2]
PIRiJC5600.
RefSeqiNP_001294915.1. NM_001307986.1. [O15466-2]
NP_001294916.1. NM_001307987.1.
NP_037437.2. NM_013305.5. [O15466-1]
UniGeneiHs.465025.

Genome annotation databases

EnsembliENST00000315087; ENSP00000321343; ENSG00000101638. [O15466-1]
ENST00000538168; ENSP00000445492; ENSG00000101638. [O15466-2]
GeneIDi29906.
KEGGihsa:29906.
UCSCiuc002lcj.2. human. [O15466-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Web resourcesi

Functional Glycomics Gateway - GTase

ST8Sia V

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U91641 mRNA. Translation: AAC51727.1.
AK056270 mRNA. Translation: BAG51661.1.
AK293608 mRNA. Translation: BAH11545.1.
CR457037 mRNA. Translation: CAG33318.1.
AC064800 Genomic DNA. No translation available.
AC090241 Genomic DNA. No translation available.
AC090311 Genomic DNA. No translation available.
CH471088 Genomic DNA. Translation: EAX01483.1.
BC108910 mRNA. Translation: AAI08911.1.
BC108911 mRNA. Translation: AAI08912.1.
CCDSiCCDS11930.1. [O15466-1]
CCDS77184.1. [O15466-2]
PIRiJC5600.
RefSeqiNP_001294915.1. NM_001307986.1. [O15466-2]
NP_001294916.1. NM_001307987.1.
NP_037437.2. NM_013305.5. [O15466-1]
UniGeneiHs.465025.

3D structure databases

ProteinModelPortaliO15466.
SMRiO15466. Positions 120-374.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi118954. 2 interactions.
IntActiO15466. 1 interaction.
STRINGi9606.ENSP00000321343.

Chemistry

SwissLipidsiSLP:000001361. [O15466-1]

Protein family/group databases

CAZyiGT29. Glycosyltransferase Family 29.

PTM databases

iPTMnetiO15466.
PhosphoSiteiO15466.

Polymorphism and mutation databases

BioMutaiST8SIA5.

Proteomic databases

EPDiO15466.
PaxDbiO15466.
PeptideAtlasiO15466.
PRIDEiO15466.

Protocols and materials databases

DNASUi29906.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000315087; ENSP00000321343; ENSG00000101638. [O15466-1]
ENST00000538168; ENSP00000445492; ENSG00000101638. [O15466-2]
GeneIDi29906.
KEGGihsa:29906.
UCSCiuc002lcj.2. human. [O15466-1]

Organism-specific databases

CTDi29906.
GeneCardsiST8SIA5.
HGNCiHGNC:17827. ST8SIA5.
HPAiHPA043813.
HPA046771.
MIMi607162. gene.
neXtProtiNX_O15466.
PharmGKBiPA38249.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2692. Eukaryota.
ENOG410XT8P. LUCA.
GeneTreeiENSGT00550000074407.
HOGENOMiHOG000090201.
HOVERGENiHBG106106.
InParanoidiO15466.
KOiK03369.
OMAiIFITHHY.
OrthoDBiEOG7SV0V9.
PhylomeDBiO15466.
TreeFamiTF323961.

Enzyme and pathway databases

UniPathwayiUPA00378.
ReactomeiR-HSA-4085001. Sialic acid metabolism.

Miscellaneous databases

ChiTaRSiST8SIA5. human.
GenomeRNAii29906.
PROiO15466.
SOURCEiSearch...

Gene expression databases

BgeeiO15466.
CleanExiHS_ST8SIA5.
ExpressionAtlasiO15466. baseline and differential.
GenevisibleiO15466. HS.

Family and domain databases

InterProiIPR001675. Glyco_trans_29.
IPR012163. Sialyl_trans.
[Graphical view]
PfamiPF00777. Glyco_transf_29. 1 hit.
[Graphical view]
PIRSFiPIRSF005557. Sialyl_trans. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning and expression of human alpha2,8-sialyltransferase (hST8Sia V)."
    Kim Y.-J., Kim K.-S., Do S.-I., Kim C.-H., Kim S.-K., Lee Y.-C.
    Biochem. Biophys. Res. Commun. 235:327-330(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY.
    Tissue: Brain.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Cerebellum and Teratocarcinoma.
  3. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
    Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
    Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).

Entry informationi

Entry nameiSIA8E_HUMAN
AccessioniPrimary (citable) accession number: O15466
Secondary accession number(s): B7Z1K9, Q6IAW7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 11, 2002
Last sequence update: September 23, 2008
Last modified: July 6, 2016
This is version 134 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 18
    Human chromosome 18: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.