O15393 (TMPS2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 131.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Transmembrane protease serine 2 EC=3.4.21.- Alternative name(s): Serine protease 10 Cleaved into the following 2 chains: | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 492 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Subcellular location | Cell membrane; Single-pass type II membrane protein. Transmembrane protease serine 2 catalytic chain: Secreted. Note: Activated by cleavage and secreted. |
| Tissue specificity | Expressed strongly in small intestine. Also expressed in prostate, colon, stomach and salivary gland. Ref.9 |
| Sequence similarities | Belongs to the peptidase S1 family. Contains 1 LDL-receptor class A domain. Contains 1 peptidase S1 domain. Contains 1 SRCR domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell membrane Membrane Secreted |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Signal-anchor Transmembrane Transmembrane helix |
| Molecular function | Hydrolase Protease Serine protease |
| PTM | Disulfide bond Glycoprotein Zymogen |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | proteolysis Inferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | cytoplasm Inferred from direct assay. Source: HPA extracellular regionInferred from electronic annotation. Source: UniProtKB-SubCell integral to plasma membraneTraceable author statement Ref.1. Source: ProtInc |
| Molecular_function | scavenger receptor activity Inferred from electronic annotation. Source: InterPro serine-type endopeptidase activityInferred from electronic annotation. Source: InterPro serine-type peptidase activityTraceable author statement Ref.1. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O15393-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O15393-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MPPAPPGGESGCEERGAAGHIEHSRYLSLLDAVDNSKM | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 255 | 255 | Transmembrane protease serine 2 non-catalytic chain | PRO_0000027855 | |||||||
| Chain | 256 – 492 | 237 | Transmembrane protease serine 2 catalytic chain | PRO_0000027856 | |||||||
Regions | |||||||||||
| Topological domain | 1 – 84 | 84 | Cytoplasmic Potential | ||||||||
| Transmembrane | 85 – 105 | 21 | Helical; Signal-anchor for type II membrane protein; Potential | ||||||||
| Topological domain | 106 – 492 | 387 | Extracellular Potential | ||||||||
| Domain | 112 – 149 | 38 | LDL-receptor class A | ||||||||
| Domain | 150 – 242 | 93 | SRCR | ||||||||
| Domain | 256 – 489 | 234 | Peptidase S1 | ||||||||
Sites | |||||||||||
| Active site | 296 | 1 | Charge relay system By similarity | ||||||||
| Active site | 345 | 1 | Charge relay system By similarity | ||||||||
| Active site | 441 | 1 | Charge relay system | ||||||||
| Site | 255 – 256 | 2 | Cleavage Potential | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 213 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 249 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 113 ↔ 126 | By similarity | |||||||||
| Disulfide bond | 120 ↔ 139 | By similarity | |||||||||
| Disulfide bond | 133 ↔ 148 | By similarity | |||||||||
| Disulfide bond | 172 ↔ 231 | By similarity | |||||||||
| Disulfide bond | 185 ↔ 241 | By similarity | |||||||||
| Disulfide bond | 244 ↔ 365 | Interchain (between non-catalytic and catalytic chains) By similarity | |||||||||
| Disulfide bond | 281 ↔ 297 | By similarity | |||||||||
| Disulfide bond | 410 ↔ 426 | By similarity | |||||||||
| Disulfide bond | 437 ↔ 465 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 | 1 | M → MPPAPPGGESGCEERGAAGH IEHSRYLSLLDAVDNSKM in isoform 2. | VSP_045083 | |||||||
| Natural variant | 160 | 1 | V → M. Ref.1 Ref.2 Ref.10 Corresponds to variant rs12329760 [ dbSNP | Ensembl ]. | VAR_027674 | |||||||
| Natural variant | 254 | 1 | S → C. Ref.10 | VAR_038002 | |||||||
| Natural variant | 329 | 1 | E → Q. Ref.1 Ref.10 | VAR_038003 | |||||||
| Natural variant | 449 | 1 | K → N. Corresponds to variant rs1056602 [ dbSNP | Ensembl ]. | VAR_011692 | |||||||
| Natural variant | 491 | 1 | D → N. Ref.10 | VAR_038004 | |||||||
Experimental info | |||||||||||
| Mutagenesis | 255 | 1 | R → Q: Loss of cleavage. | ||||||||
| Mutagenesis | 441 | 1 | S → A: Loss of activity. | ||||||||
| Sequence conflict | 26 | 1 | Y → H in BAF84502. Ref.4 | ||||||||
| Sequence conflict | 62 | 1 | N → S in BAH12445. Ref.4 | ||||||||
| Sequence conflict | 163 | 1 | S → P in BAF84502. Ref.4 | ||||||||
| Sequence conflict | 242 | 1 | I → L in AAC51784. Ref.1 | ||||||||
| Sequence conflict | 489 – 491 | 3 | RAD → KAN in AAC51784. Ref.1 | ||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning of the TMPRSS2 gene, which encodes a novel serine protease with transmembrane, LDLRA, and SRCR domains and maps to 21q22.3." Paoloni-Giacobino A., Chen H., Peitsch M.C., Rossier C., Antonarakis S.E. Genomics 44:309-320(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS MET-160 AND GLN-329. |
| [2] | "Mutation analyses of 268 candidate genes in human tumor cell lines." Teng D.-H., Chen Y., Lian L., Ha P.C., Tavtigian S.V., Wong A.K.C. Genomics 74:352-364(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT MET-160. |
| [3] | "Catalytic cleavage of the androgen-regulated TMPRSS2 protease results in its secretion by prostate and prostate cancer epithelia." Afar D.E.H., Vivanco I., Hubert R.S., Kuo J., Chen E., Saffran D.C., Raitano A.B., Jakobovits A. Cancer Res. 61:1686-1692(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), MUTAGENESIS. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Prostate, Testis and Tongue. |
| [5] | Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S. Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Liver. |
| [6] | "The DNA sequence of human chromosome 21." Hattori M., Fujiyama A., Taylor T.D., Watanabe H., Yada T., Park H.-S., Toyoda A., Ishii K., Totoki Y., Choi D.-K., Groner Y., Soeda E., Ohki M., Takagi T., Sakaki Y., Taudien S., Blechschmidt K., Polley A. Yaspo M.-L.Nature 405:311-319(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: PNS. |
| [9] | "Expression of transmembrane serine protease TMPRSS2 in mouse and human tissues." Vaarala M.H., Porvari K.S., Kellokumpu S., Kyllonen A.P., Vihko P.T. J. Pathol. 193:134-140(2001) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [10] | "An integrated genetic and functional analysis of the role of type II transmembrane serine proteases (TMPRSSs) in hearing loss." Guipponi M., Toh M.-Y., Tan J., Park D., Hanson K., Ballana E., Kwong D., Cannon P.Z.F., Wu Q., Gout A., Delorenzi M., Speed T.P., Smith R.J.H., Dahl H.-H.M., Petersen M., Teasdale R.D., Estivill X., Park W.J., Scott H.S. Hum. Mutat. 29:130-141(2008) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS MET-160; CYS-254; GLN-329 AND ASN-491. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U75329 mRNA. Translation: AAC51784.1. AF123453 mRNA. Translation: AAD37117.1. AF270487 mRNA. Translation: AAK29280.1. AK291813 mRNA. Translation: BAF84502.1. AK296860 mRNA. Translation: BAH12445.1. AK313338 mRNA. Translation: BAG36142.1. AK222784 mRNA. Translation: BAD96504.1. AP001610 Genomic DNA. No translation available. CH471079 Genomic DNA. Translation: EAX09597.1. CH471079 Genomic DNA. Translation: EAX09598.1. BC051839 mRNA. Translation: AAH51839.1. |
| IPI | IPI00006212. IPI00871690. |
| RefSeq | NP_001128571.1. NM_001135099.1. NP_005647.3. NM_005656.3. |
| UniGene | Hs.439309. |
3D structure databases | |
| ProteinModelPortal | O15393. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000330330. |
Protein family/group databases | |
| MEROPS | S01.247. |
PTM databases | |
| PhosphoSite | O15393. |
Proteomic databases | |
| PaxDb | O15393. |
| PRIDE | O15393. |
Protocols and materials databases | |
| DNASU | 7113. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000332149; ENSP00000330330; ENSG00000184012. ENST00000398585; ENSP00000381588; ENSG00000184012. ENST00000458356; ENSP00000391216; ENSG00000184012. |
| GeneID | 7113. |
| KEGG | hsa:7113. |
| UCSC | uc002yzj.3. human. uc010gor.3. human. |
Organism-specific databases | |
| CTD | 7113. |
| GeneCards | GC21M042836. |
| HGNC | HGNC:11876. TMPRSS2. |
| HPA | HPA013182. |
| MIM | 602060. gene. |
| neXtProt | NX_O15393. |
| PharmGKB | PA36577. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG5640. |
| HOVERGEN | HBG013304. |
| KO | K09633. |
| OMA | FYSSQGI. |
| OrthoDB | EOG4J6RQN. |
| PhylomeDB | O15393. |
Enzyme and pathway databases | |
| Pathway_Interaction_DB | ar_pathway. Coregulation of Androgen receptor activity. ar_tf_pathway. Regulation of Androgen receptor activity. |
Gene expression databases | |
| ArrayExpress | O15393. |
| Bgee | O15393. |
| CleanEx | HS_TMPRSS2. |
| Genevestigator | O15393. |
| GermOnline | ENSG00000184012. Homo sapiens. |
Family and domain databases | |
| Gene3D | 4.10.400.10. 1 hit. |
| InterPro | IPR023415. LDLR_class-A_CS. IPR002172. LDrepeatLR_classA_rpt. IPR001254. Peptidase_S1. IPR018114. Peptidase_S1_AS. IPR001314. Peptidase_S1A. IPR001190. Srcr_rcpt. IPR017448. Srcr_rcpt-rel. IPR009003. Trypsin-like_Pept_dom. [Graphical view] |
| Pfam | PF00530. SRCR. 1 hit. PF00089. Trypsin. 1 hit. [Graphical view] |
| PRINTS | PR00722. CHYMOTRYPSIN. |
| SMART | SM00192. LDLa. 1 hit. SM00202. SR. 1 hit. SM00020. Tryp_SPc. 1 hit. [Graphical view] |
| SUPFAM | SSF57424. LDL_rcpt_classA_cys-rich. 1 hit. SSF50494. Pept_Ser_Cys. 1 hit. SSF56487. Srcr_receptor. 1 hit. |
| PROSITE | PS01209. LDLRA_1. 1 hit. PS50068. LDLRA_2. 1 hit. PS00420. SRCR_1. False negative. PS50287. SRCR_2. 1 hit. PS50240. TRYPSIN_DOM. 1 hit. PS00134. TRYPSIN_HIS. 1 hit. PS00135. TRYPSIN_SER. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | O15393. |
| ChEMBL | CHEMBL1795140. |
| ChiTaRS | TMPRSS2. human. |
| GenomeRNAi | 7113. |
| NextBio | 27847. |
| SOURCE | Search... |
Entry information
| Entry name | TMPS2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O15393 Secondary accession number(s): A8K6Z8 Q9BXX1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Peptidase families Classification of peptidase families and list of entries |
| Human chromosome 21 Human chromosome 21: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
