Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Neural cell adhesion molecule 2

Gene

NCAM2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May play important roles in selective fasciculation and zone-to-zone projection of the primary olfactory axons.

GO - Biological processi

  • axonal fasciculation Source: Ensembl
  • neuron cell-cell adhesion Source: ProtInc
  • sensory perception of smell Source: Ensembl
Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Enzyme and pathway databases

BioCyciZFISH:ENSG00000154654-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Neural cell adhesion molecule 2
Short name:
N-CAM-2
Short name:
NCAM-2
Gene namesi
Name:NCAM2
Synonyms:NCAM21
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 21

Organism-specific databases

HGNCiHGNC:7657. NCAM2.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini20 – 697ExtracellularSequence analysisAdd BLAST678
Transmembranei698 – 718HelicalSequence analysisAdd BLAST21
Topological domaini719 – 837CytoplasmicSequence analysisAdd BLAST119

GO - Cellular componenti

  • axon Source: Ensembl
  • integral component of membrane Source: ProtInc
  • plasma membrane Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi4685.
OpenTargetsiENSG00000154654.
PharmGKBiPA31460.

Polymorphism and mutation databases

BioMutaiNCAM2.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 19Sequence analysisAdd BLAST19
ChainiPRO_000001501820 – 837Neural cell adhesion molecule 2Add BLAST818

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi42 ↔ 93Curated
Disulfide bondi136 ↔ 186Curated
Glycosylationi177N-linked (GlcNAc...)Sequence analysis1
Glycosylationi219N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi232 ↔ 281Curated
Glycosylationi309N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi322 ↔ 380Curated
Glycosylationi406N-linked (GlcNAc...)Sequence analysis1
Glycosylationi419N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi422 ↔ 475Curated
Glycosylationi445N-linked (GlcNAc...)1 Publication1
Glycosylationi474N-linked (GlcNAc...)Sequence analysis1
Glycosylationi562N-linked (GlcNAc...)1 Publication1
Modified residuei765PhosphoserineBy similarity1
Modified residuei780PhosphothreonineBy similarity1
Modified residuei786PhosphoserineBy similarity1

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiO15394.
PaxDbiO15394.
PeptideAtlasiO15394.
PRIDEiO15394.

PTM databases

iPTMnetiO15394.
PhosphoSitePlusiO15394.
SwissPalmiO15394.

Expressioni

Tissue specificityi

Expressed most strongly in adult and fetal brain.

Gene expression databases

BgeeiENSG00000154654.
CleanExiHS_NCAM2.
ExpressionAtlasiO15394. baseline and differential.
GenevisibleiO15394. HS.

Organism-specific databases

HPAiHPA030900.

Interactioni

Protein-protein interaction databases

BioGridi110765. 1 interactor.
DIPiDIP-56211N.
IntActiO15394. 2 interactors.
STRINGi9606.ENSP00000383392.

Structurei

Secondary structure

1837
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi20 – 26Combined sources7
Beta strandi28 – 33Combined sources6
Beta strandi38 – 46Combined sources9
Beta strandi49 – 54Combined sources6
Beta strandi65 – 72Combined sources8
Beta strandi75 – 80Combined sources6
Helixi85 – 87Combined sources3
Beta strandi89 – 96Combined sources8
Beta strandi98 – 100Combined sources3
Beta strandi102 – 112Combined sources11
Beta strandi116 – 119Combined sources4
Beta strandi123 – 127Combined sources5
Beta strandi132 – 134Combined sources3
Beta strandi137 – 139Combined sources3
Beta strandi145 – 150Combined sources6
Beta strandi152 – 154Combined sources3
Beta strandi163 – 165Combined sources3
Beta strandi171 – 173Combined sources3
Helixi178 – 180Combined sources3
Beta strandi182 – 190Combined sources9
Turni191 – 194Combined sources4
Beta strandi195 – 206Combined sources12
Beta strandi210 – 212Combined sources3
Beta strandi217 – 221Combined sources5
Beta strandi222 – 224Combined sources3
Beta strandi228 – 231Combined sources4
Beta strandi233 – 235Combined sources3
Beta strandi241 – 246Combined sources6
Beta strandi254 – 260Combined sources7
Turni261 – 264Combined sources4
Beta strandi265 – 268Combined sources4
Helixi273 – 275Combined sources3
Beta strandi277 – 285Combined sources9
Beta strandi288 – 307Combined sources20
Beta strandi310 – 312Combined sources3
Beta strandi317 – 328Combined sources12
Beta strandi331 – 336Combined sources6
Turni337 – 340Combined sources4
Beta strandi341 – 343Combined sources3
Beta strandi350 – 352Combined sources3
Beta strandi354 – 359Combined sources6
Beta strandi362 – 369Combined sources8
Helixi372 – 374Combined sources3
Beta strandi376 – 384Combined sources9
Beta strandi387 – 397Combined sources11
Beta strandi409 – 412Combined sources4
Beta strandi418 – 422Combined sources5
Beta strandi424 – 428Combined sources5
Beta strandi431 – 436Combined sources6
Beta strandi439 – 442Combined sources4
Beta strandi449 – 453Combined sources5
Beta strandi458 – 462Combined sources5
Beta strandi469 – 479Combined sources11
Beta strandi482 – 492Combined sources11
Beta strandi500 – 507Combined sources8
Beta strandi512 – 517Combined sources6
Beta strandi527 – 536Combined sources10
Beta strandi543 – 546Combined sources4
Beta strandi548 – 550Combined sources3
Beta strandi552 – 556Combined sources5
Beta strandi564 – 575Combined sources12
Beta strandi576 – 580Combined sources5
Beta strandi584 – 587Combined sources4
Beta strandi599 – 604Combined sources6
Turni605 – 607Combined sources3
Beta strandi608 – 613Combined sources6
Beta strandi619 – 621Combined sources3
Beta strandi625 – 631Combined sources7
Beta strandi640 – 645Combined sources6
Turni646 – 648Combined sources3
Beta strandi650 – 653Combined sources4
Beta strandi661 – 670Combined sources10
Beta strandi678 – 683Combined sources6

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2DOCNMR-A486-591[»]
2JLLX-ray2.30A301-689[»]
2KBGNMR-A592-693[»]
2V5TX-ray2.00A115-301[»]
2VAJX-ray2.70A21-113[»]
2WIMX-ray3.00A/B19-301[»]
2XY1X-ray1.90A209-398[»]
2XY2X-ray1.77A19-207[»]
2XYCX-ray2.65A301-591[»]
ProteinModelPortaliO15394.
SMRiO15394.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO15394.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini21 – 108Ig-like C2-type 1Add BLAST88
Domaini113 – 202Ig-like C2-type 2Add BLAST90
Domaini208 – 297Ig-like C2-type 3Add BLAST90
Domaini302 – 396Ig-like C2-type 4Add BLAST95
Domaini401 – 491Ig-like C2-type 5Add BLAST91
Domaini498 – 591Fibronectin type-III 1PROSITE-ProRule annotationAdd BLAST94
Domaini593 – 688Fibronectin type-III 2PROSITE-ProRule annotationAdd BLAST96

Sequence similaritiesi

Contains 2 fibronectin type-III domains.PROSITE-ProRule annotation

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IQJD. Eukaryota.
ENOG41118FG. LUCA.
GeneTreeiENSGT00860000133697.
HOGENOMiHOG000074124.
HOVERGENiHBG052579.
InParanoidiO15394.
KOiK06491.
OMAiNISCDVM.
OrthoDBiEOG091G00V0.
PhylomeDBiO15394.
TreeFamiTF326195.

Family and domain databases

CDDicd00063. FN3. 2 hits.
Gene3Di2.60.40.10. 7 hits.
InterProiIPR003961. FN3_dom.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR013106. Ig_V-set.
IPR009138. Neural_cell_adh.
[Graphical view]
PfamiPF00041. fn3. 2 hits.
PF07679. I-set. 4 hits.
[Graphical view]
PRINTSiPR01838. NCAMFAMILY.
SMARTiSM00060. FN3. 2 hits.
SM00409. IG. 5 hits.
SM00408. IGc2. 5 hits.
SM00406. IGv. 3 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 5 hits.
SSF49265. SSF49265. 1 hit.
PROSITEiPS50853. FN3. 2 hits.
PS50835. IG_LIKE. 5 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O15394-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSLLLSFYLL GLLVSSGQAL LQVTISLSKV ELSVGESKFF TCTAIGEPES
60 70 80 90 100
IDWYNPQGEK IISTQRVVVQ KEGVRSRLTI YNANIEDAGI YRCQATDAKG
110 120 130 140 150
QTQEATVVLE IYQKLTFREV VSPQEFKQGE DAEVVCRVSS SPAPAVSWLY
160 170 180 190 200
HNEEVTTISD NRFAMLANNN LQILNINKSD EGIYRCEGRV EARGEIDFRD
210 220 230 240 250
IIVIVNVPPA ISMPQKSFNA TAERGEEMTF SCRASGSPEP AISWFRNGKL
260 270 280 290 300
IEENEKYILK GSNTELTVRN IINSDGGPYV CRATNKAGED EKQAFLQVFV
310 320 330 340 350
QPHIIQLKNE TTYENGQVTL VCDAEGEPIP EITWKRAVDG FTFTEGDKSL
360 370 380 390 400
DGRIEVKGQH GSSSLHIKDV KLSDSGRYDC EAASRIGGHQ KSMYLDIEYA
410 420 430 440 450
PKFISNQTIY YSWEGNPINI SCDVKSNPPA SIHWRRDKLV LPAKNTTNLK
460 470 480 490 500
TYSTGRKMIL EIAPTSDNDF GRYNCTATNH IGTRFQEYIL ALADVPSSPY
510 520 530 540 550
GVKIIELSQT TAKVSFNKPD SHGGVPIHHY QVDVKEVASE IWKIVRSHGV
560 570 580 590 600
QTMVVLNNLE PNTTYEIRVA AVNGKGQGDY SKIEIFQTLP VREPSPPSIH
610 620 630 640 650
GQPSSGKSFK LSITKQDDGG APILEYIVKY RSKDKEDQWL EKKVQGNKDH
660 670 680 690 700
IILEHLQWTM GYEVQITAAN RLGYSEPTVY EFSMPPKPNI IKDTLFNGLG
710 720 730 740 750
LGAVIGLGVA ALLLILVVTD VSCFFIRQCG LLMCITRRMC GKKSGSSGKS
760 770 780 790 800
KELEEGKAAY LKDGSKEPIV EMRTEDERVT NHEDGSPVNE PNETTPLTEP
810 820 830
EKLPLKEEDG KEALNPETIE IKVSNDIIQS KEDDSKA
Length:837
Mass (Da):93,046
Last modified:July 22, 2008 - v2
Checksum:i878EC1110562B3F3
GO
Isoform 2 (identifier: O15394-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-18: MSLLLSFYLLGLLVSSGQ → MVRSDSGGQVYLDYHNRQGLFVDWKYNEALYLEEGQPETYYRT
     399-399: Y → S
     400-837: Missing.

Note: No experimental confirmation available.
Show »
Length:424
Mass (Da):47,551
Checksum:iD885280AE6FD66FA
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti49E → R in AAB80803 (PubMed:9226371).Curated1
Sequence conflicti72E → G in AAB80803 (PubMed:9226371).Curated1
Sequence conflicti163F → L in AAB80803 (PubMed:9226371).Curated1
Sequence conflicti374D → G in AAB80803 (PubMed:9226371).Curated1
Sequence conflicti662 – 667YEVQIT → MKFRLP in AAB80803 (PubMed:9226371).Curated6

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_047897347D → N.Corresponds to variant rs35654962dbSNPEnsembl.1
Natural variantiVAR_047898350L → P.1 PublicationCorresponds to variant rs232518dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0566371 – 18MSLLL…VSSGQ → MVRSDSGGQVYLDYHNRQGL FVDWKYNEALYLEEGQPETY YRT in isoform 2. 1 PublicationAdd BLAST18
Alternative sequenceiVSP_056638399Y → S in isoform 2. 1 Publication1
Alternative sequenceiVSP_056639400 – 837Missing in isoform 2. 1 PublicationAdd BLAST438

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U75330 mRNA. Translation: AAB80803.1.
AK302870 mRNA. Translation: BAH13827.1.
AP001114 Genomic DNA. No translation available.
AP001115 Genomic DNA. No translation available.
AP001136 Genomic DNA. No translation available.
AP001137 Genomic DNA. No translation available.
AP001138 Genomic DNA. No translation available.
AP001252 Genomic DNA. No translation available.
BC052946 mRNA. Translation: AAH52946.1.
CCDSiCCDS42910.1. [O15394-1]
RefSeqiNP_004531.2. NM_004540.3. [O15394-1]
XP_016883847.1. XM_017028358.1. [O15394-2]
UniGeneiHs.473450.

Genome annotation databases

EnsembliENST00000400546; ENSP00000383392; ENSG00000154654. [O15394-1]
GeneIDi4685.
KEGGihsa:4685.
UCSCiuc002yld.3. human. [O15394-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U75330 mRNA. Translation: AAB80803.1.
AK302870 mRNA. Translation: BAH13827.1.
AP001114 Genomic DNA. No translation available.
AP001115 Genomic DNA. No translation available.
AP001136 Genomic DNA. No translation available.
AP001137 Genomic DNA. No translation available.
AP001138 Genomic DNA. No translation available.
AP001252 Genomic DNA. No translation available.
BC052946 mRNA. Translation: AAH52946.1.
CCDSiCCDS42910.1. [O15394-1]
RefSeqiNP_004531.2. NM_004540.3. [O15394-1]
XP_016883847.1. XM_017028358.1. [O15394-2]
UniGeneiHs.473450.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2DOCNMR-A486-591[»]
2JLLX-ray2.30A301-689[»]
2KBGNMR-A592-693[»]
2V5TX-ray2.00A115-301[»]
2VAJX-ray2.70A21-113[»]
2WIMX-ray3.00A/B19-301[»]
2XY1X-ray1.90A209-398[»]
2XY2X-ray1.77A19-207[»]
2XYCX-ray2.65A301-591[»]
ProteinModelPortaliO15394.
SMRiO15394.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110765. 1 interactor.
DIPiDIP-56211N.
IntActiO15394. 2 interactors.
STRINGi9606.ENSP00000383392.

PTM databases

iPTMnetiO15394.
PhosphoSitePlusiO15394.
SwissPalmiO15394.

Polymorphism and mutation databases

BioMutaiNCAM2.

Proteomic databases

MaxQBiO15394.
PaxDbiO15394.
PeptideAtlasiO15394.
PRIDEiO15394.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000400546; ENSP00000383392; ENSG00000154654. [O15394-1]
GeneIDi4685.
KEGGihsa:4685.
UCSCiuc002yld.3. human. [O15394-1]

Organism-specific databases

CTDi4685.
DisGeNETi4685.
GeneCardsiNCAM2.
H-InvDBHIX0027799.
HGNCiHGNC:7657. NCAM2.
HPAiHPA030900.
MIMi602040. gene.
neXtProtiNX_O15394.
OpenTargetsiENSG00000154654.
PharmGKBiPA31460.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IQJD. Eukaryota.
ENOG41118FG. LUCA.
GeneTreeiENSGT00860000133697.
HOGENOMiHOG000074124.
HOVERGENiHBG052579.
InParanoidiO15394.
KOiK06491.
OMAiNISCDVM.
OrthoDBiEOG091G00V0.
PhylomeDBiO15394.
TreeFamiTF326195.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000154654-MONOMER.

Miscellaneous databases

ChiTaRSiNCAM2. human.
EvolutionaryTraceiO15394.
GenomeRNAii4685.
PROiO15394.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000154654.
CleanExiHS_NCAM2.
ExpressionAtlasiO15394. baseline and differential.
GenevisibleiO15394. HS.

Family and domain databases

CDDicd00063. FN3. 2 hits.
Gene3Di2.60.40.10. 7 hits.
InterProiIPR003961. FN3_dom.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR013106. Ig_V-set.
IPR009138. Neural_cell_adh.
[Graphical view]
PfamiPF00041. fn3. 2 hits.
PF07679. I-set. 4 hits.
[Graphical view]
PRINTSiPR01838. NCAMFAMILY.
SMARTiSM00060. FN3. 2 hits.
SM00409. IG. 5 hits.
SM00408. IGc2. 5 hits.
SM00406. IGv. 3 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 5 hits.
SSF49265. SSF49265. 1 hit.
PROSITEiPS50853. FN3. 2 hits.
PS50835. IG_LIKE. 5 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiNCAM2_HUMAN
AccessioniPrimary (citable) accession number: O15394
Secondary accession number(s): A8MQ06, B7Z841, Q7Z7F2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: July 22, 2008
Last modified: November 30, 2016
This is version 160 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 21
    Human chromosome 21: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.