Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O15438

- MRP3_HUMAN

UniProt

O15438 - MRP3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Canalicular multispecific organic anion transporter 2

Gene

ABCC3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

May act as an inducible transporter in the biliary and intestinal excretion of organic anions. Acts as an alternative route for the export of bile acids and glucuronides from cholestatic hepatocytes (By similarity).By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi661 – 6688ATP 1PROSITE-ProRule annotation
Nucleotide bindingi1323 – 13308ATP 2PROSITE-ProRule annotation

GO - Molecular functioni

  1. ATPase activity, coupled to transmembrane movement of substances Source: ProtInc
  2. ATP binding Source: ProtInc
  3. organic anion transmembrane transporter activity Source: ProtInc

GO - Biological processi

  1. bile acid and bile salt transport Source: Reactome
  2. bile acid metabolic process Source: Reactome
  3. small molecule metabolic process Source: Reactome
  4. transmembrane transport Source: Reactome
  5. transport Source: ProtInc
Complete GO annotation...

Keywords - Biological processi

Transport

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiREACT_11042. Recycling of bile acids and salts.
REACT_15480. ABC-family proteins mediated transport.

Protein family/group databases

TCDBi3.A.1.208.9. the atp-binding cassette (abc) superfamily.

Names & Taxonomyi

Protein namesi
Recommended name:
Canalicular multispecific organic anion transporter 2
Alternative name(s):
ATP-binding cassette sub-family C member 3
Multi-specific organic anion transporter D
Short name:
MOAT-D
Multidrug resistance-associated protein 3
Gene namesi
Name:ABCC3
Synonyms:CMOAT2, MLP2, MRP3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 17

Organism-specific databases

HGNCiHGNC:54. ABCC3.

Subcellular locationi

GO - Cellular componenti

  1. integral component of plasma membrane Source: ProtInc
  2. membrane Source: ProtInc
  3. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA376.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 15271527Canalicular multispecific organic anion transporter 2PRO_0000093360Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi18 – 181N-linked (GlcNAc...)Sequence Analysis
Glycosylationi1006 – 10061N-linked (GlcNAc...)Sequence Analysis
Glycosylationi1007 – 10071N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

MaxQBiO15438.
PaxDbiO15438.
PRIDEiO15438.

PTM databases

PhosphoSiteiO15438.

Expressioni

Tissue specificityi

Mainly expressed in the liver. Also expressed in small intestine, colon, prostate, testis, brain and at a lower level in the kidney.

Gene expression databases

BgeeiO15438.
CleanExiHS_ABCC3.
ExpressionAtlasiO15438. baseline and differential.
GenevestigatoriO15438.

Organism-specific databases

HPAiCAB037136.
HPA048483.

Interactioni

Protein-protein interaction databases

BioGridi114255. 2 interactions.
IntActiO15438. 5 interactions.
STRINGi9606.ENSP00000285238.

Structurei

3D structure databases

ProteinModelPortaliO15438.
SMRiO15438. Positions 626-853.
ModBaseiSearch...
MobiDBiSearch...

Topological domain

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 3232ExtracellularBy similarityAdd
BLAST
Topological domaini54 – 7320CytoplasmicBy similarityAdd
BLAST
Topological domaini95 – 995ExtracellularBy similarity
Topological domaini121 – 13212CytoplasmicBy similarityAdd
BLAST
Topological domaini154 – 17118ExtracellularBy similarityAdd
BLAST
Topological domaini193 – 302110CytoplasmicBy similarityAdd
BLAST
Topological domaini324 – 34926ExtracellularBy similarityAdd
BLAST
Topological domaini371 – 42656CytoplasmicBy similarityAdd
BLAST
Topological domaini448 – 4503ExtracellularBy similarity
Topological domaini472 – 53362CytoplasmicBy similarityAdd
BLAST
Topological domaini555 – 57622ExtracellularBy similarityAdd
BLAST
Topological domaini598 – 963366CytoplasmicBy similarityAdd
BLAST
Topological domaini985 – 102137ExtracellularBy similarityAdd
BLAST
Topological domaini1043 – 108543CytoplasmicBy similarityAdd
BLAST
Topological domaini1107 – 11071ExtracellularBy similarity
Topological domaini1129 – 119971CytoplasmicBy similarityAdd
BLAST
Topological domaini1221 – 12222ExtracellularBy similarity
Topological domaini1244 – 1527284CytoplasmicBy similarityAdd
BLAST

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei33 – 5321Helical; Name=1PROSITE-ProRule annotationAdd
BLAST
Transmembranei74 – 9421Helical; Name=2PROSITE-ProRule annotationAdd
BLAST
Transmembranei100 – 12021Helical; Name=3PROSITE-ProRule annotationAdd
BLAST
Transmembranei133 – 15321Helical; Name=4PROSITE-ProRule annotationAdd
BLAST
Transmembranei172 – 19221Helical; Name=5PROSITE-ProRule annotationAdd
BLAST
Transmembranei303 – 32321Helical; Name=6PROSITE-ProRule annotationAdd
BLAST
Transmembranei350 – 37021Helical; Name=7PROSITE-ProRule annotationAdd
BLAST
Transmembranei427 – 44721Helical; Name=8PROSITE-ProRule annotationAdd
BLAST
Transmembranei451 – 47121Helical; Name=9PROSITE-ProRule annotationAdd
BLAST
Transmembranei534 – 55421Helical; Name=10PROSITE-ProRule annotationAdd
BLAST
Transmembranei577 – 59721Helical; Name=11PROSITE-ProRule annotationAdd
BLAST
Transmembranei964 – 98421Helical; Name=12PROSITE-ProRule annotationAdd
BLAST
Transmembranei1022 – 104221Helical; Name=13PROSITE-ProRule annotationAdd
BLAST
Transmembranei1086 – 110621Helical; Name=14PROSITE-ProRule annotationAdd
BLAST
Transmembranei1108 – 112821Helical; Name=15PROSITE-ProRule annotationAdd
BLAST
Transmembranei1200 – 122021Helical; Name=16PROSITE-ProRule annotationAdd
BLAST
Transmembranei1223 – 124321Helical; Name=17PROSITE-ProRule annotationAdd
BLAST

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini311 – 594284ABC transmembrane type-1 1PROSITE-ProRule annotationAdd
BLAST
Domaini629 – 851223ABC transporter 1PROSITE-ProRule annotationAdd
BLAST
Domaini971 – 1252282ABC transmembrane type-1 2PROSITE-ProRule annotationAdd
BLAST
Domaini1291 – 1523233ABC transporter 2PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 2 ABC transmembrane type-1 domains.PROSITE-ProRule annotation
Contains 2 ABC transporter domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG1132.
GeneTreeiENSGT00760000119056.
HOVERGENiHBG108314.
InParanoidiO15438.
KOiK05667.
OMAiWNRHENK.
OrthoDBiEOG7R2BJW.
PhylomeDBiO15438.
TreeFamiTF105199.

Family and domain databases

Gene3Di3.40.50.300. 2 hits.
InterProiIPR003593. AAA+_ATPase.
IPR011527. ABC1_TM_dom.
IPR003439. ABC_transporter-like.
IPR017871. ABC_transporter_CS.
IPR001140. ABC_transptr_TM_dom.
IPR005292. Multidrug-R_assoc.
IPR027417. P-loop_NTPase.
[Graphical view]
PfamiPF00664. ABC_membrane. 2 hits.
PF00005. ABC_tran. 2 hits.
[Graphical view]
SMARTiSM00382. AAA. 2 hits.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 2 hits.
SSF90123. SSF90123. 2 hits.
TIGRFAMsiTIGR00957. MRP_assoc_pro. 1 hit.
PROSITEiPS50929. ABC_TM1F. 2 hits.
PS00211. ABC_TRANSPORTER_1. 2 hits.
PS50893. ABC_TRANSPORTER_2. 2 hits.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Note: Additional isoforms seem to exist.

Isoform 1 (identifier: O15438) [UniParc]FASTAAdd to Basket

Also known as: MRP3

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDALCGSGEL GSKFWDSNLS VHTENPDLTP CFQNSLLAWV PCIYLWVALP
60 70 80 90 100
CYLLYLRHHC RGYIILSHLS KLKMVLGVLL WCVSWADLFY SFHGLVHGRA
110 120 130 140 150
PAPVFFVTPL VVGVTMLLAT LLIQYERLQG VQSSGVLIIF WFLCVVCAIV
160 170 180 190 200
PFRSKILLAK AEGEISDPFR FTTFYIHFAL VLSALILACF REKPPFFSAK
210 220 230 240 250
NVDPNPYPET SAGFLSRLFF WWFTKMAIYG YRHPLEEKDL WSLKEEDRSQ
260 270 280 290 300
MVVQQLLEAW RKQEKQTARH KASAAPGKNA SGEDEVLLGA RPRPRKPSFL
310 320 330 340 350
KALLATFGSS FLISACFKLI QDLLSFINPQ LLSILIRFIS NPMAPSWWGF
360 370 380 390 400
LVAGLMFLCS MMQSLILQHY YHYIFVTGVK FRTGIMGVIY RKALVITNSV
410 420 430 440 450
KRASTVGEIV NLMSVDAQRF MDLAPFLNLL WSAPLQIILA IYFLWQNLGP
460 470 480 490 500
SVLAGVAFMV LLIPLNGAVA VKMRAFQVKQ MKLKDSRIKL MSEILNGIKV
510 520 530 540 550
LKLYAWEPSF LKQVEGIRQG ELQLLRTAAY LHTTTTFTWM CSPFLVTLIT
560 570 580 590 600
LWVYVYVDPN NVLDAEKAFV SVSLFNILRL PLNMLPQLIS NLTQASVSLK
610 620 630 640 650
RIQQFLSQEE LDPQSVERKT ISPGYAITIH SGTFTWAQDL PPTLHSLDIQ
660 670 680 690 700
VPKGALVAVV GPVGCGKSSL VSALLGEMEK LEGKVHMKGS VAYVPQQAWI
710 720 730 740 750
QNCTLQENVL FGKALNPKRY QQTLEACALL ADLEMLPGGD QTEIGEKGIN
760 770 780 790 800
LSGGQRQRVS LARAVYSDAD IFLLDDPLSA VDSHVAKHIF DHVIGPEGVL
810 820 830 840 850
AGKTRVLVTH GISFLPQTDF IIVLADGQVS EMGPYPALLQ RNGSFANFLC
860 870 880 890 900
NYAPDEDQGH LEDSWTALEG AEDKEALLIE DTLSNHTDLT DNDPVTYVVQ
910 920 930 940 950
KQFMRQLSAL SSDGEGQGRP VPRRHLGPSE KVQVTEAKAD GALTQEEKAA
960 970 980 990 1000
IGTVELSVFW DYAKAVGLCT TLAICLLYVG QSAAAIGANV WLSAWTNDAM
1010 1020 1030 1040 1050
ADSRQNNTSL RLGVYAALGI LQGFLVMLAA MAMAAGGIQA ARVLHQALLH
1060 1070 1080 1090 1100
NKIRSPQSFF DTTPSGRILN CFSKDIYVVD EVLAPVILML LNSFFNAIST
1110 1120 1130 1140 1150
LVVIMASTPL FTVVILPLAV LYTLVQRFYA ATSRQLKRLE SVSRSPIYSH
1160 1170 1180 1190 1200
FSETVTGASV IRAYNRSRDF EIISDTKVDA NQRSCYPYII SNRWLSIGVE
1210 1220 1230 1240 1250
FVGNCVVLFA ALFAVIGRSS LNPGLVGLSV SYSLQVTFAL NWMIRMMSDL
1260 1270 1280 1290 1300
ESNIVAVERV KEYSKTETEA PWVVEGSRPP EGWPPRGEVE FRNYSVRYRP
1310 1320 1330 1340 1350
GLDLVLRDLS LHVHGGEKVG IVGRTGAGKS SMTLCLFRIL EAAKGEIRID
1360 1370 1380 1390 1400
GLNVADIGLH DLRSQLTIIP QDPILFSGTL RMNLDPFGSY SEEDIWWALE
1410 1420 1430 1440 1450
LSHLHTFVSS QPAGLDFQCS EGGENLSVGQ RQLVCLARAL LRKSRILVLD
1460 1470 1480 1490 1500
EATAAIDLET DNLIQATIRT QFDTCTVLTI AHRLNTIMDY TRVLVLDKGV
1510 1520
VAEFDSPANL IAARGIFYGM ARDAGLA
Length:1,527
Mass (Da):169,343
Last modified:May 30, 2000 - v3
Checksum:i0D1F879B6F18370C
GO
Isoform 2 (identifier: O15438-2) [UniParc]FASTAAdd to Basket

Also known as: MRP3A

The sequence of this isoform differs from the canonical sequence as follows:
     1194-1527: WLSIGVEFVG...YGMARDAGLA → SEAASLAPCS...ALPLPHFLLI

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »
Length:1,238
Mass (Da):137,297
Checksum:i8E449E28F32BA882
GO
Isoform 3 (identifier: O15438-3) [UniParc]FASTAAdd to Basket

Also known as: MRP3B

The sequence of this isoform differs from the canonical sequence as follows:
     226-510: MAIYGYRHPL...LKLYAWEPSF → LLNPDPLRGC...IEGLAHQADE
     511-1527: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »
Length:510
Mass (Da):55,305
Checksum:iB00B65CBB262DEAA
GO
Isoform 4 (identifier: O15438-4) [UniParc]FASTAAdd to Basket

Also known as: MRP3S1

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MPACTVKESPNCKRNFCKADHIVNTSGGSNLERVGKQKTIQKGQFSQRSVCT

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.

Show »
Length:1,578
Mass (Da):174,907
Checksum:i79A1F68027EBE525
GO
Isoform 5 (identifier: O15438-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     547-572: TLITLWVYVYVDPNNVLDAEKAFVSV → RLGTGLGPCLQGSGCPGMARAHWTLP
     573-1527: Missing.

Note: No experimental confirmation available.

Show »
Length:572
Mass (Da):64,632
Checksum:iD50802109C86F4DE
GO

Sequence cautioni

The sequence AAB71756.1 differs from that shown. Reason: Frameshift at positions 1334 and 1338.
The sequence AAD01430.1 differs from that shown. Reason: Frameshift at positions 355, 359 and 361.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti13 – 131K → N in AAH46126. (PubMed:15489334)Curated
Sequence conflicti42 – 421C → R in CAA76658. (PubMed:10094960)Curated
Sequence conflicti184 – 1841A → T in AAD02846. (PubMed:9889399)Curated
Sequence conflicti344 – 3441A → G in AAC34668. (PubMed:9813153)Curated
Sequence conflicti569 – 5691F → Y in BAA28146. (PubMed:9738950)Curated
Sequence conflicti1128 – 11281F → C in AAB71756. (PubMed:9270026)Curated
Sequence conflicti1212 – 12121L → I in AAB71756. (PubMed:9270026)Curated
Sequence conflicti1249 – 12491D → E in AAB71756. (PubMed:9270026)Curated
Sequence conflicti1359 – 13591L → F in AAB71756. (PubMed:9270026)Curated
Sequence conflicti1362 – 13621L → V in AAC34668. (PubMed:9813153)Curated
Sequence conflicti1362 – 13621L → V in AAB71756. (PubMed:9270026)Curated
Sequence conflicti1364 – 13641S → C in AAB71756. (PubMed:9270026)Curated
Sequence conflicti1366 – 13661L → M in AAB71756. (PubMed:9270026)Curated
Sequence conflicti1371 – 13711Q → R in AAB71756. (PubMed:9270026)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti11 – 111G → D.
Corresponds to variant rs11568609 [ dbSNP | Ensembl ].
VAR_029119
Natural varianti346 – 3461S → F.
Corresponds to variant rs11568605 [ dbSNP | Ensembl ].
VAR_020235
Natural varianti1286 – 12861R → G.
Corresponds to variant rs11568593 [ dbSNP | Ensembl ].
VAR_029120
Natural varianti1297 – 12971R → H.
Corresponds to variant rs11568591 [ dbSNP | Ensembl ].
VAR_020237
Natural varianti1365 – 13651Q → R.
Corresponds to variant rs11568590 [ dbSNP | Ensembl ].
VAR_020239
Natural varianti1381 – 13811R → S.
Corresponds to variant rs45461799 [ dbSNP | Ensembl ].
VAR_020240

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MPACTVKESPNCKRNFCKAD HIVNTSGGSNLERVGKQKTI QKGQFSQRSVCT in isoform 4. 1 PublicationVSP_043864
Alternative sequencei226 – 510285MAIYG…WEPSF → LLNPDPLRGCLPGFTSPQDG HLWLPASPGGEGPLVPKGRG QIPDGGAAAAGGMEEAGKAD GTTQGFSSTWEKCLRRGRGA AGCPAQAPEALLPEGPAGHL RLQLPHQCLLQAYPGPALLH QSTAAQHPDQVYLQPHGPLL VGLPGGWADVPVLHDAVADL TTLLPLHLCDWGEVSYWDHG CHLQEGSGYHQLSQTCVHCG GNCQPHVSGCPALHGPCPLP QSAVVSTPADHPGDLLPLAE PRSLCPGWSRFHGLADSTQR SCGREDARLPGKANEIEGLA HQADE in isoform 3. 1 PublicationVSP_000040Add
BLAST
Alternative sequencei511 – 15271017Missing in isoform 3. 1 PublicationVSP_000041Add
BLAST
Alternative sequencei547 – 57226TLITL…AFVSV → RLGTGLGPCLQGSGCPGMAR AHWTLP in isoform 5. 1 PublicationVSP_039041Add
BLAST
Alternative sequencei573 – 1527955Missing in isoform 5. 1 PublicationVSP_039042Add
BLAST
Alternative sequencei1194 – 1527334WLSIG…DAGLA → SEAASLAPCSSRNSQQALWC SGSLSLLSPKQKTGPALPLP HFLLI in isoform 2. 1 PublicationVSP_000042Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF083552 mRNA. Translation: AAC34668.1.
AB010887 mRNA. Translation: BAA28146.1.
AF104943 mRNA. Translation: AAD04170.1.
AF085690 mRNA. Translation: AAD02845.1.
AF085691 mRNA. Translation: AAD02846.1.
AF085692 mRNA. Translation: AAD02847.1.
Y17151 mRNA. Translation: CAA76658.2.
AF009670 mRNA. Translation: AAD01430.1. Frameshift.
AF154001 mRNA. Translation: AAD38185.1. Sequence problems.
AC004590 Genomic DNA. No translation available.
AC005921 Genomic DNA. No translation available.
CH471109 Genomic DNA. Translation: EAW94592.1.
CH471109 Genomic DNA. Translation: EAW94590.1.
CH471109 Genomic DNA. Translation: EAW94593.1.
BC046126 mRNA. Translation: AAH46126.1.
BC137347 mRNA. Translation: AAI37348.1.
BC137348 mRNA. Translation: AAI37349.1.
U83659 mRNA. Translation: AAB71756.1. Frameshift.
CCDSiCCDS32681.1. [O15438-1]
CCDS45739.1. [O15438-5]
PIRiJE0336.
RefSeqiNP_001137542.1. NM_001144070.1. [O15438-5]
NP_003777.2. NM_003786.3. [O15438-1]
UniGeneiHs.463421.

Genome annotation databases

EnsembliENST00000285238; ENSP00000285238; ENSG00000108846. [O15438-1]
ENST00000427699; ENSP00000395160; ENSG00000108846. [O15438-5]
ENST00000502426; ENSP00000427073; ENSG00000108846. [O15438-3]
ENST00000505699; ENSP00000427521; ENSG00000108846. [O15438-2]
GeneIDi8714.
KEGGihsa:8714.
UCSCiuc002isk.4. human. [O15438-5]
uc002isl.3. human. [O15438-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

ABCMdb

Database for mutations in ABC proteins

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF083552 mRNA. Translation: AAC34668.1 .
AB010887 mRNA. Translation: BAA28146.1 .
AF104943 mRNA. Translation: AAD04170.1 .
AF085690 mRNA. Translation: AAD02845.1 .
AF085691 mRNA. Translation: AAD02846.1 .
AF085692 mRNA. Translation: AAD02847.1 .
Y17151 mRNA. Translation: CAA76658.2 .
AF009670 mRNA. Translation: AAD01430.1 . Frameshift.
AF154001 mRNA. Translation: AAD38185.1 . Sequence problems.
AC004590 Genomic DNA. No translation available.
AC005921 Genomic DNA. No translation available.
CH471109 Genomic DNA. Translation: EAW94592.1 .
CH471109 Genomic DNA. Translation: EAW94590.1 .
CH471109 Genomic DNA. Translation: EAW94593.1 .
BC046126 mRNA. Translation: AAH46126.1 .
BC137347 mRNA. Translation: AAI37348.1 .
BC137348 mRNA. Translation: AAI37349.1 .
U83659 mRNA. Translation: AAB71756.1 . Frameshift.
CCDSi CCDS32681.1. [O15438-1 ]
CCDS45739.1. [O15438-5 ]
PIRi JE0336.
RefSeqi NP_001137542.1. NM_001144070.1. [O15438-5 ]
NP_003777.2. NM_003786.3. [O15438-1 ]
UniGenei Hs.463421.

3D structure databases

ProteinModelPortali O15438.
SMRi O15438. Positions 626-853.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 114255. 2 interactions.
IntActi O15438. 5 interactions.
STRINGi 9606.ENSP00000285238.

Chemistry

BindingDBi O15438.
ChEMBLi CHEMBL5918.
DrugBanki DB00515. Cisplatin.
DB00257. Clotrimazole.
DB00286. Conjugated Estrogens.
DB00091. Cyclosporine.
DB00997. Doxorubicin.
DB00773. Etoposide.
DB00973. Ezetimibe.
DB00544. Fluorouracil.
DB00158. Folic Acid.
DB08884. Gadoxetate.
DB00143. Glutathione.
DB01016. Glyburide.
DB00328. Indomethacin.
DB00709. Lamivudine.
DB00650. Leucovorin.
DB00563. Methotrexate.
DB01011. Metyrapone.
DB01115. Nifedipine.
DB00338. Omeprazole.
DB01174. Phenobarbital.
DB01032. Probenecid.
DB01045. Rifampicin.
DB01138. Sulfinpyrazone.
DB00661. Verapamil.
DB00541. Vincristine.

Protein family/group databases

TCDBi 3.A.1.208.9. the atp-binding cassette (abc) superfamily.

PTM databases

PhosphoSitei O15438.

Proteomic databases

MaxQBi O15438.
PaxDbi O15438.
PRIDEi O15438.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000285238 ; ENSP00000285238 ; ENSG00000108846 . [O15438-1 ]
ENST00000427699 ; ENSP00000395160 ; ENSG00000108846 . [O15438-5 ]
ENST00000502426 ; ENSP00000427073 ; ENSG00000108846 . [O15438-3 ]
ENST00000505699 ; ENSP00000427521 ; ENSG00000108846 . [O15438-2 ]
GeneIDi 8714.
KEGGi hsa:8714.
UCSCi uc002isk.4. human. [O15438-5 ]
uc002isl.3. human. [O15438-1 ]

Organism-specific databases

CTDi 8714.
GeneCardsi GC17P048712.
HGNCi HGNC:54. ABCC3.
HPAi CAB037136.
HPA048483.
MIMi 604323. gene.
neXtProti NX_O15438.
PharmGKBi PA376.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG1132.
GeneTreei ENSGT00760000119056.
HOVERGENi HBG108314.
InParanoidi O15438.
KOi K05667.
OMAi WNRHENK.
OrthoDBi EOG7R2BJW.
PhylomeDBi O15438.
TreeFami TF105199.

Enzyme and pathway databases

Reactomei REACT_11042. Recycling of bile acids and salts.
REACT_15480. ABC-family proteins mediated transport.

Miscellaneous databases

ChiTaRSi ABCC3. human.
GeneWikii ABCC3.
GenomeRNAii 8714.
NextBioi 32679.
PROi O15438.
SOURCEi Search...

Gene expression databases

Bgeei O15438.
CleanExi HS_ABCC3.
ExpressionAtlasi O15438. baseline and differential.
Genevestigatori O15438.

Family and domain databases

Gene3Di 3.40.50.300. 2 hits.
InterProi IPR003593. AAA+_ATPase.
IPR011527. ABC1_TM_dom.
IPR003439. ABC_transporter-like.
IPR017871. ABC_transporter_CS.
IPR001140. ABC_transptr_TM_dom.
IPR005292. Multidrug-R_assoc.
IPR027417. P-loop_NTPase.
[Graphical view ]
Pfami PF00664. ABC_membrane. 2 hits.
PF00005. ABC_tran. 2 hits.
[Graphical view ]
SMARTi SM00382. AAA. 2 hits.
[Graphical view ]
SUPFAMi SSF52540. SSF52540. 2 hits.
SSF90123. SSF90123. 2 hits.
TIGRFAMsi TIGR00957. MRP_assoc_pro. 1 hit.
PROSITEi PS50929. ABC_TM1F. 2 hits.
PS00211. ABC_TRANSPORTER_1. 2 hits.
PS50893. ABC_TRANSPORTER_2. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Isolation of a novel human canalicular multispecific organic anion transporter, cMOAT2/MRP3, and its expression in cisplatin-resistant cancer cells with decreased ATP-dependent drug transport."
    Uchiumi T., Hinoshita E., Haga S., Nakamura T., Tanaka T., Toh S., Furukawa M., Kawabe T., Wada M., Kagotani K., Okumura K., Kohno K., Akiyama S., Kuwano M.
    Biochem. Biophys. Res. Commun. 252:103-110(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Liver.
  2. "cDNA cloning and inducible expression of human multidrug resistance associated protein 3 (MRP3)."
    Kiuchi Y., Suzuki H., Hirohashi T., Tyson C.A., Sugiyama Y.
    FEBS Lett. 433:149-152(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  3. "Characterization of MOAT-C and MOAT-D, new members of the MRP/cMOAT subfamily of transporter proteins."
    Belinsky M.G., Bain L.J., Balsara B.B., Testa J.R., Kruh G.D.
    J. Natl. Cancer Inst. 90:1735-1741(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  4. "Human MRP3 transporter: identification of the 5'-flanking region, genomic organization and alternative splice variants."
    Fromm M.F., Leake B., Roden D.M., Wilkinson G.R., Kim R.B.
    Biochim. Biophys. Acta 1415:369-374(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3).
    Tissue: Liver.
  5. "Characterization of the human multidrug resistance protein isoform MRP3 localized to the basolateral hepatocyte membrane."
    Koenig J., Rost D., Cui Y., Keppler D.
    Hepatology 29:1156-1163(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Liver.
  6. "Complete coding sequence of human MRP3, a homolog of the human multidrug resistance-associated protein MRP1."
    Kool M., de Haas M., Ponne N.J., Baas F., Borst P.
    Submitted (JUN-1997) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Liver.
  7. "Identification of a novel splice variant of MRP3 involved in resistance to DNA damaging agents."
    Auclair D., Alonso E., Chen L.B.
    Submitted (MAY-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
    Tissue: Colon carcinoma.
  8. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
    Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
    , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
    Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  10. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5).
    Tissue: Blood.
  11. "Analysis of expression of cMOAT (MRP2), MRP3, MRP4, and MRP5, homologues of the multidrug resistance-associated protein gene (MRP1), in human cancer cell lines."
    Kool M., de Haas M., Scheffer G.L., Scheper R.J., van Eijk M.J., Juijn J.A., Baas F., Borst P.
    Cancer Res. 57:3537-3547(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1043-1527 (ISOFORM 1).
    Tissue: Liver.
  12. Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S).
  13. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.

Entry informationi

Entry nameiMRP3_HUMAN
AccessioniPrimary (citable) accession number: O15438
Secondary accession number(s): B2RPA9
, D3DTX9, O60265, O60922, O75621, O95078, O95289, O95290, Q86X85, Q9UN52
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: May 30, 2000
Last modified: October 29, 2014
This is version 141 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3