Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O15394

- NCAM2_HUMAN

UniProt

O15394 - NCAM2_HUMAN

Protein

Neural cell adhesion molecule 2

Gene

NCAM2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 138 (01 Oct 2014)
      Sequence version 2 (22 Jul 2008)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May play important roles in selective fasciculation and zone-to-zone projection of the primary olfactory axons.

    GO - Biological processi

    1. axonal fasciculation Source: Ensembl
    2. neuron cell-cell adhesion Source: ProtInc
    3. sensory perception of smell Source: Ensembl

    Keywords - Biological processi

    Cell adhesion

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Neural cell adhesion molecule 2
    Short name:
    N-CAM-2
    Short name:
    NCAM-2
    Gene namesi
    Name:NCAM2
    Synonyms:NCAM21
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 21

    Organism-specific databases

    HGNCiHGNC:7657. NCAM2.

    Subcellular locationi

    GO - Cellular componenti

    1. axon Source: Ensembl
    2. integral component of membrane Source: ProtInc
    3. plasma membrane Source: ProtInc

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA31460.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 1919Sequence AnalysisAdd
    BLAST
    Chaini20 – 837818Neural cell adhesion molecule 2PRO_0000015018Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi42 ↔ 93Curated
    Disulfide bondi136 ↔ 186Curated
    Glycosylationi177 – 1771N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi219 – 2191N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi232 ↔ 281Curated
    Glycosylationi309 – 3091N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi322 ↔ 380Curated
    Glycosylationi406 – 4061N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi419 – 4191N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi422 ↔ 475Curated
    Glycosylationi445 – 4451N-linked (GlcNAc...)1 Publication
    Glycosylationi474 – 4741N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi562 – 5621N-linked (GlcNAc...)1 Publication

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    MaxQBiO15394.
    PaxDbiO15394.
    PRIDEiO15394.

    PTM databases

    PhosphoSiteiO15394.

    Expressioni

    Tissue specificityi

    Expressed most strongly in adult and fetal brain.

    Gene expression databases

    ArrayExpressiO15394.
    BgeeiO15394.
    CleanExiHS_NCAM2.
    GenevestigatoriO15394.

    Organism-specific databases

    HPAiHPA030900.

    Interactioni

    Protein-protein interaction databases

    BioGridi110765. 2 interactions.
    DIPiDIP-56211N.
    IntActiO15394. 2 interactions.
    STRINGi9606.ENSP00000383392.

    Structurei

    Secondary structure

    1
    837
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi20 – 267
    Beta strandi28 – 336
    Beta strandi38 – 469
    Beta strandi49 – 546
    Beta strandi65 – 728
    Beta strandi75 – 806
    Helixi85 – 873
    Beta strandi89 – 968
    Beta strandi98 – 1003
    Beta strandi102 – 11211
    Beta strandi116 – 1194
    Beta strandi123 – 1275
    Beta strandi132 – 1343
    Beta strandi137 – 1393
    Beta strandi145 – 1506
    Beta strandi152 – 1543
    Beta strandi163 – 1653
    Beta strandi171 – 1733
    Helixi178 – 1803
    Beta strandi182 – 1909
    Turni191 – 1944
    Beta strandi195 – 20612
    Beta strandi210 – 2123
    Beta strandi217 – 2215
    Beta strandi222 – 2243
    Beta strandi228 – 2314
    Beta strandi233 – 2353
    Beta strandi241 – 2466
    Beta strandi254 – 2607
    Turni261 – 2644
    Beta strandi265 – 2684
    Helixi273 – 2753
    Beta strandi277 – 2859
    Beta strandi288 – 30720
    Beta strandi310 – 3123
    Beta strandi317 – 32812
    Beta strandi331 – 3366
    Turni337 – 3404
    Beta strandi341 – 3433
    Beta strandi350 – 3523
    Beta strandi354 – 3596
    Beta strandi362 – 3698
    Helixi372 – 3743
    Beta strandi376 – 3849
    Beta strandi387 – 39711
    Beta strandi409 – 4124
    Beta strandi418 – 4225
    Beta strandi424 – 4285
    Beta strandi431 – 4366
    Beta strandi439 – 4424
    Beta strandi449 – 4535
    Beta strandi458 – 4625
    Beta strandi469 – 47911
    Beta strandi482 – 49211
    Beta strandi500 – 5078
    Beta strandi512 – 5176
    Beta strandi527 – 53610
    Beta strandi543 – 5464
    Beta strandi548 – 5503
    Beta strandi552 – 5565
    Beta strandi564 – 57512
    Beta strandi576 – 5805
    Beta strandi584 – 5874
    Beta strandi599 – 6046
    Turni605 – 6073
    Beta strandi608 – 6136
    Beta strandi619 – 6213
    Beta strandi625 – 6317
    Beta strandi640 – 6456
    Turni646 – 6483
    Beta strandi650 – 6534
    Beta strandi661 – 67010
    Beta strandi678 – 6836

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2DOCNMR-A486-591[»]
    2JLLX-ray2.30A301-689[»]
    2KBGNMR-A592-693[»]
    2V5TX-ray2.00A115-301[»]
    2VAJX-ray2.70A21-113[»]
    2WIMX-ray3.00A/B19-301[»]
    2XY1X-ray1.90A209-398[»]
    2XY2X-ray1.77A19-207[»]
    2XYCX-ray2.65A301-591[»]
    ProteinModelPortaliO15394.
    SMRiO15394. Positions 19-693.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiO15394.

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini20 – 697678ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini719 – 837119CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei698 – 71821HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini21 – 10888Ig-like C2-type 1Add
    BLAST
    Domaini113 – 20290Ig-like C2-type 2Add
    BLAST
    Domaini208 – 29790Ig-like C2-type 3Add
    BLAST
    Domaini302 – 39695Ig-like C2-type 4Add
    BLAST
    Domaini401 – 49191Ig-like C2-type 5Add
    BLAST
    Domaini498 – 59194Fibronectin type-III 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini593 – 68896Fibronectin type-III 2PROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 2 fibronectin type-III domains.PROSITE-ProRule annotation

    Keywords - Domaini

    Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG308439.
    HOGENOMiHOG000074124.
    HOVERGENiHBG052579.
    InParanoidiO15394.
    KOiK06491.
    OMAiEPTISWY.
    OrthoDBiEOG75MVVH.
    PhylomeDBiO15394.
    TreeFamiTF326195.

    Family and domain databases

    Gene3Di2.60.40.10. 7 hits.
    InterProiIPR003961. Fibronectin_type3.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR013098. Ig_I-set.
    IPR003598. Ig_sub2.
    IPR009138. Neural_cell_adh.
    [Graphical view]
    PfamiPF00041. fn3. 2 hits.
    PF07679. I-set. 5 hits.
    [Graphical view]
    PRINTSiPR01838. NCAMFAMILY.
    SMARTiSM00060. FN3. 2 hits.
    SM00408. IGc2. 5 hits.
    [Graphical view]
    SUPFAMiSSF49265. SSF49265. 1 hit.
    PROSITEiPS50853. FN3. 2 hits.
    PS50835. IG_LIKE. 5 hits.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O15394-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSLLLSFYLL GLLVSSGQAL LQVTISLSKV ELSVGESKFF TCTAIGEPES    50
    IDWYNPQGEK IISTQRVVVQ KEGVRSRLTI YNANIEDAGI YRCQATDAKG 100
    QTQEATVVLE IYQKLTFREV VSPQEFKQGE DAEVVCRVSS SPAPAVSWLY 150
    HNEEVTTISD NRFAMLANNN LQILNINKSD EGIYRCEGRV EARGEIDFRD 200
    IIVIVNVPPA ISMPQKSFNA TAERGEEMTF SCRASGSPEP AISWFRNGKL 250
    IEENEKYILK GSNTELTVRN IINSDGGPYV CRATNKAGED EKQAFLQVFV 300
    QPHIIQLKNE TTYENGQVTL VCDAEGEPIP EITWKRAVDG FTFTEGDKSL 350
    DGRIEVKGQH GSSSLHIKDV KLSDSGRYDC EAASRIGGHQ KSMYLDIEYA 400
    PKFISNQTIY YSWEGNPINI SCDVKSNPPA SIHWRRDKLV LPAKNTTNLK 450
    TYSTGRKMIL EIAPTSDNDF GRYNCTATNH IGTRFQEYIL ALADVPSSPY 500
    GVKIIELSQT TAKVSFNKPD SHGGVPIHHY QVDVKEVASE IWKIVRSHGV 550
    QTMVVLNNLE PNTTYEIRVA AVNGKGQGDY SKIEIFQTLP VREPSPPSIH 600
    GQPSSGKSFK LSITKQDDGG APILEYIVKY RSKDKEDQWL EKKVQGNKDH 650
    IILEHLQWTM GYEVQITAAN RLGYSEPTVY EFSMPPKPNI IKDTLFNGLG 700
    LGAVIGLGVA ALLLILVVTD VSCFFIRQCG LLMCITRRMC GKKSGSSGKS 750
    KELEEGKAAY LKDGSKEPIV EMRTEDERVT NHEDGSPVNE PNETTPLTEP 800
    EKLPLKEEDG KEALNPETIE IKVSNDIIQS KEDDSKA 837
    Length:837
    Mass (Da):93,046
    Last modified:July 22, 2008 - v2
    Checksum:i878EC1110562B3F3
    GO
    Isoform 2 (identifier: O15394-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-18: MSLLLSFYLLGLLVSSGQ → MVRSDSGGQVYLDYHNRQGLFVDWKYNEALYLEEGQPETYYRT
         399-399: Y → S
         400-837: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:424
    Mass (Da):47,551
    Checksum:iD885280AE6FD66FA
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti49 – 491E → R in AAB80803. (PubMed:9226371)Curated
    Sequence conflicti72 – 721E → G in AAB80803. (PubMed:9226371)Curated
    Sequence conflicti163 – 1631F → L in AAB80803. (PubMed:9226371)Curated
    Sequence conflicti374 – 3741D → G in AAB80803. (PubMed:9226371)Curated
    Sequence conflicti662 – 6676YEVQIT → MKFRLP in AAB80803. (PubMed:9226371)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti347 – 3471D → N.
    Corresponds to variant rs35654962 [ dbSNP | Ensembl ].
    VAR_047897
    Natural varianti350 – 3501L → P.1 Publication
    Corresponds to variant rs232518 [ dbSNP | Ensembl ].
    VAR_047898

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 1818MSLLL…VSSGQ → MVRSDSGGQVYLDYHNRQGL FVDWKYNEALYLEEGQPETY YRT in isoform 2. 1 PublicationVSP_056637Add
    BLAST
    Alternative sequencei399 – 3991Y → S in isoform 2. 1 PublicationVSP_056638
    Alternative sequencei400 – 837438Missing in isoform 2. 1 PublicationVSP_056639Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U75330 mRNA. Translation: AAB80803.1.
    AK302870 mRNA. Translation: BAH13827.1.
    AP001114 Genomic DNA. No translation available.
    AP001115 Genomic DNA. No translation available.
    AP001136 Genomic DNA. No translation available.
    AP001137 Genomic DNA. No translation available.
    AP001138 Genomic DNA. No translation available.
    AP001252 Genomic DNA. No translation available.
    BC052946 mRNA. Translation: AAH52946.1.
    CCDSiCCDS42910.1.
    RefSeqiNP_004531.2. NM_004540.3.
    UniGeneiHs.473450.

    Genome annotation databases

    EnsembliENST00000400546; ENSP00000383392; ENSG00000154654.
    ENST00000535285; ENSP00000441887; ENSG00000154654.
    GeneIDi4685.
    KEGGihsa:4685.
    UCSCiuc002yld.2. human.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U75330 mRNA. Translation: AAB80803.1 .
    AK302870 mRNA. Translation: BAH13827.1 .
    AP001114 Genomic DNA. No translation available.
    AP001115 Genomic DNA. No translation available.
    AP001136 Genomic DNA. No translation available.
    AP001137 Genomic DNA. No translation available.
    AP001138 Genomic DNA. No translation available.
    AP001252 Genomic DNA. No translation available.
    BC052946 mRNA. Translation: AAH52946.1 .
    CCDSi CCDS42910.1.
    RefSeqi NP_004531.2. NM_004540.3.
    UniGenei Hs.473450.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2DOC NMR - A 486-591 [» ]
    2JLL X-ray 2.30 A 301-689 [» ]
    2KBG NMR - A 592-693 [» ]
    2V5T X-ray 2.00 A 115-301 [» ]
    2VAJ X-ray 2.70 A 21-113 [» ]
    2WIM X-ray 3.00 A/B 19-301 [» ]
    2XY1 X-ray 1.90 A 209-398 [» ]
    2XY2 X-ray 1.77 A 19-207 [» ]
    2XYC X-ray 2.65 A 301-591 [» ]
    ProteinModelPortali O15394.
    SMRi O15394. Positions 19-693.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 110765. 2 interactions.
    DIPi DIP-56211N.
    IntActi O15394. 2 interactions.
    STRINGi 9606.ENSP00000383392.

    PTM databases

    PhosphoSitei O15394.

    Proteomic databases

    MaxQBi O15394.
    PaxDbi O15394.
    PRIDEi O15394.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000400546 ; ENSP00000383392 ; ENSG00000154654 .
    ENST00000535285 ; ENSP00000441887 ; ENSG00000154654 .
    GeneIDi 4685.
    KEGGi hsa:4685.
    UCSCi uc002yld.2. human.

    Organism-specific databases

    CTDi 4685.
    GeneCardsi GC21P022370.
    H-InvDB HIX0027799.
    HGNCi HGNC:7657. NCAM2.
    HPAi HPA030900.
    MIMi 602040. gene.
    neXtProti NX_O15394.
    PharmGKBi PA31460.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG308439.
    HOGENOMi HOG000074124.
    HOVERGENi HBG052579.
    InParanoidi O15394.
    KOi K06491.
    OMAi EPTISWY.
    OrthoDBi EOG75MVVH.
    PhylomeDBi O15394.
    TreeFami TF326195.

    Miscellaneous databases

    ChiTaRSi NCAM2. human.
    EvolutionaryTracei O15394.
    GenomeRNAii 4685.
    NextBioi 18068.
    PROi O15394.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O15394.
    Bgeei O15394.
    CleanExi HS_NCAM2.
    Genevestigatori O15394.

    Family and domain databases

    Gene3Di 2.60.40.10. 7 hits.
    InterProi IPR003961. Fibronectin_type3.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR013098. Ig_I-set.
    IPR003598. Ig_sub2.
    IPR009138. Neural_cell_adh.
    [Graphical view ]
    Pfami PF00041. fn3. 2 hits.
    PF07679. I-set. 5 hits.
    [Graphical view ]
    PRINTSi PR01838. NCAMFAMILY.
    SMARTi SM00060. FN3. 2 hits.
    SM00408. IGc2. 5 hits.
    [Graphical view ]
    SUPFAMi SSF49265. SSF49265. 1 hit.
    PROSITEi PS50853. FN3. 2 hits.
    PS50835. IG_LIKE. 5 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning of a novel human neural cell adhesion molecule gene (NCAM2) that maps to chromosome region 21q21 and is potentially involved in Down syndrome."
      Paoloni-Giacobino A., Chen H., Antonarakis S.E.
      Genomics 43:43-51(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT PRO-350.
      Tissue: Brain.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Testis.
    3. "The DNA sequence of human chromosome 21."
      Hattori M., Fujiyama A., Taylor T.D., Watanabe H., Yada T., Park H.-S., Toyoda A., Ishii K., Totoki Y., Choi D.-K., Groner Y., Soeda E., Ohki M., Takagi T., Sakaki Y., Taudien S., Blechschmidt K., Polley A.
      , Menzel U., Delabar J., Kumpf K., Lehmann R., Patterson D., Reichwald K., Rump A., Schillhabel M., Schudy A., Zimmermann W., Rosenthal A., Kudoh J., Shibuya K., Kawasaki K., Asakawa S., Shintani A., Sasaki T., Nagamine K., Mitsuyama S., Antonarakis S.E., Minoshima S., Shimizu N., Nordsiek G., Hornischer K., Brandt P., Scharfe M., Schoen O., Desario A., Reichelt J., Kauer G., Bloecker H., Ramser J., Beck A., Klages S., Hennig S., Riesselmann L., Dagand E., Wehrmeyer S., Borzym K., Gardiner K., Nizetic D., Francis F., Lehrach H., Reinhardt R., Yaspo M.-L.
      Nature 405:311-319(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    5. "Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry."
      Zhang H., Li X.-J., Martin D.B., Aebersold R.
      Nat. Biotechnol. 21:660-666(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION AT ASN-445 AND ASN-562.
    6. "Solution structure of the fibronectin type-III domain of human neural cell adhesion molecule 2."
      RIKEN structural genomics initiative (RSGI)
      Submitted (OCT-2006) to the PDB data bank
      Cited for: STRUCTURE BY NMR OF 486-591.

    Entry informationi

    Entry nameiNCAM2_HUMAN
    AccessioniPrimary (citable) accession number: O15394
    Secondary accession number(s): A8MQ06, B7Z841, Q7Z7F2
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 15, 1998
    Last sequence update: July 22, 2008
    Last modified: October 1, 2014
    This is version 138 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 21
      Human chromosome 21: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3