O15438 (MRP3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 126.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Canalicular multispecific organic anion transporter 2 Alternative name(s): ATP-binding cassette sub-family C member 3 Multi-specific organic anion transporter D Short name=MOAT-D Multidrug resistance-associated protein 3 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1527 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May act as an inducible transporter in the biliary and intestinal excretion of organic anions. Acts as an alternative route for the export of bile acids and glucuronides from cholestatic hepatocytes By similarity. |
| Subcellular location | |
| Tissue specificity | Mainly expressed in the liver. Also expressed in small intestine, colon, prostate, testis, brain and at a lower level in the kidney. |
| Sequence similarities | Belongs to the ABC transporter superfamily. ABCC family. Conjugate transporter (TC 3.A.1.208) subfamily. [View classification] Contains 2 ABC transmembrane type-1 domains. Contains 2 ABC transporter domains. |
| Sequence caution | The sequence AAB71756.1 differs from that shown. Reason: Frameshift at positions 1334 and 1338. The sequence AAD01430.1 differs from that shown. Reason: Frameshift at positions 355, 359 and 361. The sequence AAD38185.1 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transport |
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat Transmembrane Transmembrane helix |
| Ligand | ATP-binding Nucleotide-binding |
| PTM | Glycoprotein Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | bile acid and bile salt transport Traceable author statement. Source: Reactome bile acid metabolic processTraceable author statement. Source: Reactome |
| Cellular_component | integral to plasma membrane Traceable author statement Ref.1. Source: ProtInc |
| Molecular_function | ATP binding Traceable author statement Ref.1. Source: ProtInc ATPase activity, coupled to transmembrane movement of substancesTraceable author statement Ref.1. Source: ProtInc organic anion transmembrane transporter activityTraceable author statement Ref.2. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform 1 (identifier: O15438-1) Also known as: MRP3; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O15438-2) Also known as: MRP3A; The sequence of this isoform differs from the canonical sequence as follows: 1194-1527: WLSIGVEFVG...YGMARDAGLA → SEAASLAPCS...ALPLPHFLLI | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 3 (identifier: O15438-3) Also known as: MRP3B; The sequence of this isoform differs from the canonical sequence as follows: 226-510: MAIYGYRHPL...LKLYAWEPSF → LLNPDPLRGC...IEGLAHQADE 511-1527: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 4 (identifier: O15438-4) Also known as: MRP3S1; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MPACTVKESPNCKRNFCKADHIVNTSGGSNLERVGKQKTIQKGQFSQRSVCT | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available. | ||||||
| Isoform 5 (identifier: O15438-5) The sequence of this isoform differs from the canonical sequence as follows: 547-572: TLITLWVYVYVDPNNVLDAEKAFVSV → RLGTGLGPCLQGSGCPGMARAHWTLP 573-1527: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1527 | 1527 | Canalicular multispecific organic anion transporter 2 | PRO_0000093360 | |||||
Regions | |||||||||
| Topological domain | 1 – 32 | 32 | Extracellular By similarity | ||||||
| Transmembrane | 33 – 53 | 21 | Helical; Name=1; By similarity | ||||||
| Topological domain | 54 – 73 | 20 | Cytoplasmic By similarity | ||||||
| Transmembrane | 74 – 94 | 21 | Helical; Name=2; By similarity | ||||||
| Topological domain | 95 – 99 | 5 | Extracellular By similarity | ||||||
| Transmembrane | 100 – 120 | 21 | Helical; Name=3; By similarity | ||||||
| Topological domain | 121 – 132 | 12 | Cytoplasmic By similarity | ||||||
| Transmembrane | 133 – 153 | 21 | Helical; Name=4; By similarity | ||||||
| Topological domain | 154 – 171 | 18 | Extracellular By similarity | ||||||
| Transmembrane | 172 – 192 | 21 | Helical; Name=5; By similarity | ||||||
| Topological domain | 193 – 302 | 110 | Cytoplasmic By similarity | ||||||
| Transmembrane | 303 – 323 | 21 | Helical; Name=6; By similarity | ||||||
| Topological domain | 324 – 349 | 26 | Extracellular By similarity | ||||||
| Transmembrane | 350 – 370 | 21 | Helical; Name=7; By similarity | ||||||
| Topological domain | 371 – 426 | 56 | Cytoplasmic By similarity | ||||||
| Transmembrane | 427 – 447 | 21 | Helical; Name=8; By similarity | ||||||
| Topological domain | 448 – 450 | 3 | Extracellular By similarity | ||||||
| Transmembrane | 451 – 471 | 21 | Helical; Name=9; By similarity | ||||||
| Topological domain | 472 – 533 | 62 | Cytoplasmic By similarity | ||||||
| Transmembrane | 534 – 554 | 21 | Helical; Name=10; By similarity | ||||||
| Topological domain | 555 – 576 | 22 | Extracellular By similarity | ||||||
| Transmembrane | 577 – 597 | 21 | Helical; Name=11; By similarity | ||||||
| Topological domain | 598 – 963 | 366 | Cytoplasmic By similarity | ||||||
| Transmembrane | 964 – 984 | 21 | Helical; Name=12; By similarity | ||||||
| Topological domain | 985 – 1021 | 37 | Extracellular By similarity | ||||||
| Transmembrane | 1022 – 1042 | 21 | Helical; Name=13; By similarity | ||||||
| Topological domain | 1043 – 1085 | 43 | Cytoplasmic By similarity | ||||||
| Transmembrane | 1086 – 1106 | 21 | Helical; Name=14; By similarity | ||||||
| Topological domain | 1107 | 1 | Extracellular By similarity | ||||||
| Transmembrane | 1108 – 1128 | 21 | Helical; Name=15; By similarity | ||||||
| Topological domain | 1129 – 1199 | 71 | Cytoplasmic By similarity | ||||||
| Transmembrane | 1200 – 1220 | 21 | Helical; Name=16; By similarity | ||||||
| Topological domain | 1221 – 1222 | 2 | Extracellular By similarity | ||||||
| Transmembrane | 1223 – 1243 | 21 | Helical; Name=17; By similarity | ||||||
| Topological domain | 1244 – 1527 | 284 | Cytoplasmic By similarity | ||||||
| Domain | 311 – 594 | 284 | ABC transmembrane type-1 1 | ||||||
| Domain | 629 – 851 | 223 | ABC transporter 1 | ||||||
| Domain | 971 – 1252 | 282 | ABC transmembrane type-1 2 | ||||||
| Domain | 1291 – 1523 | 233 | ABC transporter 2 | ||||||
| Nucleotide binding | 661 – 668 | 8 | ATP 1 Potential | ||||||
| Nucleotide binding | 1323 – 1330 | 8 | ATP 2 Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 908 | 1 | Phosphoserine By similarity | ||||||
| Glycosylation | 18 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 1006 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 1007 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 | 1 | M → MPACTVKESPNCKRNFCKAD HIVNTSGGSNLERVGKQKTI QKGQFSQRSVCT in isoform 4. | VSP_043864 | |||||
| Alternative sequence | 226 – 510 | 285 | MAIYG…WEPSF → LLNPDPLRGCLPGFTSPQDG HLWLPASPGGEGPLVPKGRG QIPDGGAAAAGGMEEAGKAD GTTQGFSSTWEKCLRRGRGA AGCPAQAPEALLPEGPAGHL RLQLPHQCLLQAYPGPALLH QSTAAQHPDQVYLQPHGPLL VGLPGGWADVPVLHDAVADL TTLLPLHLCDWGEVSYWDHG CHLQEGSGYHQLSQTCVHCG GNCQPHVSGCPALHGPCPLP QSAVVSTPADHPGDLLPLAE PRSLCPGWSRFHGLADSTQR SCGREDARLPGKANEIEGLA HQADE in isoform 3. | VSP_000040 | |||||
| Alternative sequence | 511 – 1527 | 1017 | Missing in isoform 3. | VSP_000041 | |||||
| Alternative sequence | 547 – 572 | 26 | TLITL…AFVSV → RLGTGLGPCLQGSGCPGMAR AHWTLP in isoform 5. | VSP_039041 | |||||
| Alternative sequence | 573 – 1527 | 955 | Missing in isoform 5. | VSP_039042 | |||||
| Alternative sequence | 1194 – 1527 | 334 | WLSIG…DAGLA → SEAASLAPCSSRNSQQALWC SGSLSLLSPKQKTGPALPLP HFLLI in isoform 2. | VSP_000042 | |||||
| Natural variant | 11 | 1 | G → D. Corresponds to variant rs11568609 [ dbSNP | Ensembl ]. | VAR_029119 | |||||
| Natural variant | 346 | 1 | S → F. Corresponds to variant rs11568605 [ dbSNP | Ensembl ]. | VAR_020235 | |||||
| Natural variant | 1286 | 1 | R → G. Corresponds to variant rs11568593 [ dbSNP | Ensembl ]. | VAR_029120 | |||||
| Natural variant | 1297 | 1 | R → H. Corresponds to variant rs11568591 [ dbSNP | Ensembl ]. | VAR_020237 | |||||
| Natural variant | 1365 | 1 | Q → R. Corresponds to variant rs11568590 [ dbSNP | Ensembl ]. | VAR_020239 | |||||
| Natural variant | 1381 | 1 | R → S. Corresponds to variant rs45461799 [ dbSNP | Ensembl ]. | VAR_020240 | |||||
Experimental info | |||||||||
| Sequence conflict | 13 | 1 | K → N in AAH46126. Ref.10 | ||||||
| Sequence conflict | 42 | 1 | C → R in CAA76658. Ref.5 | ||||||
| Sequence conflict | 184 | 1 | A → T in AAD02846. Ref.4 | ||||||
| Sequence conflict | 344 | 1 | A → G in AAC34668. Ref.1 | ||||||
| Sequence conflict | 569 | 1 | F → Y in BAA28146. Ref.2 | ||||||
| Sequence conflict | 1128 | 1 | F → C in AAB71756. Ref.11 | ||||||
| Sequence conflict | 1212 | 1 | L → I in AAB71756. Ref.11 | ||||||
| Sequence conflict | 1249 | 1 | D → E in AAB71756. Ref.11 | ||||||
| Sequence conflict | 1359 | 1 | L → F in AAB71756. Ref.11 | ||||||
| Sequence conflict | 1362 | 1 | L → V in AAC34668. Ref.1 | ||||||
| Sequence conflict | 1362 | 1 | L → V in AAB71756. Ref.11 | ||||||
| Sequence conflict | 1364 | 1 | S → C in AAB71756. Ref.11 | ||||||
| Sequence conflict | 1366 | 1 | L → M in AAB71756. Ref.11 | ||||||
| Sequence conflict | 1371 | 1 | Q → R in AAB71756. Ref.11 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Isolation of a novel human canalicular multispecific organic anion transporter, cMOAT2/MRP3, and its expression in cisplatin-resistant cancer cells with decreased ATP-dependent drug transport." Uchiumi T., Hinoshita E., Haga S., Nakamura T., Tanaka T., Toh S., Furukawa M., Kawabe T., Wada M., Kagotani K., Okumura K., Kohno K., Akiyama S., Kuwano M. Biochem. Biophys. Res. Commun. 252:103-110(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Liver. |
| [2] | "cDNA cloning and inducible expression of human multidrug resistance associated protein 3 (MRP3)." Kiuchi Y., Suzuki H., Hirohashi T., Tyson C.A., Sugiyama Y. FEBS Lett. 433:149-152(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | "Characterization of MOAT-C and MOAT-D, new members of the MRP/cMOAT subfamily of transporter proteins." Belinsky M.G., Bain L.J., Balsara B.B., Testa J.R., Kruh G.D. J. Natl. Cancer Inst. 90:1735-1741(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [4] | "Human MRP3 transporter: identification of the 5'-flanking region, genomic organization and alternative splice variants." Fromm M.F., Leake B., Roden D.M., Wilkinson G.R., Kim R.B. Biochim. Biophys. Acta 1415:369-374(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3). Tissue: Liver. |
| [5] | "Characterization of the human multidrug resistance protein isoform MRP3 localized to the basolateral hepatocyte membrane." Koenig J., Rost D., Cui Y., Keppler D. Hepatology 29:1156-1163(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Liver. |
| [6] | "Complete coding sequence of human MRP3, a homolog of the human multidrug resistance-associated protein MRP1." Kool M., de Haas M., Ponne N.J., Baas F., Borst P. Submitted (JUN-1997) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Liver. |
| [7] | "Identification of a novel splice variant of MRP3 involved in resistance to DNA damaging agents." Auclair D., Alonso E., Chen L.B. Submitted (MAY-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4). Tissue: Colon carcinoma. |
| [8] | "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage." Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. Nusbaum C.Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [10] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5). Tissue: Blood. |
| [11] | "Analysis of expression of cMOAT (MRP2), MRP3, MRP4, and MRP5, homologues of the multidrug resistance-associated protein gene (MRP1), in human cancer cell lines." Kool M., de Haas M., Scheffer G.L., Scheper R.J., van Eijk M.J., Juijn J.A., Baas F., Borst P. Cancer Res. 57:3537-3547(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1043-1527 (ISOFORM 1). Tissue: Liver. |
| [12] | "An unappreciated role for RNA surveillance." Hillman R.T., Green R.E., Brenner S.E. Genome Biol. 5:R8.1-R8.16(2004) [PubMed] [Europe PMC] [Abstract] Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S). |
| [13] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
Web resources
| ABCMdb Database for mutations in ABC proteins |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF083552 mRNA. Translation: AAC34668.1. AB010887 mRNA. Translation: BAA28146.1. AF104943 mRNA. Translation: AAD04170.1. AF085690 mRNA. Translation: AAD02845.1. AF085691 mRNA. Translation: AAD02846.1. AF085692 mRNA. Translation: AAD02847.1. Y17151 mRNA. Translation: CAA76658.2. AF009670 mRNA. Translation: AAD01430.1. Frameshift. AF154001 mRNA. Translation: AAD38185.1. Sequence problems. AC004590 Genomic DNA. No translation available. AC005921 Genomic DNA. No translation available. CH471109 Genomic DNA. Translation: EAW94592.1. CH471109 Genomic DNA. Translation: EAW94590.1. CH471109 Genomic DNA. Translation: EAW94593.1. BC046126 mRNA. Translation: AAH46126.1. BC137347 mRNA. Translation: AAI37348.1. BC137348 mRNA. Translation: AAI37349.1. U83659 mRNA. Translation: AAB71756.1. Frameshift. |
| IPI | IPI00006674. IPI00219843. IPI00219844. IPI00251066. IPI00797470. |
| PIR | JE0336. |
| RefSeq | NP_001137542.1. NM_001144070.1. NP_003777.2. NM_003786.3. |
| UniGene | Hs.463421. |
3D structure databases | |
| ProteinModelPortal | O15438. |
| SMR | O15438. Positions 596-853, 949-1525. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | O15438. 5 interactions. |
| STRING | 9606.ENSP00000285238. |
Protein family/group databases | |
| TCDB | 3.A.1.208.9. ATP-binding cassette (ABC) superfamily. |
PTM databases | |
| PhosphoSite | O15438. |
Proteomic databases | |
| PaxDb | O15438. |
| PRIDE | O15438. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000285238; ENSP00000285238; ENSG00000108846. ENST00000427699; ENSP00000395160; ENSG00000108846. ENST00000502426; ENSP00000427073; ENSG00000108846. ENST00000505699; ENSP00000427521; ENSG00000108846. |
| GeneID | 8714. |
| KEGG | hsa:8714. |
| UCSC | uc002isk.4. human. uc002isl.3. human. uc002isn.3. human. |
Organism-specific databases | |
| CTD | 8714. |
| GeneCards | GC17P048712. |
| HGNC | HGNC:54. ABCC3. |
| HPA | CAB037136. |
| MIM | 604323. gene. |
| neXtProt | NX_O15438. |
| PharmGKB | PA376. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG1132. |
| HOVERGEN | HBG108314. |
| InParanoid | O15438. |
| KO | K05667. |
| OMA | NQKSCYP. |
| OrthoDB | EOG4TTGH1. |
| PhylomeDB | O15438. |
Enzyme and pathway databases | |
| Reactome | REACT_111217. Metabolism. REACT_15518. Transmembrane transport of small molecules. |
Gene expression databases | |
| ArrayExpress | O15438. |
| Bgee | O15438. |
| CleanEx | HS_ABCC3. |
| Genevestigator | O15438. |
| GermOnline | ENSG00000108846. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR003593. AAA+_ATPase. IPR003439. ABC_transporter-like. IPR017871. ABC_transporter_CS. IPR017940. ABC_transporter_type1. IPR001140. ABC_transptr_TM_dom. IPR011527. ABC_transptrTM_dom_typ1. IPR005292. Multidrug-R_assoc. [Graphical view] |
| Pfam | PF00664. ABC_membrane. 2 hits. PF00005. ABC_tran. 2 hits. [Graphical view] |
| SMART | SM00382. AAA. 2 hits. [Graphical view] |
| SUPFAM | SSF90123. ABC_TM_1. 2 hits. |
| TIGRFAMs | TIGR00957. MRP_assoc_pro. 1 hit. |
| PROSITE | PS50929. ABC_TM1F. 2 hits. PS00211. ABC_TRANSPORTER_1. 2 hits. PS50893. ABC_TRANSPORTER_2. 2 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | O15438. |
| ChEMBL | CHEMBL5918. |
| ChiTaRS | ABCC3. human. |
| DrugBank | DB01016. Glibenclamide. |
| GenomeRNAi | 8714. |
| NextBio | 32679. |
| SOURCE | Search... |
Entry information
| Entry name | MRP3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O15438 Secondary accession number(s): B2RPA9 Q9UN52 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
