Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O15438

- MRP3_HUMAN

UniProt

O15438 - MRP3_HUMAN

Protein

Canalicular multispecific organic anion transporter 2

Gene

ABCC3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 140 (01 Oct 2014)
      Sequence version 3 (30 May 2000)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May act as an inducible transporter in the biliary and intestinal excretion of organic anions. Acts as an alternative route for the export of bile acids and glucuronides from cholestatic hepatocytes By similarity.By similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi661 – 6688ATP 1PROSITE-ProRule annotation
    Nucleotide bindingi1323 – 13308ATP 2PROSITE-ProRule annotation

    GO - Molecular functioni

    1. ATPase activity, coupled to transmembrane movement of substances Source: ProtInc
    2. ATP binding Source: ProtInc
    3. organic anion transmembrane transporter activity Source: ProtInc

    GO - Biological processi

    1. bile acid and bile salt transport Source: Reactome
    2. bile acid metabolic process Source: Reactome
    3. small molecule metabolic process Source: Reactome
    4. transmembrane transport Source: Reactome
    5. transport Source: ProtInc

    Keywords - Biological processi

    Transport

    Keywords - Ligandi

    ATP-binding, Nucleotide-binding

    Enzyme and pathway databases

    ReactomeiREACT_11042. Recycling of bile acids and salts.
    REACT_15480. ABC-family proteins mediated transport.

    Protein family/group databases

    TCDBi3.A.1.208.9. the atp-binding cassette (abc) superfamily.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Canalicular multispecific organic anion transporter 2
    Alternative name(s):
    ATP-binding cassette sub-family C member 3
    Multi-specific organic anion transporter D
    Short name:
    MOAT-D
    Multidrug resistance-associated protein 3
    Gene namesi
    Name:ABCC3
    Synonyms:CMOAT2, MLP2, MRP3
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 17

    Organism-specific databases

    HGNCiHGNC:54. ABCC3.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of plasma membrane Source: ProtInc
    2. membrane Source: ProtInc
    3. plasma membrane Source: Reactome

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA376.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 15271527Canalicular multispecific organic anion transporter 2PRO_0000093360Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi18 – 181N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1006 – 10061N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1007 – 10071N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    MaxQBiO15438.
    PaxDbiO15438.
    PRIDEiO15438.

    PTM databases

    PhosphoSiteiO15438.

    Expressioni

    Tissue specificityi

    Mainly expressed in the liver. Also expressed in small intestine, colon, prostate, testis, brain and at a lower level in the kidney.

    Gene expression databases

    ArrayExpressiO15438.
    BgeeiO15438.
    CleanExiHS_ABCC3.
    GenevestigatoriO15438.

    Organism-specific databases

    HPAiCAB037136.
    HPA048483.

    Interactioni

    Protein-protein interaction databases

    BioGridi114255. 2 interactions.
    IntActiO15438. 5 interactions.
    STRINGi9606.ENSP00000285238.

    Structurei

    3D structure databases

    ProteinModelPortaliO15438.
    SMRiO15438. Positions 626-853.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 3232ExtracellularBy similarityAdd
    BLAST
    Topological domaini54 – 7320CytoplasmicBy similarityAdd
    BLAST
    Topological domaini95 – 995ExtracellularBy similarity
    Topological domaini121 – 13212CytoplasmicBy similarityAdd
    BLAST
    Topological domaini154 – 17118ExtracellularBy similarityAdd
    BLAST
    Topological domaini193 – 302110CytoplasmicBy similarityAdd
    BLAST
    Topological domaini324 – 34926ExtracellularBy similarityAdd
    BLAST
    Topological domaini371 – 42656CytoplasmicBy similarityAdd
    BLAST
    Topological domaini448 – 4503ExtracellularBy similarity
    Topological domaini472 – 53362CytoplasmicBy similarityAdd
    BLAST
    Topological domaini555 – 57622ExtracellularBy similarityAdd
    BLAST
    Topological domaini598 – 963366CytoplasmicBy similarityAdd
    BLAST
    Topological domaini985 – 102137ExtracellularBy similarityAdd
    BLAST
    Topological domaini1043 – 108543CytoplasmicBy similarityAdd
    BLAST
    Topological domaini1107 – 11071ExtracellularBy similarity
    Topological domaini1129 – 119971CytoplasmicBy similarityAdd
    BLAST
    Topological domaini1221 – 12222ExtracellularBy similarity
    Topological domaini1244 – 1527284CytoplasmicBy similarityAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei33 – 5321Helical; Name=1PROSITE-ProRule annotationAdd
    BLAST
    Transmembranei74 – 9421Helical; Name=2PROSITE-ProRule annotationAdd
    BLAST
    Transmembranei100 – 12021Helical; Name=3PROSITE-ProRule annotationAdd
    BLAST
    Transmembranei133 – 15321Helical; Name=4PROSITE-ProRule annotationAdd
    BLAST
    Transmembranei172 – 19221Helical; Name=5PROSITE-ProRule annotationAdd
    BLAST
    Transmembranei303 – 32321Helical; Name=6PROSITE-ProRule annotationAdd
    BLAST
    Transmembranei350 – 37021Helical; Name=7PROSITE-ProRule annotationAdd
    BLAST
    Transmembranei427 – 44721Helical; Name=8PROSITE-ProRule annotationAdd
    BLAST
    Transmembranei451 – 47121Helical; Name=9PROSITE-ProRule annotationAdd
    BLAST
    Transmembranei534 – 55421Helical; Name=10PROSITE-ProRule annotationAdd
    BLAST
    Transmembranei577 – 59721Helical; Name=11PROSITE-ProRule annotationAdd
    BLAST
    Transmembranei964 – 98421Helical; Name=12PROSITE-ProRule annotationAdd
    BLAST
    Transmembranei1022 – 104221Helical; Name=13PROSITE-ProRule annotationAdd
    BLAST
    Transmembranei1086 – 110621Helical; Name=14PROSITE-ProRule annotationAdd
    BLAST
    Transmembranei1108 – 112821Helical; Name=15PROSITE-ProRule annotationAdd
    BLAST
    Transmembranei1200 – 122021Helical; Name=16PROSITE-ProRule annotationAdd
    BLAST
    Transmembranei1223 – 124321Helical; Name=17PROSITE-ProRule annotationAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini311 – 594284ABC transmembrane type-1 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini629 – 851223ABC transporter 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini971 – 1252282ABC transmembrane type-1 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini1291 – 1523233ABC transporter 2PROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 2 ABC transmembrane type-1 domains.PROSITE-ProRule annotation
    Contains 2 ABC transporter domains.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG1132.
    HOVERGENiHBG108314.
    InParanoidiO15438.
    KOiK05667.
    OMAiWNRHENK.
    OrthoDBiEOG7R2BJW.
    PhylomeDBiO15438.
    TreeFamiTF105199.

    Family and domain databases

    Gene3Di3.40.50.300. 2 hits.
    InterProiIPR003593. AAA+_ATPase.
    IPR011527. ABC1_TM_dom.
    IPR003439. ABC_transporter-like.
    IPR017871. ABC_transporter_CS.
    IPR001140. ABC_transptr_TM_dom.
    IPR005292. Multidrug-R_assoc.
    IPR027417. P-loop_NTPase.
    [Graphical view]
    PfamiPF00664. ABC_membrane. 2 hits.
    PF00005. ABC_tran. 2 hits.
    [Graphical view]
    SMARTiSM00382. AAA. 2 hits.
    [Graphical view]
    SUPFAMiSSF52540. SSF52540. 2 hits.
    SSF90123. SSF90123. 2 hits.
    TIGRFAMsiTIGR00957. MRP_assoc_pro. 1 hit.
    PROSITEiPS50929. ABC_TM1F. 2 hits.
    PS00211. ABC_TRANSPORTER_1. 2 hits.
    PS50893. ABC_TRANSPORTER_2. 2 hits.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Note: Additional isoforms seem to exist.

    Isoform 1 (identifier: O15438-1) [UniParc]FASTAAdd to Basket

    Also known as: MRP3

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MDALCGSGEL GSKFWDSNLS VHTENPDLTP CFQNSLLAWV PCIYLWVALP     50
    CYLLYLRHHC RGYIILSHLS KLKMVLGVLL WCVSWADLFY SFHGLVHGRA 100
    PAPVFFVTPL VVGVTMLLAT LLIQYERLQG VQSSGVLIIF WFLCVVCAIV 150
    PFRSKILLAK AEGEISDPFR FTTFYIHFAL VLSALILACF REKPPFFSAK 200
    NVDPNPYPET SAGFLSRLFF WWFTKMAIYG YRHPLEEKDL WSLKEEDRSQ 250
    MVVQQLLEAW RKQEKQTARH KASAAPGKNA SGEDEVLLGA RPRPRKPSFL 300
    KALLATFGSS FLISACFKLI QDLLSFINPQ LLSILIRFIS NPMAPSWWGF 350
    LVAGLMFLCS MMQSLILQHY YHYIFVTGVK FRTGIMGVIY RKALVITNSV 400
    KRASTVGEIV NLMSVDAQRF MDLAPFLNLL WSAPLQIILA IYFLWQNLGP 450
    SVLAGVAFMV LLIPLNGAVA VKMRAFQVKQ MKLKDSRIKL MSEILNGIKV 500
    LKLYAWEPSF LKQVEGIRQG ELQLLRTAAY LHTTTTFTWM CSPFLVTLIT 550
    LWVYVYVDPN NVLDAEKAFV SVSLFNILRL PLNMLPQLIS NLTQASVSLK 600
    RIQQFLSQEE LDPQSVERKT ISPGYAITIH SGTFTWAQDL PPTLHSLDIQ 650
    VPKGALVAVV GPVGCGKSSL VSALLGEMEK LEGKVHMKGS VAYVPQQAWI 700
    QNCTLQENVL FGKALNPKRY QQTLEACALL ADLEMLPGGD QTEIGEKGIN 750
    LSGGQRQRVS LARAVYSDAD IFLLDDPLSA VDSHVAKHIF DHVIGPEGVL 800
    AGKTRVLVTH GISFLPQTDF IIVLADGQVS EMGPYPALLQ RNGSFANFLC 850
    NYAPDEDQGH LEDSWTALEG AEDKEALLIE DTLSNHTDLT DNDPVTYVVQ 900
    KQFMRQLSAL SSDGEGQGRP VPRRHLGPSE KVQVTEAKAD GALTQEEKAA 950
    IGTVELSVFW DYAKAVGLCT TLAICLLYVG QSAAAIGANV WLSAWTNDAM 1000
    ADSRQNNTSL RLGVYAALGI LQGFLVMLAA MAMAAGGIQA ARVLHQALLH 1050
    NKIRSPQSFF DTTPSGRILN CFSKDIYVVD EVLAPVILML LNSFFNAIST 1100
    LVVIMASTPL FTVVILPLAV LYTLVQRFYA ATSRQLKRLE SVSRSPIYSH 1150
    FSETVTGASV IRAYNRSRDF EIISDTKVDA NQRSCYPYII SNRWLSIGVE 1200
    FVGNCVVLFA ALFAVIGRSS LNPGLVGLSV SYSLQVTFAL NWMIRMMSDL 1250
    ESNIVAVERV KEYSKTETEA PWVVEGSRPP EGWPPRGEVE FRNYSVRYRP 1300
    GLDLVLRDLS LHVHGGEKVG IVGRTGAGKS SMTLCLFRIL EAAKGEIRID 1350
    GLNVADIGLH DLRSQLTIIP QDPILFSGTL RMNLDPFGSY SEEDIWWALE 1400
    LSHLHTFVSS QPAGLDFQCS EGGENLSVGQ RQLVCLARAL LRKSRILVLD 1450
    EATAAIDLET DNLIQATIRT QFDTCTVLTI AHRLNTIMDY TRVLVLDKGV 1500
    VAEFDSPANL IAARGIFYGM ARDAGLA 1527
    Length:1,527
    Mass (Da):169,343
    Last modified:May 30, 2000 - v3
    Checksum:i0D1F879B6F18370C
    GO
    Isoform 2 (identifier: O15438-2) [UniParc]FASTAAdd to Basket

    Also known as: MRP3A

    The sequence of this isoform differs from the canonical sequence as follows:
         1194-1527: WLSIGVEFVG...YGMARDAGLA → SEAASLAPCS...ALPLPHFLLI

    Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:1,238
    Mass (Da):137,297
    Checksum:i8E449E28F32BA882
    GO
    Isoform 3 (identifier: O15438-3) [UniParc]FASTAAdd to Basket

    Also known as: MRP3B

    The sequence of this isoform differs from the canonical sequence as follows:
         226-510: MAIYGYRHPL...LKLYAWEPSF → LLNPDPLRGC...IEGLAHQADE
         511-1527: Missing.

    Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:510
    Mass (Da):55,305
    Checksum:iB00B65CBB262DEAA
    GO
    Isoform 4 (identifier: O15438-4) [UniParc]FASTAAdd to Basket

    Also known as: MRP3S1

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MPACTVKESPNCKRNFCKADHIVNTSGGSNLERVGKQKTIQKGQFSQRSVCT

    Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.

    Show »
    Length:1,578
    Mass (Da):174,907
    Checksum:i79A1F68027EBE525
    GO
    Isoform 5 (identifier: O15438-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         547-572: TLITLWVYVYVDPNNVLDAEKAFVSV → RLGTGLGPCLQGSGCPGMARAHWTLP
         573-1527: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:572
    Mass (Da):64,632
    Checksum:iD50802109C86F4DE
    GO

    Sequence cautioni

    The sequence AAB71756.1 differs from that shown. Reason: Frameshift at positions 1334 and 1338.
    The sequence AAD01430.1 differs from that shown. Reason: Frameshift at positions 355, 359 and 361.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti13 – 131K → N in AAH46126. (PubMed:15489334)Curated
    Sequence conflicti42 – 421C → R in CAA76658. (PubMed:10094960)Curated
    Sequence conflicti184 – 1841A → T in AAD02846. (PubMed:9889399)Curated
    Sequence conflicti344 – 3441A → G in AAC34668. (PubMed:9813153)Curated
    Sequence conflicti569 – 5691F → Y in BAA28146. (PubMed:9738950)Curated
    Sequence conflicti1128 – 11281F → C in AAB71756. (PubMed:9270026)Curated
    Sequence conflicti1212 – 12121L → I in AAB71756. (PubMed:9270026)Curated
    Sequence conflicti1249 – 12491D → E in AAB71756. (PubMed:9270026)Curated
    Sequence conflicti1359 – 13591L → F in AAB71756. (PubMed:9270026)Curated
    Sequence conflicti1362 – 13621L → V in AAC34668. (PubMed:9813153)Curated
    Sequence conflicti1362 – 13621L → V in AAB71756. (PubMed:9270026)Curated
    Sequence conflicti1364 – 13641S → C in AAB71756. (PubMed:9270026)Curated
    Sequence conflicti1366 – 13661L → M in AAB71756. (PubMed:9270026)Curated
    Sequence conflicti1371 – 13711Q → R in AAB71756. (PubMed:9270026)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti11 – 111G → D.
    Corresponds to variant rs11568609 [ dbSNP | Ensembl ].
    VAR_029119
    Natural varianti346 – 3461S → F.
    Corresponds to variant rs11568605 [ dbSNP | Ensembl ].
    VAR_020235
    Natural varianti1286 – 12861R → G.
    Corresponds to variant rs11568593 [ dbSNP | Ensembl ].
    VAR_029120
    Natural varianti1297 – 12971R → H.
    Corresponds to variant rs11568591 [ dbSNP | Ensembl ].
    VAR_020237
    Natural varianti1365 – 13651Q → R.
    Corresponds to variant rs11568590 [ dbSNP | Ensembl ].
    VAR_020239
    Natural varianti1381 – 13811R → S.
    Corresponds to variant rs45461799 [ dbSNP | Ensembl ].
    VAR_020240

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11M → MPACTVKESPNCKRNFCKAD HIVNTSGGSNLERVGKQKTI QKGQFSQRSVCT in isoform 4. 1 PublicationVSP_043864
    Alternative sequencei226 – 510285MAIYG…WEPSF → LLNPDPLRGCLPGFTSPQDG HLWLPASPGGEGPLVPKGRG QIPDGGAAAAGGMEEAGKAD GTTQGFSSTWEKCLRRGRGA AGCPAQAPEALLPEGPAGHL RLQLPHQCLLQAYPGPALLH QSTAAQHPDQVYLQPHGPLL VGLPGGWADVPVLHDAVADL TTLLPLHLCDWGEVSYWDHG CHLQEGSGYHQLSQTCVHCG GNCQPHVSGCPALHGPCPLP QSAVVSTPADHPGDLLPLAE PRSLCPGWSRFHGLADSTQR SCGREDARLPGKANEIEGLA HQADE in isoform 3. 1 PublicationVSP_000040Add
    BLAST
    Alternative sequencei511 – 15271017Missing in isoform 3. 1 PublicationVSP_000041Add
    BLAST
    Alternative sequencei547 – 57226TLITL…AFVSV → RLGTGLGPCLQGSGCPGMAR AHWTLP in isoform 5. 1 PublicationVSP_039041Add
    BLAST
    Alternative sequencei573 – 1527955Missing in isoform 5. 1 PublicationVSP_039042Add
    BLAST
    Alternative sequencei1194 – 1527334WLSIG…DAGLA → SEAASLAPCSSRNSQQALWC SGSLSLLSPKQKTGPALPLP HFLLI in isoform 2. 1 PublicationVSP_000042Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF083552 mRNA. Translation: AAC34668.1.
    AB010887 mRNA. Translation: BAA28146.1.
    AF104943 mRNA. Translation: AAD04170.1.
    AF085690 mRNA. Translation: AAD02845.1.
    AF085691 mRNA. Translation: AAD02846.1.
    AF085692 mRNA. Translation: AAD02847.1.
    Y17151 mRNA. Translation: CAA76658.2.
    AF009670 mRNA. Translation: AAD01430.1. Frameshift.
    AF154001 mRNA. Translation: AAD38185.1. Sequence problems.
    AC004590 Genomic DNA. No translation available.
    AC005921 Genomic DNA. No translation available.
    CH471109 Genomic DNA. Translation: EAW94592.1.
    CH471109 Genomic DNA. Translation: EAW94590.1.
    CH471109 Genomic DNA. Translation: EAW94593.1.
    BC046126 mRNA. Translation: AAH46126.1.
    BC137347 mRNA. Translation: AAI37348.1.
    BC137348 mRNA. Translation: AAI37349.1.
    U83659 mRNA. Translation: AAB71756.1. Frameshift.
    CCDSiCCDS32681.1. [O15438-1]
    CCDS45739.1. [O15438-5]
    PIRiJE0336.
    RefSeqiNP_001137542.1. NM_001144070.1. [O15438-5]
    NP_003777.2. NM_003786.3. [O15438-1]
    UniGeneiHs.463421.

    Genome annotation databases

    EnsembliENST00000285238; ENSP00000285238; ENSG00000108846. [O15438-1]
    ENST00000427699; ENSP00000395160; ENSG00000108846. [O15438-5]
    ENST00000502426; ENSP00000427073; ENSG00000108846. [O15438-3]
    ENST00000505699; ENSP00000427521; ENSG00000108846. [O15438-2]
    GeneIDi8714.
    KEGGihsa:8714.
    UCSCiuc002isk.4. human. [O15438-5]
    uc002isl.3. human. [O15438-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    ABCMdb

    Database for mutations in ABC proteins

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF083552 mRNA. Translation: AAC34668.1 .
    AB010887 mRNA. Translation: BAA28146.1 .
    AF104943 mRNA. Translation: AAD04170.1 .
    AF085690 mRNA. Translation: AAD02845.1 .
    AF085691 mRNA. Translation: AAD02846.1 .
    AF085692 mRNA. Translation: AAD02847.1 .
    Y17151 mRNA. Translation: CAA76658.2 .
    AF009670 mRNA. Translation: AAD01430.1 . Frameshift.
    AF154001 mRNA. Translation: AAD38185.1 . Sequence problems.
    AC004590 Genomic DNA. No translation available.
    AC005921 Genomic DNA. No translation available.
    CH471109 Genomic DNA. Translation: EAW94592.1 .
    CH471109 Genomic DNA. Translation: EAW94590.1 .
    CH471109 Genomic DNA. Translation: EAW94593.1 .
    BC046126 mRNA. Translation: AAH46126.1 .
    BC137347 mRNA. Translation: AAI37348.1 .
    BC137348 mRNA. Translation: AAI37349.1 .
    U83659 mRNA. Translation: AAB71756.1 . Frameshift.
    CCDSi CCDS32681.1. [O15438-1 ]
    CCDS45739.1. [O15438-5 ]
    PIRi JE0336.
    RefSeqi NP_001137542.1. NM_001144070.1. [O15438-5 ]
    NP_003777.2. NM_003786.3. [O15438-1 ]
    UniGenei Hs.463421.

    3D structure databases

    ProteinModelPortali O15438.
    SMRi O15438. Positions 626-853.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 114255. 2 interactions.
    IntActi O15438. 5 interactions.
    STRINGi 9606.ENSP00000285238.

    Chemistry

    BindingDBi O15438.
    ChEMBLi CHEMBL5918.
    DrugBanki DB00515. Cisplatin.
    DB00257. Clotrimazole.
    DB00286. Conjugated Estrogens.
    DB00091. Cyclosporine.
    DB00997. Doxorubicin.
    DB00773. Etoposide.
    DB00973. Ezetimibe.
    DB00544. Fluorouracil.
    DB00158. Folic Acid.
    DB08884. Gadoxetate.
    DB00143. Glutathione.
    DB01016. Glyburide.
    DB00328. Indomethacin.
    DB00709. Lamivudine.
    DB00650. Leucovorin.
    DB00563. Methotrexate.
    DB01011. Metyrapone.
    DB01115. Nifedipine.
    DB00338. Omeprazole.
    DB01174. Phenobarbital.
    DB01032. Probenecid.
    DB01045. Rifampicin.
    DB01138. Sulfinpyrazone.
    DB00661. Verapamil.
    DB00541. Vincristine.

    Protein family/group databases

    TCDBi 3.A.1.208.9. the atp-binding cassette (abc) superfamily.

    PTM databases

    PhosphoSitei O15438.

    Proteomic databases

    MaxQBi O15438.
    PaxDbi O15438.
    PRIDEi O15438.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000285238 ; ENSP00000285238 ; ENSG00000108846 . [O15438-1 ]
    ENST00000427699 ; ENSP00000395160 ; ENSG00000108846 . [O15438-5 ]
    ENST00000502426 ; ENSP00000427073 ; ENSG00000108846 . [O15438-3 ]
    ENST00000505699 ; ENSP00000427521 ; ENSG00000108846 . [O15438-2 ]
    GeneIDi 8714.
    KEGGi hsa:8714.
    UCSCi uc002isk.4. human. [O15438-5 ]
    uc002isl.3. human. [O15438-1 ]

    Organism-specific databases

    CTDi 8714.
    GeneCardsi GC17P048712.
    HGNCi HGNC:54. ABCC3.
    HPAi CAB037136.
    HPA048483.
    MIMi 604323. gene.
    neXtProti NX_O15438.
    PharmGKBi PA376.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG1132.
    HOVERGENi HBG108314.
    InParanoidi O15438.
    KOi K05667.
    OMAi WNRHENK.
    OrthoDBi EOG7R2BJW.
    PhylomeDBi O15438.
    TreeFami TF105199.

    Enzyme and pathway databases

    Reactomei REACT_11042. Recycling of bile acids and salts.
    REACT_15480. ABC-family proteins mediated transport.

    Miscellaneous databases

    ChiTaRSi ABCC3. human.
    GeneWikii ABCC3.
    GenomeRNAii 8714.
    NextBioi 32679.
    PROi O15438.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O15438.
    Bgeei O15438.
    CleanExi HS_ABCC3.
    Genevestigatori O15438.

    Family and domain databases

    Gene3Di 3.40.50.300. 2 hits.
    InterProi IPR003593. AAA+_ATPase.
    IPR011527. ABC1_TM_dom.
    IPR003439. ABC_transporter-like.
    IPR017871. ABC_transporter_CS.
    IPR001140. ABC_transptr_TM_dom.
    IPR005292. Multidrug-R_assoc.
    IPR027417. P-loop_NTPase.
    [Graphical view ]
    Pfami PF00664. ABC_membrane. 2 hits.
    PF00005. ABC_tran. 2 hits.
    [Graphical view ]
    SMARTi SM00382. AAA. 2 hits.
    [Graphical view ]
    SUPFAMi SSF52540. SSF52540. 2 hits.
    SSF90123. SSF90123. 2 hits.
    TIGRFAMsi TIGR00957. MRP_assoc_pro. 1 hit.
    PROSITEi PS50929. ABC_TM1F. 2 hits.
    PS00211. ABC_TRANSPORTER_1. 2 hits.
    PS50893. ABC_TRANSPORTER_2. 2 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Isolation of a novel human canalicular multispecific organic anion transporter, cMOAT2/MRP3, and its expression in cisplatin-resistant cancer cells with decreased ATP-dependent drug transport."
      Uchiumi T., Hinoshita E., Haga S., Nakamura T., Tanaka T., Toh S., Furukawa M., Kawabe T., Wada M., Kagotani K., Okumura K., Kohno K., Akiyama S., Kuwano M.
      Biochem. Biophys. Res. Commun. 252:103-110(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Liver.
    2. "cDNA cloning and inducible expression of human multidrug resistance associated protein 3 (MRP3)."
      Kiuchi Y., Suzuki H., Hirohashi T., Tyson C.A., Sugiyama Y.
      FEBS Lett. 433:149-152(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    3. "Characterization of MOAT-C and MOAT-D, new members of the MRP/cMOAT subfamily of transporter proteins."
      Belinsky M.G., Bain L.J., Balsara B.B., Testa J.R., Kruh G.D.
      J. Natl. Cancer Inst. 90:1735-1741(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    4. "Human MRP3 transporter: identification of the 5'-flanking region, genomic organization and alternative splice variants."
      Fromm M.F., Leake B., Roden D.M., Wilkinson G.R., Kim R.B.
      Biochim. Biophys. Acta 1415:369-374(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3).
      Tissue: Liver.
    5. "Characterization of the human multidrug resistance protein isoform MRP3 localized to the basolateral hepatocyte membrane."
      Koenig J., Rost D., Cui Y., Keppler D.
      Hepatology 29:1156-1163(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Liver.
    6. "Complete coding sequence of human MRP3, a homolog of the human multidrug resistance-associated protein MRP1."
      Kool M., de Haas M., Ponne N.J., Baas F., Borst P.
      Submitted (JUN-1997) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Liver.
    7. "Identification of a novel splice variant of MRP3 involved in resistance to DNA damaging agents."
      Auclair D., Alonso E., Chen L.B.
      Submitted (MAY-1999) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
      Tissue: Colon carcinoma.
    8. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
      Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
      , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
      Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    10. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5).
      Tissue: Blood.
    11. "Analysis of expression of cMOAT (MRP2), MRP3, MRP4, and MRP5, homologues of the multidrug resistance-associated protein gene (MRP1), in human cancer cell lines."
      Kool M., de Haas M., Scheffer G.L., Scheper R.J., van Eijk M.J., Juijn J.A., Baas F., Borst P.
      Cancer Res. 57:3537-3547(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1043-1527 (ISOFORM 1).
      Tissue: Liver.
    12. Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S).
    13. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.

    Entry informationi

    Entry nameiMRP3_HUMAN
    AccessioniPrimary (citable) accession number: O15438
    Secondary accession number(s): B2RPA9
    , D3DTX9, O60265, O60922, O75621, O95078, O95289, O95290, Q86X85, Q9UN52
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 15, 1998
    Last sequence update: May 30, 2000
    Last modified: October 1, 2014
    This is version 140 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 17
      Human chromosome 17: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3