Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

O15438 (MRP3_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 136. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Canalicular multispecific organic anion transporter 2
Alternative name(s):
ATP-binding cassette sub-family C member 3
Multi-specific organic anion transporter D
Short name=MOAT-D
Multidrug resistance-associated protein 3
Gene names
Name:ABCC3
Synonyms:CMOAT2, MLP2, MRP3
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1527 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

May act as an inducible transporter in the biliary and intestinal excretion of organic anions. Acts as an alternative route for the export of bile acids and glucuronides from cholestatic hepatocytes By similarity.

Subcellular location

Membrane; Multi-pass membrane protein.

Tissue specificity

Mainly expressed in the liver. Also expressed in small intestine, colon, prostate, testis, brain and at a lower level in the kidney.

Sequence similarities

Belongs to the ABC transporter superfamily. ABCC family. Conjugate transporter (TC 3.A.1.208) subfamily. [View classification]

Contains 2 ABC transmembrane type-1 domains.

Contains 2 ABC transporter domains.

Sequence caution

The sequence AAB71756.1 differs from that shown. Reason: Frameshift at positions 1334 and 1338.

The sequence AAD01430.1 differs from that shown. Reason: Frameshift at positions 355, 359 and 361.

The sequence AAD38185.1 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS.

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]

Note: Additional isoforms seem to exist.
Isoform 1 (identifier: O15438-1)

Also known as: MRP3;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: O15438-2)

Also known as: MRP3A;

The sequence of this isoform differs from the canonical sequence as follows:
     1194-1527: WLSIGVEFVG...YGMARDAGLA → SEAASLAPCS...ALPLPHFLLI
Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Isoform 3 (identifier: O15438-3)

Also known as: MRP3B;

The sequence of this isoform differs from the canonical sequence as follows:
     226-510: MAIYGYRHPL...LKLYAWEPSF → LLNPDPLRGC...IEGLAHQADE
     511-1527: Missing.
Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Isoform 4 (identifier: O15438-4)

Also known as: MRP3S1;

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MPACTVKESPNCKRNFCKADHIVNTSGGSNLERVGKQKTIQKGQFSQRSVCT
Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.
Isoform 5 (identifier: O15438-5)

The sequence of this isoform differs from the canonical sequence as follows:
     547-572: TLITLWVYVYVDPNNVLDAEKAFVSV → RLGTGLGPCLQGSGCPGMARAHWTLP
     573-1527: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 15271527Canalicular multispecific organic anion transporter 2
PRO_0000093360

Regions

Topological domain1 – 3232Extracellular By similarity
Transmembrane33 – 5321Helical; Name=1; By similarity
Topological domain54 – 7320Cytoplasmic By similarity
Transmembrane74 – 9421Helical; Name=2; By similarity
Topological domain95 – 995Extracellular By similarity
Transmembrane100 – 12021Helical; Name=3; By similarity
Topological domain121 – 13212Cytoplasmic By similarity
Transmembrane133 – 15321Helical; Name=4; By similarity
Topological domain154 – 17118Extracellular By similarity
Transmembrane172 – 19221Helical; Name=5; By similarity
Topological domain193 – 302110Cytoplasmic By similarity
Transmembrane303 – 32321Helical; Name=6; By similarity
Topological domain324 – 34926Extracellular By similarity
Transmembrane350 – 37021Helical; Name=7; By similarity
Topological domain371 – 42656Cytoplasmic By similarity
Transmembrane427 – 44721Helical; Name=8; By similarity
Topological domain448 – 4503Extracellular By similarity
Transmembrane451 – 47121Helical; Name=9; By similarity
Topological domain472 – 53362Cytoplasmic By similarity
Transmembrane534 – 55421Helical; Name=10; By similarity
Topological domain555 – 57622Extracellular By similarity
Transmembrane577 – 59721Helical; Name=11; By similarity
Topological domain598 – 963366Cytoplasmic By similarity
Transmembrane964 – 98421Helical; Name=12; By similarity
Topological domain985 – 102137Extracellular By similarity
Transmembrane1022 – 104221Helical; Name=13; By similarity
Topological domain1043 – 108543Cytoplasmic By similarity
Transmembrane1086 – 110621Helical; Name=14; By similarity
Topological domain11071Extracellular By similarity
Transmembrane1108 – 112821Helical; Name=15; By similarity
Topological domain1129 – 119971Cytoplasmic By similarity
Transmembrane1200 – 122021Helical; Name=16; By similarity
Topological domain1221 – 12222Extracellular By similarity
Transmembrane1223 – 124321Helical; Name=17; By similarity
Topological domain1244 – 1527284Cytoplasmic By similarity
Domain311 – 594284ABC transmembrane type-1 1
Domain629 – 851223ABC transporter 1
Domain971 – 1252282ABC transmembrane type-1 2
Domain1291 – 1523233ABC transporter 2
Nucleotide binding661 – 6688ATP 1 Potential
Nucleotide binding1323 – 13308ATP 2 Potential

Amino acid modifications

Glycosylation181N-linked (GlcNAc...) Potential
Glycosylation10061N-linked (GlcNAc...) Potential
Glycosylation10071N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence11M → MPACTVKESPNCKRNFCKAD HIVNTSGGSNLERVGKQKTI QKGQFSQRSVCT in isoform 4.
VSP_043864
Alternative sequence226 – 510285MAIYG…WEPSF → LLNPDPLRGCLPGFTSPQDG HLWLPASPGGEGPLVPKGRG QIPDGGAAAAGGMEEAGKAD GTTQGFSSTWEKCLRRGRGA AGCPAQAPEALLPEGPAGHL RLQLPHQCLLQAYPGPALLH QSTAAQHPDQVYLQPHGPLL VGLPGGWADVPVLHDAVADL TTLLPLHLCDWGEVSYWDHG CHLQEGSGYHQLSQTCVHCG GNCQPHVSGCPALHGPCPLP QSAVVSTPADHPGDLLPLAE PRSLCPGWSRFHGLADSTQR SCGREDARLPGKANEIEGLA HQADE in isoform 3.
VSP_000040
Alternative sequence511 – 15271017Missing in isoform 3.
VSP_000041
Alternative sequence547 – 57226TLITL…AFVSV → RLGTGLGPCLQGSGCPGMAR AHWTLP in isoform 5.
VSP_039041
Alternative sequence573 – 1527955Missing in isoform 5.
VSP_039042
Alternative sequence1194 – 1527334WLSIG…DAGLA → SEAASLAPCSSRNSQQALWC SGSLSLLSPKQKTGPALPLP HFLLI in isoform 2.
VSP_000042
Natural variant111G → D.
Corresponds to variant rs11568609 [ dbSNP | Ensembl ].
VAR_029119
Natural variant3461S → F.
Corresponds to variant rs11568605 [ dbSNP | Ensembl ].
VAR_020235
Natural variant12861R → G.
Corresponds to variant rs11568593 [ dbSNP | Ensembl ].
VAR_029120
Natural variant12971R → H.
Corresponds to variant rs11568591 [ dbSNP | Ensembl ].
VAR_020237
Natural variant13651Q → R.
Corresponds to variant rs11568590 [ dbSNP | Ensembl ].
VAR_020239
Natural variant13811R → S.
Corresponds to variant rs45461799 [ dbSNP | Ensembl ].
VAR_020240

Experimental info

Sequence conflict131K → N in AAH46126. Ref.10
Sequence conflict421C → R in CAA76658. Ref.5
Sequence conflict1841A → T in AAD02846. Ref.4
Sequence conflict3441A → G in AAC34668. Ref.1
Sequence conflict5691F → Y in BAA28146. Ref.2
Sequence conflict11281F → C in AAB71756. Ref.11
Sequence conflict12121L → I in AAB71756. Ref.11
Sequence conflict12491D → E in AAB71756. Ref.11
Sequence conflict13591L → F in AAB71756. Ref.11
Sequence conflict13621L → V in AAC34668. Ref.1
Sequence conflict13621L → V in AAB71756. Ref.11
Sequence conflict13641S → C in AAB71756. Ref.11
Sequence conflict13661L → M in AAB71756. Ref.11
Sequence conflict13711Q → R in AAB71756. Ref.11

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (MRP3) [UniParc].

Last modified May 30, 2000. Version 3.
Checksum: 0D1F879B6F18370C

FASTA1,527169,343
        10         20         30         40         50         60 
MDALCGSGEL GSKFWDSNLS VHTENPDLTP CFQNSLLAWV PCIYLWVALP CYLLYLRHHC 

        70         80         90        100        110        120 
RGYIILSHLS KLKMVLGVLL WCVSWADLFY SFHGLVHGRA PAPVFFVTPL VVGVTMLLAT 

       130        140        150        160        170        180 
LLIQYERLQG VQSSGVLIIF WFLCVVCAIV PFRSKILLAK AEGEISDPFR FTTFYIHFAL 

       190        200        210        220        230        240 
VLSALILACF REKPPFFSAK NVDPNPYPET SAGFLSRLFF WWFTKMAIYG YRHPLEEKDL 

       250        260        270        280        290        300 
WSLKEEDRSQ MVVQQLLEAW RKQEKQTARH KASAAPGKNA SGEDEVLLGA RPRPRKPSFL 

       310        320        330        340        350        360 
KALLATFGSS FLISACFKLI QDLLSFINPQ LLSILIRFIS NPMAPSWWGF LVAGLMFLCS 

       370        380        390        400        410        420 
MMQSLILQHY YHYIFVTGVK FRTGIMGVIY RKALVITNSV KRASTVGEIV NLMSVDAQRF 

       430        440        450        460        470        480 
MDLAPFLNLL WSAPLQIILA IYFLWQNLGP SVLAGVAFMV LLIPLNGAVA VKMRAFQVKQ 

       490        500        510        520        530        540 
MKLKDSRIKL MSEILNGIKV LKLYAWEPSF LKQVEGIRQG ELQLLRTAAY LHTTTTFTWM 

       550        560        570        580        590        600 
CSPFLVTLIT LWVYVYVDPN NVLDAEKAFV SVSLFNILRL PLNMLPQLIS NLTQASVSLK 

       610        620        630        640        650        660 
RIQQFLSQEE LDPQSVERKT ISPGYAITIH SGTFTWAQDL PPTLHSLDIQ VPKGALVAVV 

       670        680        690        700        710        720 
GPVGCGKSSL VSALLGEMEK LEGKVHMKGS VAYVPQQAWI QNCTLQENVL FGKALNPKRY 

       730        740        750        760        770        780 
QQTLEACALL ADLEMLPGGD QTEIGEKGIN LSGGQRQRVS LARAVYSDAD IFLLDDPLSA 

       790        800        810        820        830        840 
VDSHVAKHIF DHVIGPEGVL AGKTRVLVTH GISFLPQTDF IIVLADGQVS EMGPYPALLQ 

       850        860        870        880        890        900 
RNGSFANFLC NYAPDEDQGH LEDSWTALEG AEDKEALLIE DTLSNHTDLT DNDPVTYVVQ 

       910        920        930        940        950        960 
KQFMRQLSAL SSDGEGQGRP VPRRHLGPSE KVQVTEAKAD GALTQEEKAA IGTVELSVFW 

       970        980        990       1000       1010       1020 
DYAKAVGLCT TLAICLLYVG QSAAAIGANV WLSAWTNDAM ADSRQNNTSL RLGVYAALGI 

      1030       1040       1050       1060       1070       1080 
LQGFLVMLAA MAMAAGGIQA ARVLHQALLH NKIRSPQSFF DTTPSGRILN CFSKDIYVVD 

      1090       1100       1110       1120       1130       1140 
EVLAPVILML LNSFFNAIST LVVIMASTPL FTVVILPLAV LYTLVQRFYA ATSRQLKRLE 

      1150       1160       1170       1180       1190       1200 
SVSRSPIYSH FSETVTGASV IRAYNRSRDF EIISDTKVDA NQRSCYPYII SNRWLSIGVE 

      1210       1220       1230       1240       1250       1260 
FVGNCVVLFA ALFAVIGRSS LNPGLVGLSV SYSLQVTFAL NWMIRMMSDL ESNIVAVERV 

      1270       1280       1290       1300       1310       1320 
KEYSKTETEA PWVVEGSRPP EGWPPRGEVE FRNYSVRYRP GLDLVLRDLS LHVHGGEKVG 

      1330       1340       1350       1360       1370       1380 
IVGRTGAGKS SMTLCLFRIL EAAKGEIRID GLNVADIGLH DLRSQLTIIP QDPILFSGTL 

      1390       1400       1410       1420       1430       1440 
RMNLDPFGSY SEEDIWWALE LSHLHTFVSS QPAGLDFQCS EGGENLSVGQ RQLVCLARAL 

      1450       1460       1470       1480       1490       1500 
LRKSRILVLD EATAAIDLET DNLIQATIRT QFDTCTVLTI AHRLNTIMDY TRVLVLDKGV 

      1510       1520 
VAEFDSPANL IAARGIFYGM ARDAGLA 

« Hide

Isoform 2 (MRP3A) [UniParc].

Checksum: 8E449E28F32BA882
Show »

FASTA1,238137,297
Isoform 3 (MRP3B) [UniParc].

Checksum: B00B65CBB262DEAA
Show »

FASTA51055,305
Isoform 4 (MRP3S1) [UniParc].

Checksum: 79A1F68027EBE525
Show »

FASTA1,578174,907
Isoform 5 [UniParc].

Checksum: D50802109C86F4DE
Show »

FASTA57264,632

References

« Hide 'large scale' references
[1]"Isolation of a novel human canalicular multispecific organic anion transporter, cMOAT2/MRP3, and its expression in cisplatin-resistant cancer cells with decreased ATP-dependent drug transport."
Uchiumi T., Hinoshita E., Haga S., Nakamura T., Tanaka T., Toh S., Furukawa M., Kawabe T., Wada M., Kagotani K., Okumura K., Kohno K., Akiyama S., Kuwano M.
Biochem. Biophys. Res. Commun. 252:103-110(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Liver.
[2]"cDNA cloning and inducible expression of human multidrug resistance associated protein 3 (MRP3)."
Kiuchi Y., Suzuki H., Hirohashi T., Tyson C.A., Sugiyama Y.
FEBS Lett. 433:149-152(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[3]"Characterization of MOAT-C and MOAT-D, new members of the MRP/cMOAT subfamily of transporter proteins."
Belinsky M.G., Bain L.J., Balsara B.B., Testa J.R., Kruh G.D.
J. Natl. Cancer Inst. 90:1735-1741(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[4]"Human MRP3 transporter: identification of the 5'-flanking region, genomic organization and alternative splice variants."
Fromm M.F., Leake B., Roden D.M., Wilkinson G.R., Kim R.B.
Biochim. Biophys. Acta 1415:369-374(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3).
Tissue: Liver.
[5]"Characterization of the human multidrug resistance protein isoform MRP3 localized to the basolateral hepatocyte membrane."
Koenig J., Rost D., Cui Y., Keppler D.
Hepatology 29:1156-1163(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Liver.
[6]"Complete coding sequence of human MRP3, a homolog of the human multidrug resistance-associated protein MRP1."
Kool M., de Haas M., Ponne N.J., Baas F., Borst P.
Submitted (JUN-1997) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Liver.
[7]"Identification of a novel splice variant of MRP3 involved in resistance to DNA damaging agents."
Auclair D., Alonso E., Chen L.B.
Submitted (MAY-1999) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
Tissue: Colon carcinoma.
[8]"DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. expand/collapse author list , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[9]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[10]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5).
Tissue: Blood.
[11]"Analysis of expression of cMOAT (MRP2), MRP3, MRP4, and MRP5, homologues of the multidrug resistance-associated protein gene (MRP1), in human cancer cell lines."
Kool M., de Haas M., Scheffer G.L., Scheper R.J., van Eijk M.J., Juijn J.A., Baas F., Borst P.
Cancer Res. 57:3537-3547(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1043-1527 (ISOFORM 1).
Tissue: Liver.
[12]"An unappreciated role for RNA surveillance."
Hillman R.T., Green R.E., Brenner S.E.
Genome Biol. 5:R8.1-R8.16(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S).
[13]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.

Web resources

ABCMdb

Database for mutations in ABC proteins

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF083552 mRNA. Translation: AAC34668.1.
AB010887 mRNA. Translation: BAA28146.1.
AF104943 mRNA. Translation: AAD04170.1.
AF085690 mRNA. Translation: AAD02845.1.
AF085691 mRNA. Translation: AAD02846.1.
AF085692 mRNA. Translation: AAD02847.1.
Y17151 mRNA. Translation: CAA76658.2.
AF009670 mRNA. Translation: AAD01430.1. Frameshift.
AF154001 mRNA. Translation: AAD38185.1. Sequence problems.
AC004590 Genomic DNA. No translation available.
AC005921 Genomic DNA. No translation available.
CH471109 Genomic DNA. Translation: EAW94592.1.
CH471109 Genomic DNA. Translation: EAW94590.1.
CH471109 Genomic DNA. Translation: EAW94593.1.
BC046126 mRNA. Translation: AAH46126.1.
BC137347 mRNA. Translation: AAI37348.1.
BC137348 mRNA. Translation: AAI37349.1.
U83659 mRNA. Translation: AAB71756.1. Frameshift.
PIRJE0336.
RefSeqNP_001137542.1. NM_001144070.1.
NP_003777.2. NM_003786.3.
UniGeneHs.463421.

3D structure databases

ProteinModelPortalO15438.
SMRO15438. Positions 626-853.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid114255. 2 interactions.
IntActO15438. 5 interactions.
STRING9606.ENSP00000285238.

Chemistry

BindingDBO15438.
ChEMBLCHEMBL5918.
DrugBankDB01016. Glibenclamide.

Protein family/group databases

TCDB3.A.1.208.9. the atp-binding cassette (abc) superfamily.

PTM databases

PhosphoSiteO15438.

Proteomic databases

PaxDbO15438.
PRIDEO15438.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000285238; ENSP00000285238; ENSG00000108846. [O15438-1]
ENST00000427699; ENSP00000395160; ENSG00000108846. [O15438-5]
ENST00000502426; ENSP00000427073; ENSG00000108846. [O15438-3]
ENST00000505699; ENSP00000427521; ENSG00000108846. [O15438-2]
GeneID8714.
KEGGhsa:8714.
UCSCuc002isk.4. human. [O15438-5]
uc002isl.3. human. [O15438-1]

Organism-specific databases

CTD8714.
GeneCardsGC17P048712.
HGNCHGNC:54. ABCC3.
HPACAB037136.
HPA048483.
MIM604323. gene.
neXtProtNX_O15438.
PharmGKBPA376.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG1132.
HOVERGENHBG108314.
InParanoidO15438.
KOK05667.
OMAQFETCTV.
OrthoDBEOG7R2BJW.
PhylomeDBO15438.
TreeFamTF105199.

Enzyme and pathway databases

ReactomeREACT_111217. Metabolism.
REACT_15518. Transmembrane transport of small molecules.

Gene expression databases

ArrayExpressO15438.
BgeeO15438.
CleanExHS_ABCC3.
GenevestigatorO15438.

Family and domain databases

Gene3D3.40.50.300. 2 hits.
InterProIPR003593. AAA+_ATPase.
IPR011527. ABC1_TM_dom.
IPR003439. ABC_transporter-like.
IPR017871. ABC_transporter_CS.
IPR001140. ABC_transptr_TM_dom.
IPR005292. Multidrug-R_assoc.
IPR027417. P-loop_NTPase.
[Graphical view]
PfamPF00664. ABC_membrane. 2 hits.
PF00005. ABC_tran. 2 hits.
[Graphical view]
SMARTSM00382. AAA. 2 hits.
[Graphical view]
SUPFAMSSF52540. SSF52540. 2 hits.
SSF90123. SSF90123. 2 hits.
TIGRFAMsTIGR00957. MRP_assoc_pro. 1 hit.
PROSITEPS50929. ABC_TM1F. 2 hits.
PS00211. ABC_TRANSPORTER_1. 2 hits.
PS50893. ABC_TRANSPORTER_2. 2 hits.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSABCC3. human.
GeneWikiABCC3.
GenomeRNAi8714.
NextBio32679.
PROO15438.
SOURCESearch...

Entry information

Entry nameMRP3_HUMAN
AccessionPrimary (citable) accession number: O15438
Secondary accession number(s): B2RPA9 expand/collapse secondary AC list , D3DTX9, O60265, O60922, O75621, O95078, O95289, O95290, Q86X85, Q9UN52
Entry history
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: May 30, 2000
Last modified: April 16, 2014
This is version 136 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 17

Human chromosome 17: entries, gene names and cross-references to MIM