Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Canalicular multispecific organic anion transporter 2

Gene

ABCC3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May act as an inducible transporter in the biliary and intestinal excretion of organic anions. Acts as an alternative route for the export of bile acids and glucuronides from cholestatic hepatocytes (By similarity).By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi661 – 668ATP 1PROSITE-ProRule annotation8
Nucleotide bindingi1323 – 1330ATP 2PROSITE-ProRule annotation8

GO - Molecular functioni

  • ATPase activity, coupled to transmembrane movement of substances Source: ProtInc
  • ATPase-coupled anion transmembrane transporter activity Source: Reactome
  • ATP binding Source: ProtInc
  • bile acid-exporting ATPase activity Source: Reactome
  • organic anion transmembrane transporter activity Source: ProtInc
  • xenobiotic transmembrane transporting ATPase activity Source: GO_Central

GO - Biological processi

Keywordsi

Biological processTransport
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-HSA-159418 Recycling of bile acids and salts
R-HSA-382556 ABC-family proteins mediated transport
SIGNORiO15438

Protein family/group databases

TCDBi3.A.1.208.9 the atp-binding cassette (abc) superfamily

Names & Taxonomyi

Protein namesi
Recommended name:
Canalicular multispecific organic anion transporter 2
Alternative name(s):
ATP-binding cassette sub-family C member 3
Multi-specific organic anion transporter D
Short name:
MOAT-D
Multidrug resistance-associated protein 3
Gene namesi
Name:ABCC3
Synonyms:CMOAT2, MLP2, MRP3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

EuPathDBiHostDB:ENSG00000108846.15
HGNCiHGNC:54 ABCC3
MIMi604323 gene
neXtProtiNX_O15438

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 32ExtracellularBy similarityAdd BLAST32
Transmembranei33 – 53Helical; Name=1PROSITE-ProRule annotationAdd BLAST21
Topological domaini54 – 73CytoplasmicBy similarityAdd BLAST20
Transmembranei74 – 94Helical; Name=2PROSITE-ProRule annotationAdd BLAST21
Topological domaini95 – 99ExtracellularBy similarity5
Transmembranei100 – 120Helical; Name=3PROSITE-ProRule annotationAdd BLAST21
Topological domaini121 – 132CytoplasmicBy similarityAdd BLAST12
Transmembranei133 – 153Helical; Name=4PROSITE-ProRule annotationAdd BLAST21
Topological domaini154 – 171ExtracellularBy similarityAdd BLAST18
Transmembranei172 – 192Helical; Name=5PROSITE-ProRule annotationAdd BLAST21
Topological domaini193 – 302CytoplasmicBy similarityAdd BLAST110
Transmembranei303 – 323Helical; Name=6PROSITE-ProRule annotationAdd BLAST21
Topological domaini324 – 349ExtracellularBy similarityAdd BLAST26
Transmembranei350 – 370Helical; Name=7PROSITE-ProRule annotationAdd BLAST21
Topological domaini371 – 426CytoplasmicBy similarityAdd BLAST56
Transmembranei427 – 447Helical; Name=8PROSITE-ProRule annotationAdd BLAST21
Topological domaini448 – 450ExtracellularBy similarity3
Transmembranei451 – 471Helical; Name=9PROSITE-ProRule annotationAdd BLAST21
Topological domaini472 – 533CytoplasmicBy similarityAdd BLAST62
Transmembranei534 – 554Helical; Name=10PROSITE-ProRule annotationAdd BLAST21
Topological domaini555 – 576ExtracellularBy similarityAdd BLAST22
Transmembranei577 – 597Helical; Name=11PROSITE-ProRule annotationAdd BLAST21
Topological domaini598 – 963CytoplasmicBy similarityAdd BLAST366
Transmembranei964 – 984Helical; Name=12PROSITE-ProRule annotationAdd BLAST21
Topological domaini985 – 1021ExtracellularBy similarityAdd BLAST37
Transmembranei1022 – 1042Helical; Name=13PROSITE-ProRule annotationAdd BLAST21
Topological domaini1043 – 1085CytoplasmicBy similarityAdd BLAST43
Transmembranei1086 – 1106Helical; Name=14PROSITE-ProRule annotationAdd BLAST21
Topological domaini1107ExtracellularBy similarity1
Transmembranei1108 – 1128Helical; Name=15PROSITE-ProRule annotationAdd BLAST21
Topological domaini1129 – 1199CytoplasmicBy similarityAdd BLAST71
Transmembranei1200 – 1220Helical; Name=16PROSITE-ProRule annotationAdd BLAST21
Topological domaini1221 – 1222ExtracellularBy similarity2
Transmembranei1223 – 1243Helical; Name=17PROSITE-ProRule annotationAdd BLAST21
Topological domaini1244 – 1527CytoplasmicBy similarityAdd BLAST284

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi8714
OpenTargetsiENSG00000108846
PharmGKBiPA376

Chemistry databases

ChEMBLiCHEMBL5918
DrugBankiDB02659 Cholic Acid
DB00515 Cisplatin
DB00257 Clotrimazole
DB00286 Conjugated Equine Estrogens
DB00091 Cyclosporine
DB00997 Doxorubicin
DB00773 Etoposide
DB00973 Ezetimibe
DB00544 Fluorouracil
DB00158 Folic Acid
DB08884 Gadoxetic acid
DB00143 Glutathione
DB01016 Glyburide
DB00328 Indomethacin
DB00709 Lamivudine
DB00563 Methotrexate
DB01011 Metyrapone
DB01115 Nifedipine
DB00338 Omeprazole
DB01174 Phenobarbital
DB01032 Probenecid
DB01045 Rifampicin
DB01138 Sulfinpyrazone
DB04348 Taurocholic Acid
DB00661 Verapamil
DB00541 Vincristine

Polymorphism and mutation databases

BioMutaiABCC3

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000933601 – 1527Canalicular multispecific organic anion transporter 2Add BLAST1527

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi18N-linked (GlcNAc...) asparagineSequence analysis1
Modified residuei489N6-succinyllysineBy similarity1
Modified residuei864PhosphoserineBy similarity1
Modified residuei908PhosphoserineCombined sources1
Modified residuei911PhosphoserineCombined sources1
Glycosylationi1006N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1007N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiO15438
PaxDbiO15438
PeptideAtlasiO15438
PRIDEiO15438

PTM databases

iPTMnetiO15438
PhosphoSitePlusiO15438

Expressioni

Tissue specificityi

Mainly expressed in the liver. Also expressed in small intestine, colon, prostate, testis, brain and at a lower level in the kidney.

Gene expression databases

BgeeiENSG00000108846
CleanExiHS_ABCC3
ExpressionAtlasiO15438 baseline and differential
GenevisibleiO15438 HS

Organism-specific databases

HPAiCAB037136
HPA048483

Interactioni

Protein-protein interaction databases

BioGridi114255, 9 interactors
IntActiO15438, 5 interactors
STRINGi9606.ENSP00000285238

Chemistry databases

BindingDBiO15438

Structurei

3D structure databases

ProteinModelPortaliO15438
SMRiO15438
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini311 – 594ABC transmembrane type-1 1PROSITE-ProRule annotationAdd BLAST284
Domaini629 – 851ABC transporter 1PROSITE-ProRule annotationAdd BLAST223
Domaini971 – 1252ABC transmembrane type-1 2PROSITE-ProRule annotationAdd BLAST282
Domaini1291 – 1523ABC transporter 2PROSITE-ProRule annotationAdd BLAST233

Sequence similaritiesi

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0054 Eukaryota
COG1132 LUCA
GeneTreeiENSGT00880000137856
HOVERGENiHBG108314
InParanoidiO15438
KOiK05667
OMAiAFQVEQM
OrthoDBiEOG091G00IN
PhylomeDBiO15438
TreeFamiTF105199

Family and domain databases

Gene3Di1.20.1560.10, 2 hits
InterProiView protein in InterPro
IPR003593 AAA+_ATPase
IPR011527 ABC1_TM_dom
IPR036640 ABC1_TM_sf
IPR003439 ABC_transporter-like
IPR017871 ABC_transporter_CS
IPR005292 Multidrug-R_assoc
IPR027417 P-loop_NTPase
PfamiView protein in Pfam
PF00664 ABC_membrane, 2 hits
PF00005 ABC_tran, 2 hits
SMARTiView protein in SMART
SM00382 AAA, 2 hits
SUPFAMiSSF52540 SSF52540, 2 hits
SSF90123 SSF90123, 2 hits
TIGRFAMsiTIGR00957 MRP_assoc_pro, 1 hit
PROSITEiView protein in PROSITE
PS50929 ABC_TM1F, 2 hits
PS00211 ABC_TRANSPORTER_1, 2 hits
PS50893 ABC_TRANSPORTER_2, 2 hits

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.
Isoform 1 (identifier: O15438-1) [UniParc]FASTAAdd to basket
Also known as: MRP3

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDALCGSGEL GSKFWDSNLS VHTENPDLTP CFQNSLLAWV PCIYLWVALP
60 70 80 90 100
CYLLYLRHHC RGYIILSHLS KLKMVLGVLL WCVSWADLFY SFHGLVHGRA
110 120 130 140 150
PAPVFFVTPL VVGVTMLLAT LLIQYERLQG VQSSGVLIIF WFLCVVCAIV
160 170 180 190 200
PFRSKILLAK AEGEISDPFR FTTFYIHFAL VLSALILACF REKPPFFSAK
210 220 230 240 250
NVDPNPYPET SAGFLSRLFF WWFTKMAIYG YRHPLEEKDL WSLKEEDRSQ
260 270 280 290 300
MVVQQLLEAW RKQEKQTARH KASAAPGKNA SGEDEVLLGA RPRPRKPSFL
310 320 330 340 350
KALLATFGSS FLISACFKLI QDLLSFINPQ LLSILIRFIS NPMAPSWWGF
360 370 380 390 400
LVAGLMFLCS MMQSLILQHY YHYIFVTGVK FRTGIMGVIY RKALVITNSV
410 420 430 440 450
KRASTVGEIV NLMSVDAQRF MDLAPFLNLL WSAPLQIILA IYFLWQNLGP
460 470 480 490 500
SVLAGVAFMV LLIPLNGAVA VKMRAFQVKQ MKLKDSRIKL MSEILNGIKV
510 520 530 540 550
LKLYAWEPSF LKQVEGIRQG ELQLLRTAAY LHTTTTFTWM CSPFLVTLIT
560 570 580 590 600
LWVYVYVDPN NVLDAEKAFV SVSLFNILRL PLNMLPQLIS NLTQASVSLK
610 620 630 640 650
RIQQFLSQEE LDPQSVERKT ISPGYAITIH SGTFTWAQDL PPTLHSLDIQ
660 670 680 690 700
VPKGALVAVV GPVGCGKSSL VSALLGEMEK LEGKVHMKGS VAYVPQQAWI
710 720 730 740 750
QNCTLQENVL FGKALNPKRY QQTLEACALL ADLEMLPGGD QTEIGEKGIN
760 770 780 790 800
LSGGQRQRVS LARAVYSDAD IFLLDDPLSA VDSHVAKHIF DHVIGPEGVL
810 820 830 840 850
AGKTRVLVTH GISFLPQTDF IIVLADGQVS EMGPYPALLQ RNGSFANFLC
860 870 880 890 900
NYAPDEDQGH LEDSWTALEG AEDKEALLIE DTLSNHTDLT DNDPVTYVVQ
910 920 930 940 950
KQFMRQLSAL SSDGEGQGRP VPRRHLGPSE KVQVTEAKAD GALTQEEKAA
960 970 980 990 1000
IGTVELSVFW DYAKAVGLCT TLAICLLYVG QSAAAIGANV WLSAWTNDAM
1010 1020 1030 1040 1050
ADSRQNNTSL RLGVYAALGI LQGFLVMLAA MAMAAGGIQA ARVLHQALLH
1060 1070 1080 1090 1100
NKIRSPQSFF DTTPSGRILN CFSKDIYVVD EVLAPVILML LNSFFNAIST
1110 1120 1130 1140 1150
LVVIMASTPL FTVVILPLAV LYTLVQRFYA ATSRQLKRLE SVSRSPIYSH
1160 1170 1180 1190 1200
FSETVTGASV IRAYNRSRDF EIISDTKVDA NQRSCYPYII SNRWLSIGVE
1210 1220 1230 1240 1250
FVGNCVVLFA ALFAVIGRSS LNPGLVGLSV SYSLQVTFAL NWMIRMMSDL
1260 1270 1280 1290 1300
ESNIVAVERV KEYSKTETEA PWVVEGSRPP EGWPPRGEVE FRNYSVRYRP
1310 1320 1330 1340 1350
GLDLVLRDLS LHVHGGEKVG IVGRTGAGKS SMTLCLFRIL EAAKGEIRID
1360 1370 1380 1390 1400
GLNVADIGLH DLRSQLTIIP QDPILFSGTL RMNLDPFGSY SEEDIWWALE
1410 1420 1430 1440 1450
LSHLHTFVSS QPAGLDFQCS EGGENLSVGQ RQLVCLARAL LRKSRILVLD
1460 1470 1480 1490 1500
EATAAIDLET DNLIQATIRT QFDTCTVLTI AHRLNTIMDY TRVLVLDKGV
1510 1520
VAEFDSPANL IAARGIFYGM ARDAGLA
Length:1,527
Mass (Da):169,343
Last modified:May 30, 2000 - v3
Checksum:i0D1F879B6F18370C
GO
Isoform 2 (identifier: O15438-2) [UniParc]FASTAAdd to basket
Also known as: MRP3A

The sequence of this isoform differs from the canonical sequence as follows:
     1194-1527: WLSIGVEFVG...YGMARDAGLA → SEAASLAPCS...ALPLPHFLLI

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:1,238
Mass (Da):137,297
Checksum:i8E449E28F32BA882
GO
Isoform 3 (identifier: O15438-3) [UniParc]FASTAAdd to basket
Also known as: MRP3B

The sequence of this isoform differs from the canonical sequence as follows:
     226-510: MAIYGYRHPL...LKLYAWEPSF → LLNPDPLRGC...IEGLAHQADE
     511-1527: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:510
Mass (Da):55,305
Checksum:iB00B65CBB262DEAA
GO
Isoform 4 (identifier: O15438-4) [UniParc]FASTAAdd to basket
Also known as: MRP3S1

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MPACTVKESPNCKRNFCKADHIVNTSGGSNLERVGKQKTIQKGQFSQRSVCT

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.
Show »
Length:1,578
Mass (Da):174,907
Checksum:i79A1F68027EBE525
GO
Isoform 5 (identifier: O15438-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     547-572: TLITLWVYVYVDPNNVLDAEKAFVSV → RLGTGLGPCLQGSGCPGMARAHWTLP
     573-1527: Missing.

Note: No experimental confirmation available.
Show »
Length:572
Mass (Da):64,632
Checksum:iD50802109C86F4DE
GO

Sequence cautioni

The sequence AAB71756 differs from that shown. Reason: Frameshift at positions 1334 and 1338.Curated
The sequence AAD01430 differs from that shown. Reason: Frameshift at positions 355, 359 and 361.Curated
The sequence AAD38185 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti13K → N in AAH46126 (PubMed:15489334).Curated1
Sequence conflicti42C → R in CAA76658 (PubMed:10094960).Curated1
Sequence conflicti184A → T in AAD02846 (PubMed:9889399).Curated1
Sequence conflicti344A → G in AAC34668 (PubMed:9813153).Curated1
Sequence conflicti569F → Y in BAA28146 (PubMed:9738950).Curated1
Sequence conflicti1128F → C in AAB71756 (PubMed:9270026).Curated1
Sequence conflicti1212L → I in AAB71756 (PubMed:9270026).Curated1
Sequence conflicti1249D → E in AAB71756 (PubMed:9270026).Curated1
Sequence conflicti1359L → F in AAB71756 (PubMed:9270026).Curated1
Sequence conflicti1362L → V in AAC34668 (PubMed:9813153).Curated1
Sequence conflicti1362L → V in AAB71756 (PubMed:9270026).Curated1
Sequence conflicti1364S → C in AAB71756 (PubMed:9270026).Curated1
Sequence conflicti1366L → M in AAB71756 (PubMed:9270026).Curated1
Sequence conflicti1371Q → R in AAB71756 (PubMed:9270026).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02911911G → D. Corresponds to variant dbSNP:rs11568609Ensembl.1
Natural variantiVAR_020235346S → F. Corresponds to variant dbSNP:rs11568605Ensembl.1
Natural variantiVAR_0291201286R → G. Corresponds to variant dbSNP:rs11568593Ensembl.1
Natural variantiVAR_0202371297R → H. Corresponds to variant dbSNP:rs11568591Ensembl.1
Natural variantiVAR_0202391365Q → R. Corresponds to variant dbSNP:rs11568590Ensembl.1
Natural variantiVAR_0202401381R → S. Corresponds to variant dbSNP:rs45461799Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0438641M → MPACTVKESPNCKRNFCKAD HIVNTSGGSNLERVGKQKTI QKGQFSQRSVCT in isoform 4. 1 Publication1
Alternative sequenceiVSP_000040226 – 510MAIYG…WEPSF → LLNPDPLRGCLPGFTSPQDG HLWLPASPGGEGPLVPKGRG QIPDGGAAAAGGMEEAGKAD GTTQGFSSTWEKCLRRGRGA AGCPAQAPEALLPEGPAGHL RLQLPHQCLLQAYPGPALLH QSTAAQHPDQVYLQPHGPLL VGLPGGWADVPVLHDAVADL TTLLPLHLCDWGEVSYWDHG CHLQEGSGYHQLSQTCVHCG GNCQPHVSGCPALHGPCPLP QSAVVSTPADHPGDLLPLAE PRSLCPGWSRFHGLADSTQR SCGREDARLPGKANEIEGLA HQADE in isoform 3. 1 PublicationAdd BLAST285
Alternative sequenceiVSP_000041511 – 1527Missing in isoform 3. 1 PublicationAdd BLAST1017
Alternative sequenceiVSP_039041547 – 572TLITL…AFVSV → RLGTGLGPCLQGSGCPGMAR AHWTLP in isoform 5. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_039042573 – 1527Missing in isoform 5. 1 PublicationAdd BLAST955
Alternative sequenceiVSP_0000421194 – 1527WLSIG…DAGLA → SEAASLAPCSSRNSQQALWC SGSLSLLSPKQKTGPALPLP HFLLI in isoform 2. 1 PublicationAdd BLAST334

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF083552 mRNA Translation: AAC34668.1
AB010887 mRNA Translation: BAA28146.1
AF104943 mRNA Translation: AAD04170.1
AF085690 mRNA Translation: AAD02845.1
AF085691 mRNA Translation: AAD02846.1
AF085692 mRNA Translation: AAD02847.1
Y17151 mRNA Translation: CAA76658.2
AF009670 mRNA Translation: AAD01430.1 Frameshift.
AF154001 mRNA Translation: AAD38185.1 Sequence problems.
AC004590 Genomic DNA No translation available.
AC005921 Genomic DNA No translation available.
CH471109 Genomic DNA Translation: EAW94592.1
CH471109 Genomic DNA Translation: EAW94590.1
CH471109 Genomic DNA Translation: EAW94593.1
BC046126 mRNA Translation: AAH46126.1
BC137347 mRNA Translation: AAI37348.1
BC137348 mRNA Translation: AAI37349.1
U83659 mRNA Translation: AAB71756.1 Frameshift.
CCDSiCCDS32681.1 [O15438-1]
CCDS45739.1 [O15438-5]
PIRiJE0336
RefSeqiNP_001137542.1, NM_001144070.1 [O15438-5]
NP_003777.2, NM_003786.3 [O15438-1]
UniGeneiHs.463421

Genome annotation databases

EnsembliENST00000285238; ENSP00000285238; ENSG00000108846 [O15438-1]
ENST00000427699; ENSP00000395160; ENSG00000108846 [O15438-5]
ENST00000502426; ENSP00000427073; ENSG00000108846 [O15438-3]
ENST00000505699; ENSP00000427521; ENSG00000108846 [O15438-2]
GeneIDi8714
KEGGihsa:8714
UCSCiuc002isk.5 human [O15438-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiMRP3_HUMAN
AccessioniPrimary (citable) accession number: O15438
Secondary accession number(s): B2RPA9
, D3DTX9, O60265, O60922, O75621, O95078, O95289, O95290, Q86X85, Q9UN52
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: May 30, 2000
Last modified: March 28, 2018
This is version 172 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health