SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O15438

- MRP3_HUMAN

UniProt

O15438 - MRP3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Canalicular multispecific organic anion transporter 2

Gene
ABCC3, CMOAT2, MLP2, MRP3
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

May act as an inducible transporter in the biliary and intestinal excretion of organic anions. Acts as an alternative route for the export of bile acids and glucuronides from cholestatic hepatocytes By similarity.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi661 – 6688ATP 1 Reviewed prediction
Nucleotide bindingi1323 – 13308ATP 2 Reviewed prediction

GO - Molecular functioni

  1. ATPase activity, coupled to transmembrane movement of substances Source: ProtInc
  2. ATP binding Source: ProtInc
  3. organic anion transmembrane transporter activity Source: ProtInc

GO - Biological processi

  1. bile acid and bile salt transport Source: Reactome
  2. bile acid metabolic process Source: Reactome
  3. small molecule metabolic process Source: Reactome
  4. transmembrane transport Source: Reactome
  5. transport Source: ProtInc
Complete GO annotation...

Keywords - Biological processi

Transport

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiREACT_11042. Recycling of bile acids and salts.
REACT_15480. ABC-family proteins mediated transport.

Protein family/group databases

TCDBi3.A.1.208.9. the atp-binding cassette (abc) superfamily.

Names & Taxonomyi

Protein namesi
Recommended name:
Canalicular multispecific organic anion transporter 2
Alternative name(s):
ATP-binding cassette sub-family C member 3
Multi-specific organic anion transporter D
Short name:
MOAT-D
Multidrug resistance-associated protein 3
Gene namesi
Name:ABCC3
Synonyms:CMOAT2, MLP2, MRP3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 17

Organism-specific databases

HGNCiHGNC:54. ABCC3.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 3232Extracellular By similarityAdd
BLAST
Transmembranei33 – 5321Helical; Name=1; By similarityAdd
BLAST
Topological domaini54 – 7320Cytoplasmic By similarityAdd
BLAST
Transmembranei74 – 9421Helical; Name=2; By similarityAdd
BLAST
Topological domaini95 – 995Extracellular By similarity
Transmembranei100 – 12021Helical; Name=3; By similarityAdd
BLAST
Topological domaini121 – 13212Cytoplasmic By similarityAdd
BLAST
Transmembranei133 – 15321Helical; Name=4; By similarityAdd
BLAST
Topological domaini154 – 17118Extracellular By similarityAdd
BLAST
Transmembranei172 – 19221Helical; Name=5; By similarityAdd
BLAST
Topological domaini193 – 302110Cytoplasmic By similarityAdd
BLAST
Transmembranei303 – 32321Helical; Name=6; By similarityAdd
BLAST
Topological domaini324 – 34926Extracellular By similarityAdd
BLAST
Transmembranei350 – 37021Helical; Name=7; By similarityAdd
BLAST
Topological domaini371 – 42656Cytoplasmic By similarityAdd
BLAST
Transmembranei427 – 44721Helical; Name=8; By similarityAdd
BLAST
Topological domaini448 – 4503Extracellular By similarity
Transmembranei451 – 47121Helical; Name=9; By similarityAdd
BLAST
Topological domaini472 – 53362Cytoplasmic By similarityAdd
BLAST
Transmembranei534 – 55421Helical; Name=10; By similarityAdd
BLAST
Topological domaini555 – 57622Extracellular By similarityAdd
BLAST
Transmembranei577 – 59721Helical; Name=11; By similarityAdd
BLAST
Topological domaini598 – 963366Cytoplasmic By similarityAdd
BLAST
Transmembranei964 – 98421Helical; Name=12; By similarityAdd
BLAST
Topological domaini985 – 102137Extracellular By similarityAdd
BLAST
Transmembranei1022 – 104221Helical; Name=13; By similarityAdd
BLAST
Topological domaini1043 – 108543Cytoplasmic By similarityAdd
BLAST
Transmembranei1086 – 110621Helical; Name=14; By similarityAdd
BLAST
Topological domaini1107 – 11071Extracellular By similarity
Transmembranei1108 – 112821Helical; Name=15; By similarityAdd
BLAST
Topological domaini1129 – 119971Cytoplasmic By similarityAdd
BLAST
Transmembranei1200 – 122021Helical; Name=16; By similarityAdd
BLAST
Topological domaini1221 – 12222Extracellular By similarity
Transmembranei1223 – 124321Helical; Name=17; By similarityAdd
BLAST
Topological domaini1244 – 1527284Cytoplasmic By similarityAdd
BLAST

GO - Cellular componenti

  1. integral component of plasma membrane Source: ProtInc
  2. membrane Source: ProtInc
  3. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA376.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 15271527Canalicular multispecific organic anion transporter 2PRO_0000093360Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi18 – 181N-linked (GlcNAc...) Reviewed prediction
Glycosylationi1006 – 10061N-linked (GlcNAc...) Reviewed prediction
Glycosylationi1007 – 10071N-linked (GlcNAc...) Reviewed prediction

Keywords - PTMi

Glycoprotein

Proteomic databases

MaxQBiO15438.
PaxDbiO15438.
PRIDEiO15438.

PTM databases

PhosphoSiteiO15438.

Expressioni

Tissue specificityi

Mainly expressed in the liver. Also expressed in small intestine, colon, prostate, testis, brain and at a lower level in the kidney.

Gene expression databases

ArrayExpressiO15438.
BgeeiO15438.
CleanExiHS_ABCC3.
GenevestigatoriO15438.

Organism-specific databases

HPAiCAB037136.
HPA048483.

Interactioni

Protein-protein interaction databases

BioGridi114255. 2 interactions.
IntActiO15438. 5 interactions.
STRINGi9606.ENSP00000285238.

Structurei

3D structure databases

ProteinModelPortaliO15438.
SMRiO15438. Positions 626-853.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini311 – 594284ABC transmembrane type-1 1Add
BLAST
Domaini629 – 851223ABC transporter 1Add
BLAST
Domaini971 – 1252282ABC transmembrane type-1 2Add
BLAST
Domaini1291 – 1523233ABC transporter 2Add
BLAST

Sequence similaritiesi

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG1132.
HOVERGENiHBG108314.
InParanoidiO15438.
KOiK05667.
OMAiWNRHENK.
OrthoDBiEOG7R2BJW.
PhylomeDBiO15438.
TreeFamiTF105199.

Family and domain databases

Gene3Di3.40.50.300. 2 hits.
InterProiIPR003593. AAA+_ATPase.
IPR011527. ABC1_TM_dom.
IPR003439. ABC_transporter-like.
IPR017871. ABC_transporter_CS.
IPR001140. ABC_transptr_TM_dom.
IPR005292. Multidrug-R_assoc.
IPR027417. P-loop_NTPase.
[Graphical view]
PfamiPF00664. ABC_membrane. 2 hits.
PF00005. ABC_tran. 2 hits.
[Graphical view]
SMARTiSM00382. AAA. 2 hits.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 2 hits.
SSF90123. SSF90123. 2 hits.
TIGRFAMsiTIGR00957. MRP_assoc_pro. 1 hit.
PROSITEiPS50929. ABC_TM1F. 2 hits.
PS00211. ABC_TRANSPORTER_1. 2 hits.
PS50893. ABC_TRANSPORTER_2. 2 hits.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Note: Additional isoforms seem to exist.

Isoform 1 (identifier: O15438-1) [UniParc]FASTAAdd to Basket

Also known as: MRP3

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MDALCGSGEL GSKFWDSNLS VHTENPDLTP CFQNSLLAWV PCIYLWVALP     50
CYLLYLRHHC RGYIILSHLS KLKMVLGVLL WCVSWADLFY SFHGLVHGRA 100
PAPVFFVTPL VVGVTMLLAT LLIQYERLQG VQSSGVLIIF WFLCVVCAIV 150
PFRSKILLAK AEGEISDPFR FTTFYIHFAL VLSALILACF REKPPFFSAK 200
NVDPNPYPET SAGFLSRLFF WWFTKMAIYG YRHPLEEKDL WSLKEEDRSQ 250
MVVQQLLEAW RKQEKQTARH KASAAPGKNA SGEDEVLLGA RPRPRKPSFL 300
KALLATFGSS FLISACFKLI QDLLSFINPQ LLSILIRFIS NPMAPSWWGF 350
LVAGLMFLCS MMQSLILQHY YHYIFVTGVK FRTGIMGVIY RKALVITNSV 400
KRASTVGEIV NLMSVDAQRF MDLAPFLNLL WSAPLQIILA IYFLWQNLGP 450
SVLAGVAFMV LLIPLNGAVA VKMRAFQVKQ MKLKDSRIKL MSEILNGIKV 500
LKLYAWEPSF LKQVEGIRQG ELQLLRTAAY LHTTTTFTWM CSPFLVTLIT 550
LWVYVYVDPN NVLDAEKAFV SVSLFNILRL PLNMLPQLIS NLTQASVSLK 600
RIQQFLSQEE LDPQSVERKT ISPGYAITIH SGTFTWAQDL PPTLHSLDIQ 650
VPKGALVAVV GPVGCGKSSL VSALLGEMEK LEGKVHMKGS VAYVPQQAWI 700
QNCTLQENVL FGKALNPKRY QQTLEACALL ADLEMLPGGD QTEIGEKGIN 750
LSGGQRQRVS LARAVYSDAD IFLLDDPLSA VDSHVAKHIF DHVIGPEGVL 800
AGKTRVLVTH GISFLPQTDF IIVLADGQVS EMGPYPALLQ RNGSFANFLC 850
NYAPDEDQGH LEDSWTALEG AEDKEALLIE DTLSNHTDLT DNDPVTYVVQ 900
KQFMRQLSAL SSDGEGQGRP VPRRHLGPSE KVQVTEAKAD GALTQEEKAA 950
IGTVELSVFW DYAKAVGLCT TLAICLLYVG QSAAAIGANV WLSAWTNDAM 1000
ADSRQNNTSL RLGVYAALGI LQGFLVMLAA MAMAAGGIQA ARVLHQALLH 1050
NKIRSPQSFF DTTPSGRILN CFSKDIYVVD EVLAPVILML LNSFFNAIST 1100
LVVIMASTPL FTVVILPLAV LYTLVQRFYA ATSRQLKRLE SVSRSPIYSH 1150
FSETVTGASV IRAYNRSRDF EIISDTKVDA NQRSCYPYII SNRWLSIGVE 1200
FVGNCVVLFA ALFAVIGRSS LNPGLVGLSV SYSLQVTFAL NWMIRMMSDL 1250
ESNIVAVERV KEYSKTETEA PWVVEGSRPP EGWPPRGEVE FRNYSVRYRP 1300
GLDLVLRDLS LHVHGGEKVG IVGRTGAGKS SMTLCLFRIL EAAKGEIRID 1350
GLNVADIGLH DLRSQLTIIP QDPILFSGTL RMNLDPFGSY SEEDIWWALE 1400
LSHLHTFVSS QPAGLDFQCS EGGENLSVGQ RQLVCLARAL LRKSRILVLD 1450
EATAAIDLET DNLIQATIRT QFDTCTVLTI AHRLNTIMDY TRVLVLDKGV 1500
VAEFDSPANL IAARGIFYGM ARDAGLA 1527
Length:1,527
Mass (Da):169,343
Last modified:May 30, 2000 - v3
Checksum:i0D1F879B6F18370C
GO
Isoform 2 (identifier: O15438-2) [UniParc]FASTAAdd to Basket

Also known as: MRP3A

The sequence of this isoform differs from the canonical sequence as follows:
     1194-1527: WLSIGVEFVG...YGMARDAGLA → SEAASLAPCS...ALPLPHFLLI

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »
Length:1,238
Mass (Da):137,297
Checksum:i8E449E28F32BA882
GO
Isoform 3 (identifier: O15438-3) [UniParc]FASTAAdd to Basket

Also known as: MRP3B

The sequence of this isoform differs from the canonical sequence as follows:
     226-510: MAIYGYRHPL...LKLYAWEPSF → LLNPDPLRGC...IEGLAHQADE
     511-1527: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »
Length:510
Mass (Da):55,305
Checksum:iB00B65CBB262DEAA
GO
Isoform 4 (identifier: O15438-4) [UniParc]FASTAAdd to Basket

Also known as: MRP3S1

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MPACTVKESPNCKRNFCKADHIVNTSGGSNLERVGKQKTIQKGQFSQRSVCT

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.

Show »
Length:1,578
Mass (Da):174,907
Checksum:i79A1F68027EBE525
GO
Isoform 5 (identifier: O15438-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     547-572: TLITLWVYVYVDPNNVLDAEKAFVSV → RLGTGLGPCLQGSGCPGMARAHWTLP
     573-1527: Missing.

Note: No experimental confirmation available.

Show »
Length:572
Mass (Da):64,632
Checksum:iD50802109C86F4DE
GO

Sequence cautioni

The sequence AAB71756.1 differs from that shown. Reason: Frameshift at positions 1334 and 1338.
The sequence AAD01430.1 differs from that shown. Reason: Frameshift at positions 355, 359 and 361.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti11 – 111G → D.
Corresponds to variant rs11568609 [ dbSNP | Ensembl ].
VAR_029119
Natural varianti346 – 3461S → F.
Corresponds to variant rs11568605 [ dbSNP | Ensembl ].
VAR_020235
Natural varianti1286 – 12861R → G.
Corresponds to variant rs11568593 [ dbSNP | Ensembl ].
VAR_029120
Natural varianti1297 – 12971R → H.
Corresponds to variant rs11568591 [ dbSNP | Ensembl ].
VAR_020237
Natural varianti1365 – 13651Q → R.
Corresponds to variant rs11568590 [ dbSNP | Ensembl ].
VAR_020239
Natural varianti1381 – 13811R → S.
Corresponds to variant rs45461799 [ dbSNP | Ensembl ].
VAR_020240

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MPACTVKESPNCKRNFCKAD HIVNTSGGSNLERVGKQKTI QKGQFSQRSVCT in isoform 4. VSP_043864
Alternative sequencei226 – 510285MAIYG…WEPSF → LLNPDPLRGCLPGFTSPQDG HLWLPASPGGEGPLVPKGRG QIPDGGAAAAGGMEEAGKAD GTTQGFSSTWEKCLRRGRGA AGCPAQAPEALLPEGPAGHL RLQLPHQCLLQAYPGPALLH QSTAAQHPDQVYLQPHGPLL VGLPGGWADVPVLHDAVADL TTLLPLHLCDWGEVSYWDHG CHLQEGSGYHQLSQTCVHCG GNCQPHVSGCPALHGPCPLP QSAVVSTPADHPGDLLPLAE PRSLCPGWSRFHGLADSTQR SCGREDARLPGKANEIEGLA HQADE in isoform 3. VSP_000040Add
BLAST
Alternative sequencei511 – 15271017Missing in isoform 3. VSP_000041Add
BLAST
Alternative sequencei547 – 57226TLITL…AFVSV → RLGTGLGPCLQGSGCPGMAR AHWTLP in isoform 5. VSP_039041Add
BLAST
Alternative sequencei573 – 1527955Missing in isoform 5. VSP_039042Add
BLAST
Alternative sequencei1194 – 1527334WLSIG…DAGLA → SEAASLAPCSSRNSQQALWC SGSLSLLSPKQKTGPALPLP HFLLI in isoform 2. VSP_000042Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti13 – 131K → N in AAH46126. 1 Publication
Sequence conflicti42 – 421C → R in CAA76658. 1 Publication
Sequence conflicti184 – 1841A → T in AAD02846. 1 Publication
Sequence conflicti344 – 3441A → G in AAC34668. 1 Publication
Sequence conflicti569 – 5691F → Y in BAA28146. 1 Publication
Sequence conflicti1128 – 11281F → C in AAB71756. 1 Publication
Sequence conflicti1212 – 12121L → I in AAB71756. 1 Publication
Sequence conflicti1249 – 12491D → E in AAB71756. 1 Publication
Sequence conflicti1359 – 13591L → F in AAB71756. 1 Publication
Sequence conflicti1362 – 13621L → V in AAC34668. 1 Publication
Sequence conflicti1362 – 13621L → V in AAB71756. 1 Publication
Sequence conflicti1364 – 13641S → C in AAB71756. 1 Publication
Sequence conflicti1366 – 13661L → M in AAB71756. 1 Publication
Sequence conflicti1371 – 13711Q → R in AAB71756. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF083552 mRNA. Translation: AAC34668.1.
AB010887 mRNA. Translation: BAA28146.1.
AF104943 mRNA. Translation: AAD04170.1.
AF085690 mRNA. Translation: AAD02845.1.
AF085691 mRNA. Translation: AAD02846.1.
AF085692 mRNA. Translation: AAD02847.1.
Y17151 mRNA. Translation: CAA76658.2.
AF009670 mRNA. Translation: AAD01430.1. Frameshift.
AF154001 mRNA. Translation: AAD38185.1. Sequence problems.
AC004590 Genomic DNA. No translation available.
AC005921 Genomic DNA. No translation available.
CH471109 Genomic DNA. Translation: EAW94592.1.
CH471109 Genomic DNA. Translation: EAW94590.1.
CH471109 Genomic DNA. Translation: EAW94593.1.
BC046126 mRNA. Translation: AAH46126.1.
BC137347 mRNA. Translation: AAI37348.1.
BC137348 mRNA. Translation: AAI37349.1.
U83659 mRNA. Translation: AAB71756.1. Frameshift.
CCDSiCCDS32681.1. [O15438-1]
CCDS45739.1. [O15438-5]
PIRiJE0336.
RefSeqiNP_001137542.1. NM_001144070.1. [O15438-5]
NP_003777.2. NM_003786.3. [O15438-1]
UniGeneiHs.463421.

Genome annotation databases

EnsembliENST00000285238; ENSP00000285238; ENSG00000108846. [O15438-1]
ENST00000427699; ENSP00000395160; ENSG00000108846. [O15438-5]
ENST00000502426; ENSP00000427073; ENSG00000108846. [O15438-3]
ENST00000505699; ENSP00000427521; ENSG00000108846. [O15438-2]
GeneIDi8714.
KEGGihsa:8714.
UCSCiuc002isk.4. human. [O15438-5]
uc002isl.3. human. [O15438-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

ABCMdb

Database for mutations in ABC proteins

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF083552 mRNA. Translation: AAC34668.1 .
AB010887 mRNA. Translation: BAA28146.1 .
AF104943 mRNA. Translation: AAD04170.1 .
AF085690 mRNA. Translation: AAD02845.1 .
AF085691 mRNA. Translation: AAD02846.1 .
AF085692 mRNA. Translation: AAD02847.1 .
Y17151 mRNA. Translation: CAA76658.2 .
AF009670 mRNA. Translation: AAD01430.1 . Frameshift.
AF154001 mRNA. Translation: AAD38185.1 . Sequence problems.
AC004590 Genomic DNA. No translation available.
AC005921 Genomic DNA. No translation available.
CH471109 Genomic DNA. Translation: EAW94592.1 .
CH471109 Genomic DNA. Translation: EAW94590.1 .
CH471109 Genomic DNA. Translation: EAW94593.1 .
BC046126 mRNA. Translation: AAH46126.1 .
BC137347 mRNA. Translation: AAI37348.1 .
BC137348 mRNA. Translation: AAI37349.1 .
U83659 mRNA. Translation: AAB71756.1 . Frameshift.
CCDSi CCDS32681.1. [O15438-1 ]
CCDS45739.1. [O15438-5 ]
PIRi JE0336.
RefSeqi NP_001137542.1. NM_001144070.1. [O15438-5 ]
NP_003777.2. NM_003786.3. [O15438-1 ]
UniGenei Hs.463421.

3D structure databases

ProteinModelPortali O15438.
SMRi O15438. Positions 626-853.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 114255. 2 interactions.
IntActi O15438. 5 interactions.
STRINGi 9606.ENSP00000285238.

Chemistry

BindingDBi O15438.
ChEMBLi CHEMBL5918.
DrugBanki DB01016. Glibenclamide.

Protein family/group databases

TCDBi 3.A.1.208.9. the atp-binding cassette (abc) superfamily.

PTM databases

PhosphoSitei O15438.

Proteomic databases

MaxQBi O15438.
PaxDbi O15438.
PRIDEi O15438.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000285238 ; ENSP00000285238 ; ENSG00000108846 . [O15438-1 ]
ENST00000427699 ; ENSP00000395160 ; ENSG00000108846 . [O15438-5 ]
ENST00000502426 ; ENSP00000427073 ; ENSG00000108846 . [O15438-3 ]
ENST00000505699 ; ENSP00000427521 ; ENSG00000108846 . [O15438-2 ]
GeneIDi 8714.
KEGGi hsa:8714.
UCSCi uc002isk.4. human. [O15438-5 ]
uc002isl.3. human. [O15438-1 ]

Organism-specific databases

CTDi 8714.
GeneCardsi GC17P048712.
HGNCi HGNC:54. ABCC3.
HPAi CAB037136.
HPA048483.
MIMi 604323. gene.
neXtProti NX_O15438.
PharmGKBi PA376.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG1132.
HOVERGENi HBG108314.
InParanoidi O15438.
KOi K05667.
OMAi WNRHENK.
OrthoDBi EOG7R2BJW.
PhylomeDBi O15438.
TreeFami TF105199.

Enzyme and pathway databases

Reactomei REACT_11042. Recycling of bile acids and salts.
REACT_15480. ABC-family proteins mediated transport.

Miscellaneous databases

ChiTaRSi ABCC3. human.
GeneWikii ABCC3.
GenomeRNAii 8714.
NextBioi 32679.
PROi O15438.
SOURCEi Search...

Gene expression databases

ArrayExpressi O15438.
Bgeei O15438.
CleanExi HS_ABCC3.
Genevestigatori O15438.

Family and domain databases

Gene3Di 3.40.50.300. 2 hits.
InterProi IPR003593. AAA+_ATPase.
IPR011527. ABC1_TM_dom.
IPR003439. ABC_transporter-like.
IPR017871. ABC_transporter_CS.
IPR001140. ABC_transptr_TM_dom.
IPR005292. Multidrug-R_assoc.
IPR027417. P-loop_NTPase.
[Graphical view ]
Pfami PF00664. ABC_membrane. 2 hits.
PF00005. ABC_tran. 2 hits.
[Graphical view ]
SMARTi SM00382. AAA. 2 hits.
[Graphical view ]
SUPFAMi SSF52540. SSF52540. 2 hits.
SSF90123. SSF90123. 2 hits.
TIGRFAMsi TIGR00957. MRP_assoc_pro. 1 hit.
PROSITEi PS50929. ABC_TM1F. 2 hits.
PS00211. ABC_TRANSPORTER_1. 2 hits.
PS50893. ABC_TRANSPORTER_2. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Isolation of a novel human canalicular multispecific organic anion transporter, cMOAT2/MRP3, and its expression in cisplatin-resistant cancer cells with decreased ATP-dependent drug transport."
    Uchiumi T., Hinoshita E., Haga S., Nakamura T., Tanaka T., Toh S., Furukawa M., Kawabe T., Wada M., Kagotani K., Okumura K., Kohno K., Akiyama S., Kuwano M.
    Biochem. Biophys. Res. Commun. 252:103-110(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Liver.
  2. "cDNA cloning and inducible expression of human multidrug resistance associated protein 3 (MRP3)."
    Kiuchi Y., Suzuki H., Hirohashi T., Tyson C.A., Sugiyama Y.
    FEBS Lett. 433:149-152(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  3. "Characterization of MOAT-C and MOAT-D, new members of the MRP/cMOAT subfamily of transporter proteins."
    Belinsky M.G., Bain L.J., Balsara B.B., Testa J.R., Kruh G.D.
    J. Natl. Cancer Inst. 90:1735-1741(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  4. "Human MRP3 transporter: identification of the 5'-flanking region, genomic organization and alternative splice variants."
    Fromm M.F., Leake B., Roden D.M., Wilkinson G.R., Kim R.B.
    Biochim. Biophys. Acta 1415:369-374(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3).
    Tissue: Liver.
  5. "Characterization of the human multidrug resistance protein isoform MRP3 localized to the basolateral hepatocyte membrane."
    Koenig J., Rost D., Cui Y., Keppler D.
    Hepatology 29:1156-1163(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Liver.
  6. "Complete coding sequence of human MRP3, a homolog of the human multidrug resistance-associated protein MRP1."
    Kool M., de Haas M., Ponne N.J., Baas F., Borst P.
    Submitted (JUN-1997) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Liver.
  7. "Identification of a novel splice variant of MRP3 involved in resistance to DNA damaging agents."
    Auclair D., Alonso E., Chen L.B.
    Submitted (MAY-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
    Tissue: Colon carcinoma.
  8. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
    Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
    , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
    Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  10. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5).
    Tissue: Blood.
  11. "Analysis of expression of cMOAT (MRP2), MRP3, MRP4, and MRP5, homologues of the multidrug resistance-associated protein gene (MRP1), in human cancer cell lines."
    Kool M., de Haas M., Scheffer G.L., Scheper R.J., van Eijk M.J., Juijn J.A., Baas F., Borst P.
    Cancer Res. 57:3537-3547(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1043-1527 (ISOFORM 1).
    Tissue: Liver.
  12. Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S).
  13. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.

Entry informationi

Entry nameiMRP3_HUMAN
AccessioniPrimary (citable) accession number: O15438
Secondary accession number(s): B2RPA9
, D3DTX9, O60265, O60922, O75621, O95078, O95289, O95290, Q86X85, Q9UN52
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: May 30, 2000
Last modified: September 3, 2014
This is version 139 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi