Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O15394

- NCAM2_HUMAN

UniProt

O15394 - NCAM2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Neural cell adhesion molecule 2

Gene

NCAM2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

May play important roles in selective fasciculation and zone-to-zone projection of the primary olfactory axons.

GO - Biological processi

  1. axonal fasciculation Source: Ensembl
  2. neuron cell-cell adhesion Source: ProtInc
  3. sensory perception of smell Source: Ensembl
Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Names & Taxonomyi

Protein namesi
Recommended name:
Neural cell adhesion molecule 2
Short name:
N-CAM-2
Short name:
NCAM-2
Gene namesi
Name:NCAM2
Synonyms:NCAM21
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 21

Organism-specific databases

HGNCiHGNC:7657. NCAM2.

Subcellular locationi

GO - Cellular componenti

  1. axon Source: Ensembl
  2. integral component of membrane Source: ProtInc
  3. plasma membrane Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA31460.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1919Sequence AnalysisAdd
BLAST
Chaini20 – 837818Neural cell adhesion molecule 2PRO_0000015018Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi42 ↔ 93Curated
Disulfide bondi136 ↔ 186Curated
Glycosylationi177 – 1771N-linked (GlcNAc...)Sequence Analysis
Glycosylationi219 – 2191N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi232 ↔ 281Curated
Glycosylationi309 – 3091N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi322 ↔ 380Curated
Glycosylationi406 – 4061N-linked (GlcNAc...)Sequence Analysis
Glycosylationi419 – 4191N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi422 ↔ 475Curated
Glycosylationi445 – 4451N-linked (GlcNAc...)1 Publication
Glycosylationi474 – 4741N-linked (GlcNAc...)Sequence Analysis
Glycosylationi562 – 5621N-linked (GlcNAc...)1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQBiO15394.
PaxDbiO15394.
PRIDEiO15394.

PTM databases

PhosphoSiteiO15394.

Expressioni

Tissue specificityi

Expressed most strongly in adult and fetal brain.

Gene expression databases

BgeeiO15394.
CleanExiHS_NCAM2.
ExpressionAtlasiO15394. baseline and differential.
GenevestigatoriO15394.

Organism-specific databases

HPAiHPA030900.

Interactioni

Protein-protein interaction databases

BioGridi110765. 2 interactions.
DIPiDIP-56211N.
IntActiO15394. 2 interactions.
STRINGi9606.ENSP00000383392.

Structurei

Secondary structure

1
837
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi20 – 267Combined sources
Beta strandi28 – 336Combined sources
Beta strandi38 – 469Combined sources
Beta strandi49 – 546Combined sources
Beta strandi65 – 728Combined sources
Beta strandi75 – 806Combined sources
Helixi85 – 873Combined sources
Beta strandi89 – 968Combined sources
Beta strandi98 – 1003Combined sources
Beta strandi102 – 11211Combined sources
Beta strandi116 – 1194Combined sources
Beta strandi123 – 1275Combined sources
Beta strandi132 – 1343Combined sources
Beta strandi137 – 1393Combined sources
Beta strandi145 – 1506Combined sources
Beta strandi152 – 1543Combined sources
Beta strandi163 – 1653Combined sources
Beta strandi171 – 1733Combined sources
Helixi178 – 1803Combined sources
Beta strandi182 – 1909Combined sources
Turni191 – 1944Combined sources
Beta strandi195 – 20612Combined sources
Beta strandi210 – 2123Combined sources
Beta strandi217 – 2215Combined sources
Beta strandi222 – 2243Combined sources
Beta strandi228 – 2314Combined sources
Beta strandi233 – 2353Combined sources
Beta strandi241 – 2466Combined sources
Beta strandi254 – 2607Combined sources
Turni261 – 2644Combined sources
Beta strandi265 – 2684Combined sources
Helixi273 – 2753Combined sources
Beta strandi277 – 2859Combined sources
Beta strandi288 – 30720Combined sources
Beta strandi310 – 3123Combined sources
Beta strandi317 – 32812Combined sources
Beta strandi331 – 3366Combined sources
Turni337 – 3404Combined sources
Beta strandi341 – 3433Combined sources
Beta strandi350 – 3523Combined sources
Beta strandi354 – 3596Combined sources
Beta strandi362 – 3698Combined sources
Helixi372 – 3743Combined sources
Beta strandi376 – 3849Combined sources
Beta strandi387 – 39711Combined sources
Beta strandi409 – 4124Combined sources
Beta strandi418 – 4225Combined sources
Beta strandi424 – 4285Combined sources
Beta strandi431 – 4366Combined sources
Beta strandi439 – 4424Combined sources
Beta strandi449 – 4535Combined sources
Beta strandi458 – 4625Combined sources
Beta strandi469 – 47911Combined sources
Beta strandi482 – 49211Combined sources
Beta strandi500 – 5078Combined sources
Beta strandi512 – 5176Combined sources
Beta strandi527 – 53610Combined sources
Beta strandi543 – 5464Combined sources
Beta strandi548 – 5503Combined sources
Beta strandi552 – 5565Combined sources
Beta strandi564 – 57512Combined sources
Beta strandi576 – 5805Combined sources
Beta strandi584 – 5874Combined sources
Beta strandi599 – 6046Combined sources
Turni605 – 6073Combined sources
Beta strandi608 – 6136Combined sources
Beta strandi619 – 6213Combined sources
Beta strandi625 – 6317Combined sources
Beta strandi640 – 6456Combined sources
Turni646 – 6483Combined sources
Beta strandi650 – 6534Combined sources
Beta strandi661 – 67010Combined sources
Beta strandi678 – 6836Combined sources

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2DOCNMR-A486-591[»]
2JLLX-ray2.30A301-689[»]
2KBGNMR-A592-693[»]
2V5TX-ray2.00A115-301[»]
2VAJX-ray2.70A21-113[»]
2WIMX-ray3.00A/B19-301[»]
2XY1X-ray1.90A209-398[»]
2XY2X-ray1.77A19-207[»]
2XYCX-ray2.65A301-591[»]
ProteinModelPortaliO15394.
SMRiO15394. Positions 19-693.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO15394.

Topological domain

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini20 – 697678ExtracellularSequence AnalysisAdd
BLAST
Topological domaini719 – 837119CytoplasmicSequence AnalysisAdd
BLAST

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei698 – 71821HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini21 – 10888Ig-like C2-type 1Add
BLAST
Domaini113 – 20290Ig-like C2-type 2Add
BLAST
Domaini208 – 29790Ig-like C2-type 3Add
BLAST
Domaini302 – 39695Ig-like C2-type 4Add
BLAST
Domaini401 – 49191Ig-like C2-type 5Add
BLAST
Domaini498 – 59194Fibronectin type-III 1PROSITE-ProRule annotationAdd
BLAST
Domaini593 – 68896Fibronectin type-III 2PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 2 fibronectin type-III domains.PROSITE-ProRule annotation

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG308439.
GeneTreeiENSGT00750000117404.
HOGENOMiHOG000074124.
HOVERGENiHBG052579.
InParanoidiO15394.
KOiK06491.
OMAiEPTISWY.
OrthoDBiEOG75MVVH.
PhylomeDBiO15394.
TreeFamiTF326195.

Family and domain databases

Gene3Di2.60.40.10. 4 hits.
InterProiIPR003961. Fibronectin_type3.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003598. Ig_sub2.
IPR009138. Neural_cell_adh.
[Graphical view]
PfamiPF00041. fn3. 2 hits.
PF07679. I-set. 5 hits.
[Graphical view]
PRINTSiPR01838. NCAMFAMILY.
SMARTiSM00060. FN3. 2 hits.
SM00408. IGc2. 5 hits.
[Graphical view]
SUPFAMiSSF49265. SSF49265. 1 hit.
PROSITEiPS50853. FN3. 2 hits.
PS50835. IG_LIKE. 5 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O15394-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSLLLSFYLL GLLVSSGQAL LQVTISLSKV ELSVGESKFF TCTAIGEPES
60 70 80 90 100
IDWYNPQGEK IISTQRVVVQ KEGVRSRLTI YNANIEDAGI YRCQATDAKG
110 120 130 140 150
QTQEATVVLE IYQKLTFREV VSPQEFKQGE DAEVVCRVSS SPAPAVSWLY
160 170 180 190 200
HNEEVTTISD NRFAMLANNN LQILNINKSD EGIYRCEGRV EARGEIDFRD
210 220 230 240 250
IIVIVNVPPA ISMPQKSFNA TAERGEEMTF SCRASGSPEP AISWFRNGKL
260 270 280 290 300
IEENEKYILK GSNTELTVRN IINSDGGPYV CRATNKAGED EKQAFLQVFV
310 320 330 340 350
QPHIIQLKNE TTYENGQVTL VCDAEGEPIP EITWKRAVDG FTFTEGDKSL
360 370 380 390 400
DGRIEVKGQH GSSSLHIKDV KLSDSGRYDC EAASRIGGHQ KSMYLDIEYA
410 420 430 440 450
PKFISNQTIY YSWEGNPINI SCDVKSNPPA SIHWRRDKLV LPAKNTTNLK
460 470 480 490 500
TYSTGRKMIL EIAPTSDNDF GRYNCTATNH IGTRFQEYIL ALADVPSSPY
510 520 530 540 550
GVKIIELSQT TAKVSFNKPD SHGGVPIHHY QVDVKEVASE IWKIVRSHGV
560 570 580 590 600
QTMVVLNNLE PNTTYEIRVA AVNGKGQGDY SKIEIFQTLP VREPSPPSIH
610 620 630 640 650
GQPSSGKSFK LSITKQDDGG APILEYIVKY RSKDKEDQWL EKKVQGNKDH
660 670 680 690 700
IILEHLQWTM GYEVQITAAN RLGYSEPTVY EFSMPPKPNI IKDTLFNGLG
710 720 730 740 750
LGAVIGLGVA ALLLILVVTD VSCFFIRQCG LLMCITRRMC GKKSGSSGKS
760 770 780 790 800
KELEEGKAAY LKDGSKEPIV EMRTEDERVT NHEDGSPVNE PNETTPLTEP
810 820 830
EKLPLKEEDG KEALNPETIE IKVSNDIIQS KEDDSKA
Length:837
Mass (Da):93,046
Last modified:July 22, 2008 - v2
Checksum:i878EC1110562B3F3
GO
Isoform 2 (identifier: O15394-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-18: MSLLLSFYLLGLLVSSGQ → MVRSDSGGQVYLDYHNRQGLFVDWKYNEALYLEEGQPETYYRT
     399-399: Y → S
     400-837: Missing.

Note: No experimental confirmation available.

Show »
Length:424
Mass (Da):47,551
Checksum:iD885280AE6FD66FA
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti49 – 491E → R in AAB80803. (PubMed:9226371)Curated
Sequence conflicti72 – 721E → G in AAB80803. (PubMed:9226371)Curated
Sequence conflicti163 – 1631F → L in AAB80803. (PubMed:9226371)Curated
Sequence conflicti374 – 3741D → G in AAB80803. (PubMed:9226371)Curated
Sequence conflicti662 – 6676YEVQIT → MKFRLP in AAB80803. (PubMed:9226371)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti347 – 3471D → N.
Corresponds to variant rs35654962 [ dbSNP | Ensembl ].
VAR_047897
Natural varianti350 – 3501L → P.1 Publication
Corresponds to variant rs232518 [ dbSNP | Ensembl ].
VAR_047898

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 1818MSLLL…VSSGQ → MVRSDSGGQVYLDYHNRQGL FVDWKYNEALYLEEGQPETY YRT in isoform 2. 1 PublicationVSP_056637Add
BLAST
Alternative sequencei399 – 3991Y → S in isoform 2. 1 PublicationVSP_056638
Alternative sequencei400 – 837438Missing in isoform 2. 1 PublicationVSP_056639Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U75330 mRNA. Translation: AAB80803.1.
AK302870 mRNA. Translation: BAH13827.1.
AP001114 Genomic DNA. No translation available.
AP001115 Genomic DNA. No translation available.
AP001136 Genomic DNA. No translation available.
AP001137 Genomic DNA. No translation available.
AP001138 Genomic DNA. No translation available.
AP001252 Genomic DNA. No translation available.
BC052946 mRNA. Translation: AAH52946.1.
CCDSiCCDS42910.1. [O15394-1]
RefSeqiNP_004531.2. NM_004540.3.
UniGeneiHs.473450.

Genome annotation databases

EnsembliENST00000400546; ENSP00000383392; ENSG00000154654. [O15394-1]
GeneIDi4685.
KEGGihsa:4685.
UCSCiuc002yld.2. human. [O15394-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U75330 mRNA. Translation: AAB80803.1 .
AK302870 mRNA. Translation: BAH13827.1 .
AP001114 Genomic DNA. No translation available.
AP001115 Genomic DNA. No translation available.
AP001136 Genomic DNA. No translation available.
AP001137 Genomic DNA. No translation available.
AP001138 Genomic DNA. No translation available.
AP001252 Genomic DNA. No translation available.
BC052946 mRNA. Translation: AAH52946.1 .
CCDSi CCDS42910.1. [O15394-1 ]
RefSeqi NP_004531.2. NM_004540.3.
UniGenei Hs.473450.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2DOC NMR - A 486-591 [» ]
2JLL X-ray 2.30 A 301-689 [» ]
2KBG NMR - A 592-693 [» ]
2V5T X-ray 2.00 A 115-301 [» ]
2VAJ X-ray 2.70 A 21-113 [» ]
2WIM X-ray 3.00 A/B 19-301 [» ]
2XY1 X-ray 1.90 A 209-398 [» ]
2XY2 X-ray 1.77 A 19-207 [» ]
2XYC X-ray 2.65 A 301-591 [» ]
ProteinModelPortali O15394.
SMRi O15394. Positions 19-693.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 110765. 2 interactions.
DIPi DIP-56211N.
IntActi O15394. 2 interactions.
STRINGi 9606.ENSP00000383392.

PTM databases

PhosphoSitei O15394.

Proteomic databases

MaxQBi O15394.
PaxDbi O15394.
PRIDEi O15394.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000400546 ; ENSP00000383392 ; ENSG00000154654 . [O15394-1 ]
GeneIDi 4685.
KEGGi hsa:4685.
UCSCi uc002yld.2. human. [O15394-1 ]

Organism-specific databases

CTDi 4685.
GeneCardsi GC21P022370.
H-InvDB HIX0027799.
HGNCi HGNC:7657. NCAM2.
HPAi HPA030900.
MIMi 602040. gene.
neXtProti NX_O15394.
PharmGKBi PA31460.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG308439.
GeneTreei ENSGT00750000117404.
HOGENOMi HOG000074124.
HOVERGENi HBG052579.
InParanoidi O15394.
KOi K06491.
OMAi EPTISWY.
OrthoDBi EOG75MVVH.
PhylomeDBi O15394.
TreeFami TF326195.

Miscellaneous databases

ChiTaRSi NCAM2. human.
EvolutionaryTracei O15394.
GenomeRNAii 4685.
NextBioi 18068.
PROi O15394.
SOURCEi Search...

Gene expression databases

Bgeei O15394.
CleanExi HS_NCAM2.
ExpressionAtlasi O15394. baseline and differential.
Genevestigatori O15394.

Family and domain databases

Gene3Di 2.60.40.10. 4 hits.
InterProi IPR003961. Fibronectin_type3.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003598. Ig_sub2.
IPR009138. Neural_cell_adh.
[Graphical view ]
Pfami PF00041. fn3. 2 hits.
PF07679. I-set. 5 hits.
[Graphical view ]
PRINTSi PR01838. NCAMFAMILY.
SMARTi SM00060. FN3. 2 hits.
SM00408. IGc2. 5 hits.
[Graphical view ]
SUPFAMi SSF49265. SSF49265. 1 hit.
PROSITEi PS50853. FN3. 2 hits.
PS50835. IG_LIKE. 5 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning of a novel human neural cell adhesion molecule gene (NCAM2) that maps to chromosome region 21q21 and is potentially involved in Down syndrome."
    Paoloni-Giacobino A., Chen H., Antonarakis S.E.
    Genomics 43:43-51(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT PRO-350.
    Tissue: Brain.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Testis.
  3. "The DNA sequence of human chromosome 21."
    Hattori M., Fujiyama A., Taylor T.D., Watanabe H., Yada T., Park H.-S., Toyoda A., Ishii K., Totoki Y., Choi D.-K., Groner Y., Soeda E., Ohki M., Takagi T., Sakaki Y., Taudien S., Blechschmidt K., Polley A.
    , Menzel U., Delabar J., Kumpf K., Lehmann R., Patterson D., Reichwald K., Rump A., Schillhabel M., Schudy A., Zimmermann W., Rosenthal A., Kudoh J., Shibuya K., Kawasaki K., Asakawa S., Shintani A., Sasaki T., Nagamine K., Mitsuyama S., Antonarakis S.E., Minoshima S., Shimizu N., Nordsiek G., Hornischer K., Brandt P., Scharfe M., Schoen O., Desario A., Reichelt J., Kauer G., Bloecker H., Ramser J., Beck A., Klages S., Hennig S., Riesselmann L., Dagand E., Wehrmeyer S., Borzym K., Gardiner K., Nizetic D., Francis F., Lehrach H., Reinhardt R., Yaspo M.-L.
    Nature 405:311-319(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  5. "Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry."
    Zhang H., Li X.-J., Martin D.B., Aebersold R.
    Nat. Biotechnol. 21:660-666(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION AT ASN-445 AND ASN-562.
  6. "Solution structure of the fibronectin type-III domain of human neural cell adhesion molecule 2."
    RIKEN structural genomics initiative (RSGI)
    Submitted (OCT-2006) to the PDB data bank
    Cited for: STRUCTURE BY NMR OF 486-591.

Entry informationi

Entry nameiNCAM2_HUMAN
AccessioniPrimary (citable) accession number: O15394
Secondary accession number(s): A8MQ06, B7Z841, Q7Z7F2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: July 22, 2008
Last modified: October 29, 2014
This is version 139 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 21
    Human chromosome 21: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3