Reviewed,
UniProtKB/Swiss-Prot O15392 (BIRC5_HUMAN)
Last modified
January 19, 2010.
Version 123.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Baculoviral IAP repeat-containing protein 5 Alternative name(s): Apoptosis inhibitor survivin Apoptosis inhibitor 4 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 142 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. The complex with RAN plays a role in mitotic spindle formation by serving as a physical scaffold to help deliver the RAN effector molecule TPX2 to microtubules. May play a role in neoplasia. May counteract a default induction of apoptosis in G2/M phase. Inhibitor of caspase-3 and caspase-7. Isoform 2 and isoform 3 do not appear to play vital roles in mitosis. Isoform 3 shows a marked reduction in its anti-apoptotic effects when compared with the displayed wild-type isoform. Ref.2 Ref.16 Ref.18 Ref.21 Ref.26 Ref.30 |
| Subunit structure | Monomer or homodimer. Exist as a homodimer in the apo state and as a monomer in the CPC-bound state. When phosphorylated, interacts with HBXIP; the resulting complex binds pro-caspase-9, as well as active caspase-9, but much less efficiently. Component of the CPC at least composed of BIRC5/survivin, CDCA8/borealin, INCENP and AURKB/Aurora-B. Interacts with CDCA8 and INCENP; interaction is direct. Interacts with EVI5. Interacts with GTP-bound RAN in both the S and M phases of the cell cycle. Interacts with USP9X. Interacts with tubulin. Ref.18 Ref.21 Ref.26 Ref.30 Ref.19 Ref.20 Ref.23 Ref.24 Ref.25 Ref.27 Ref.34 |
| Subcellular location | Cytoplasm. Nucleus. Centromere. Cytoplasm › cytoskeleton › spindle. Note: Localizes on chromosome arms and inner centromeres from prophase through metaphase and then transferring to the spindle midzone and midbody from anaphase through cytokinesis. Colocalizes with AURKB at mitotic chromosomes. Ref.18 Ref.21 Ref.30 Ref.19 Ref.3 |
| Tissue specificity | Expressed only in fetal kidney and liver, and to lesser extent, lung and brain. Abundantly expressed in adenocarcinoma (lung, pancreas, colon, breast, and prostate) and in high-grade lymphomas. Also expressed in various renal cell carcinoma cell lines. Ref.2 Ref.4 Ref.5 |
| Developmental stage | Expression is cell cycle-dependent and peaks at mitosis. Ref.30 |
| Induction | Up-regulated by COMP. Ref.29 |
| Domain | The BIR repeat is necessary and sufficient for HBXIP binding. |
| Post-translational modification | Ubiquitination is required for centrosomal targeting. In vitro phosphorylation at Thr-117 by AURKB/STK12 prevents interaction with INCENP and localization to mitotic chromosomes. |
| Sequence similarities | Belongs to the IAP family. Contains 1 BIR repeat. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| itself | 2 | EBI-518838,EBI-518838 | ||
| AURKB | Q96GD4 | 1 | EBI-518823,EBI-624291 | |
| AURKB | Q96GD4 | 2 | EBI-518838,EBI-624291 | |
| AURKB | Q96GD4 | 2 | EBI-518842,EBI-624291 | |
| BIRC5 | O15392-1 | 2 | EBI-518842,EBI-518838 | |
| BIRC5 | O15392-2 | 2 | EBI-518838,EBI-518842 | |
| Birc6 | O88738 | 1 | EBI-518823,EBI-912068 | From a different organism. |
| CASP9 | P55211 | 1 | EBI-518823,EBI-516799 | |
| CDC2 | P06493 | 1 | EBI-518823,EBI-444308 | |
| CDCA8 | Q53HL2 | 2 | EBI-518823,EBI-979174 | |
| CDCA8 | Q53HL2 | 2 | EBI-518838,EBI-979174 | |
| CDCA8 | Q53HL2 | 2 | EBI-518842,EBI-979174 | |
| PPP1CC | P36873-1 | 1 | EBI-518823,EBI-356289 | |
| USF2 | Q15853 | 1 | EBI-518823,EBI-1055994 |
Alternative products
| This entry describes 7 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O15392-1) Also known as: Alpha; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O15392-2) Also known as: 2B; Beta; The sequence of this isoform differs from the canonical sequence as follows: 74-74: I → IGPGTVAYACNTSTLGGRGGRITR | ||||||
| Isoform 3 (identifier: O15392-3) Also known as: DeltaEx3; The sequence of this isoform differs from the canonical sequence as follows: 74-142: IEEHKKHSSG...RAIEQLAAMD → MQRKPTIRRK...SLPVGPLAMS | ||||||
| Isoform 4 (identifier: O15392-4) Also known as: 3B; The sequence of this isoform differs from the canonical sequence as follows: 114-142: AKETNNKKKEFEETAEKVRRAIEQLAAMD → ERALLAE | ||||||
| Isoform 5 (identifier: O15392-5) Also known as: SI; The sequence of this isoform differs from the canonical sequence as follows: 105-142: DRERAKNKIAKETNNKKKEFEETAEKVRRAIEQLAAMD → VRETLPPPRSFIR | ||||||
| Isoform 6 (identifier: O15392-6) Also known as: 3 alpha; The sequence of this isoform differs from the canonical sequence as follows: 74-142: IEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETAEKVRRAIEQLAAMD → MRELC | ||||||
| Isoform 7 (identifier: O15392-7) Also known as: 2 alpha; The sequence of this isoform differs from the canonical sequence as follows: 74-142: IEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETAEKVRRAIEQLAAMD → M |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 142 | 142 | Baculoviral IAP repeat-containing protein 5 | PRO_0000122356 | |||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||
| Repeat | 18 – 88 | 71 | BIR | ||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||
| Metal binding | 57 | 1 | Zinc | ||||||||||||||||||||||||||
| Metal binding | 60 | 1 | Zinc | ||||||||||||||||||||||||||
| Metal binding | 77 | 1 | Zinc | ||||||||||||||||||||||||||
| Metal binding | 84 | 1 | Zinc | ||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||
| Modified residue | 34 | 1 | Phosphothreonine; by CDC2 Ref.17 Ref.28 Ref.31 | ||||||||||||||||||||||||||
| Modified residue | 117 | 1 | Phosphothreonine; by STK12 Ref.19 | ||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||
| Alternative sequence | 74 – 142 | 69 | IEEHK…LAAMD → MQRKPTIRRKNLRKLRRKCA VPSSSWLPWIEASGRSCLVP EWLHHFQGLFPGATSLPVGP LAMS in isoform 3. | VSP_020338 | |||||||||||||||||||||||||
| Alternative sequence | 74 – 142 | 69 | IEEHK…LAAMD → MRELC in isoform 6. | VSP_020339 | |||||||||||||||||||||||||
| Alternative sequence | 74 – 142 | 69 | IEEHK…LAAMD → M in isoform 7. | VSP_020340 | |||||||||||||||||||||||||
| Alternative sequence | 74 | 1 | I → IGPGTVAYACNTSTLGGRGG RITR in isoform 2. | VSP_002454 | |||||||||||||||||||||||||
| Alternative sequence | 105 – 142 | 38 | DRERA…LAAMD → VRETLPPPRSFIR in isoform 5. | VSP_020341 | |||||||||||||||||||||||||
| Alternative sequence | 114 – 142 | 29 | AKETN…LAAMD → ERALLAE in isoform 4. | VSP_020342 | |||||||||||||||||||||||||
| Natural variant | 129 | 1 | E → K: dbSNP rs2071214. Ref.2 Ref.3 Ref.4 Ref.5 Ref.6 Ref.9 Ref.10 Ref.11 Ref.12 Ref.15 | VAR_021071 | |||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||
| Mutagenesis | 23 | 1 | K → R: Increases ubiquitination and blocks dissociation from centromeres; when associated with R-62, R-78 and R-79. Ref.21 | ||||||||||||||||||||||||||
| Mutagenesis | 34 | 1 | T → A: Loss of HBXIP binding. Ref.18 | ||||||||||||||||||||||||||
| Mutagenesis | 34 | 1 | T → E: Higher affinity for HBXIP binding. Ref.18 | ||||||||||||||||||||||||||
| Mutagenesis | 62 | 1 | K → R: Increases ubiquitination and blocks dissociation from centromeres; when associated with R-23; R-78 and R-79. Ref.21 | ||||||||||||||||||||||||||
| Mutagenesis | 65 | 1 | E → A: Almost abolishes RAN-binding. Does not disrupt binding to AURKB or CDCA8. Disrupts mitotic spindle assembly. Does not disrupt nuclear export. Ref.30 | ||||||||||||||||||||||||||
| Mutagenesis | 70 | 1 | D → A: No change. Loss of interaction with AURKB; when associated A-71. Ref.22 | ||||||||||||||||||||||||||
| Mutagenesis | 71 | 1 | D → A: No change. Loss of interaction with AURKB; when associated with A-70. Ref.22 | ||||||||||||||||||||||||||
| Mutagenesis | 78 | 1 | K → R: Increases ubiquitination and blocks dissociation from centromeres; when associated with R-23; R-62 and R-79. Ref.21 | ||||||||||||||||||||||||||
| Mutagenesis | 79 | 1 | K → R: Increases ubiquitination and blocks dissociation from centromeres; when associated with R-23; R-62 and R-78. Ref.21 | ||||||||||||||||||||||||||
| Mutagenesis | 84 | 1 | C → A: Loss of cytoprotection. | ||||||||||||||||||||||||||
| Mutagenesis | 117 | 1 | T → A: Prevents phosphorylation by STK12/AURKB. Still able to localize correctly but prevents interaction with INCENP. Ref.19 | ||||||||||||||||||||||||||
| Mutagenesis | 117 | 1 | T → E: Mimics phosphorylation. Disrupts subcellular localization during mitosis and prevents interaction with INCENP. Ref.19 | ||||||||||||||||||||||||||
| Sequence conflict | 57 – 58 | 2 | CF → WV in AAW22624. Ref.5 | ||||||||||||||||||||||||||
| Sequence conflict | 58 | 1 | F → L in BAD97148. Ref.11 | ||||||||||||||||||||||||||
| Sequence conflict | 128 | 1 | A → V in CAG46540. Ref.9 | ||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||
| Turn | 8 – 10 | 3 | |||||||||||||||||||||||||||
| Helix | 11 – 13 | 3 | |||||||||||||||||||||||||||
| Helix | 15 – 20 | 6 | |||||||||||||||||||||||||||
| Helix | 35 – 40 | 6 | |||||||||||||||||||||||||||
| Beta strand | 43 – 45 | 3 | |||||||||||||||||||||||||||
| Beta strand | 55 – 57 | 3 | |||||||||||||||||||||||||||
| Turn | 58 – 60 | 3 | |||||||||||||||||||||||||||
| Helix | 73 – 80 | 8 | |||||||||||||||||||||||||||
| Helix | 85 – 88 | 4 | |||||||||||||||||||||||||||
| Helix | 93 – 95 | 3 | |||||||||||||||||||||||||||
| Helix | 98 – 139 | 42 | |||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A novel anti-apoptosis gene, survivin, expressed in cancer and lymphoma." Ambrosini G., Adida C., Altieri D.C. Nat. Med. 3:917-921(1997) [PubMed: 9256286] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1). |
| [2] | "Survivin-deltaEx3 and survivin-2B: two novel splice variants of the apoptosis inhibitor survivin with different antiapoptotic properties." Mahotka C., Wenzel M., Springer E., Gabbert H.E., Gerharz C.D. Cancer Res. 59:6097-6102(1999) [PubMed: 10626797] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), FUNCTION, TISSUE SPECIFICITY, VARIANT LYS-129. |
| [3] | "Survivin and the inner centromere protein INCENP show similar cell-cycle localization and gene knockout phenotype." Uren A.G., Wong L., Pakusch M., Fowler K.J., Burrows F.J., Vaux D.L., Choo K.H. Curr. Biol. 10:1319-1328(2000) [PubMed: 11084331] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, VARIANT LYS-129. |
| [4] | "Identification of a novel splice variant of the human anti-apoptosis gene survivin." Badran A., Yoshida A., Ishikawa K., Goi T., Yamaguchi A., Ueda T., Inuzuka M. Biochem. Biophys. Res. Commun. 314:902-907(2004) [PubMed: 14741722] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), TISSUE SPECIFICITY, VARIANT LYS-129. Tissue: Myeloid leukemia cell. |
| [5] | "Molecular cloning and bioinformatics analysis of a novel spliced variant of survivin from human breast cancer cells." Zheng W., Ma X., Wei D., Wang T., Ma Y., Yang S. DNA Seq. 16:321-328(2005) [PubMed: 16329164] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), VARIANT LYS-129, TISSUE SPECIFICITY. Tissue: Mammary cancer. |
| [6] | "An isoform of survivin (survivin-beta) which has 23 amino acids insertion into the BIR domain." Kageyama H., Islam A., Takayasu H., Nakagawara A. Submitted (JUN-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), VARIANT LYS-129. Tissue: Neuroblastoma. |
| [7] | "Survivin 2 alpha: a novel survivin splice variant expressed in human malignancies." Caldas H., Honsey L.E., Altura R.A. Submitted (FEB-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 7). |
| [8] | "Identification of a novel survivin splicing variant 3alpha in acute myeloid leukemia." Vietri M.T., Cioffi M., Sessa M., Sica V., Molinari A.M. Submitted (NOV-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 6). Tissue: Myeloid leukemia cell. |
| [9] | "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT LYS-129. |
| [10] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT LYS-129. |
| [11] | Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S. Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT LYS-129. |
| [12] | NIEHS SNPs program Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT LYS-129. |
| [13] | "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage." Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. Nusbaum C.Nature 440:1045-1049(2006) [PubMed: 16625196] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [14] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT LYS-129. |
| [15] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT LYS-129. Tissue: Lung, Mammary gland and Muscle. |
| [16] | "Control of apoptosis and mitotic spindle checkpoint by survivin." Li F., Ambrosini G., Chu E.Y., Plescia J., Tognin S., Marchisio P.C., Altieri D.C. Nature 396:580-584(1998) [PubMed: 9859993] [Abstract] Cited for: FUNCTION. |
| [17] | "Regulation of apoptosis at cell division by p34cdc2 phosphorylation of survivin." O'Connor D.S., Grossman D., Plescia J., Li F., Zhang H., Villa A., Tognin S., Marchisio P.C., Altieri D.C. Proc. Natl. Acad. Sci. U.S.A. 97:13103-13107(2000) [PubMed: 11069302] [Abstract] Cited for: PHOSPHORYLATION AT THR-34. |
| [18] | "HBXIP functions as a cofactor of survivin in apoptosis suppression." Marusawa H., Matsuzawa S., Welsh K., Zou H., Armstrong R., Tamm I., Reed J.C. EMBO J. 22:2729-2740(2003) [PubMed: 12773388] [Abstract] Cited for: FUNCTION IN APOPTOSIS SUPPRESSION, INTERACTION WITH HBXIP, MUTAGENESIS OF THR-34, SUBCELLULAR LOCATION. |
| [19] | "Aurora-B phosphorylation in vitro identifies a residue of survivin that is essential for its localization and binding to inner centromere protein (INCENP) in vivo." Wheatley S.P., Henzing A.J., Dodson H., Khaled W., Earnshaw W.C. J. Biol. Chem. 279:5655-5660(2004) [PubMed: 14610074] [Abstract] Cited for: INTERACTION WITH INCENP, SUBCELLULAR LOCATION, PHOSPHORYLATION AT THR-117, MUTAGENESIS OF THR-117. |
| [20] | "Borealin: a novel chromosomal passenger required for stability of the bipolar mitotic spindle." Gassmann R., Carvalho A., Henzing A.J., Ruchaud S., Hudson D.F., Honda R., Nigg E.A., Gerloff D.L., Earnshaw W.C. J. Cell Biol. 166:179-191(2004) [PubMed: 15249581] [Abstract] Cited for: INTERACTION WITH CDCA8. |
| [21] | "Chromosome alignment and segregation regulated by ubiquitination of survivin." Vong Q.P., Cao K., Li H.Y., Iglesias P.A., Zheng Y. Science 310:1499-1504(2005) [PubMed: 16322459] [Abstract] Cited for: FUNCTION, INTERACTION WITH USP9X, SUBCELLULAR LOCATION, UBIQUITINATION, MUTAGENESIS OF LYS-23; LYS-62; LYS-78 AND LYS-79. |
| [22] | "Survivin mutant (Surv-DD70, 71AA) disrupts the interaction of Survivin with Aurora B and causes multinucleation in HeLa cells." Cao L., Yan X., Wu Y., Hu H., Li Q., Zhou T., Jiang S., Yu L. Biochem. Biophys. Res. Commun. 346:400-407(2006) [PubMed: 16762323] [Abstract] Cited for: MUTAGENESIS OF ASP-70; ASP-71 AND 70-ASP--ASP-71. |
| [23] | "Survivin mediates targeting of the chromosomal passenger complex to the centromere and midbody." Vader G., Kauw J.J.W., Medema R.H., Lens S.M.A. EMBO Rep. 7:85-92(2006) [PubMed: 16239925] [Abstract] Cited for: INTERACTION WITH CDCA8. |
| [24] | "Borealin/Dasra B is a cell cycle-regulated chromosomal passenger protein and its nuclear accumulation is linked to poor prognosis for human gastric cancer." Chang J.-L., Chen T.-H., Wang C.-F., Chiang Y.-H., Huang Y.-L., Wong F.-H., Chou C.-K., Chen C.-M. Exp. Cell Res. 312:962-973(2006) [PubMed: 16427043] [Abstract] Cited for: INTERACTION WITH CDCA8. |
| [25] | "EVI5 protein associates with the INCENP-aurora B kinase-survivin chromosomal passenger complex and is involved in the completion of cytokinesis." Faitar S.L., Sossey-Alaoui K., Ranalli T.A., Cowell J.K. Exp. Cell Res. 312:2325-2335(2006) [PubMed: 16764853] [Abstract] Cited for: INTERACTION WITH EVI5. |
| [26] | "Molecular analysis of survivin isoforms: evidence that alternatively spliced variants do not play a role in mitosis." Noton E.A., Colnaghi R., Tate S., Starck C., Carvalho A., Ko Ferrigno P., Wheatley S.P. J. Biol. Chem. 281:1286-1295(2006) [PubMed: 16291752] [Abstract] Cited for: FUNCTION, INTERACTION WITH CDCA8. |
| [27] | "Uncoupling the central spindle-associated function of the chromosomal passenger complex from its role at centromeres." Lens S.M.A., Rodriguez J.A., Vader G., Span S.W., Giaccone G., Medema R.H. Mol. Biol. Cell 17:1897-1909(2006) [PubMed: 16436504] [Abstract] Cited for: INTERACTION WITH CDCA8. |
| [28] | "Phosphoproteome analysis of the human mitotic spindle." Nousiainen M., Sillje H.H.W., Sauer G., Nigg E.A., Koerner R. Proc. Natl. Acad. Sci. U.S.A. 103:5391-5396(2006) [PubMed: 16565220] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-34, MASS SPECTROMETRY. Tissue: Epithelium. |
| [29] | "Cartilage oligomeric matrix protein protects cells against death by elevating members of the IAP family of survival proteins." Gagarina V., Carlberg A.L., Pereira-Mouries L., Hall D.J. J. Biol. Chem. 283:648-659(2008) [PubMed: 17993464] [Abstract] Cited for: INDUCTION. |
| [30] | "A survivin-ran complex regulates spindle formation in tumor cells." Xia F., Canovas P.M., Guadagno T.M., Altieri D.C. Mol. Cell. Biol. 28:5299-5311(2008) [PubMed: 18591255] [Abstract] Cited for: FUNCTION, INTERACTION WITH RAN; AURKB AND CDCA8, SUBCELLULAR LOCATION, DEVELOPMENTAL STAGE, MUTAGENESIS OF GLU-65. |
| [31] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed: 18691976] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-34, MASS SPECTROMETRY. |
| [32] | "Crystal structure of human survivin reveals a bow tie-shaped dimer with two unusual alpha-helical extensions." Chantalat L., Skoufias D.A., Kleman J.P., Jung B., Dideberg O., Margolis R.L. Mol. Cell 6:183-189(2000) [PubMed: 10949039] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.71 ANGSTROMS) OF ISOFORM 1. |
| [33] | "Structure of the human anti-apoptotic protein survivin reveals a dimeric arrangement." Verdecia M.A., Huang H., Dutil E., Kaiser D.A., Hunter T., Noel J.P. Nat. Struct. Biol. 7:602-608(2000) [PubMed: 10876248] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.58 ANGSTROMS) OF ISOFORM 1. |
| [34] | "Structure of a Survivin-Borealin-INCENP core complex reveals how chromosomal passengers travel together." Jeyaprakash A.A., Klein U.R., Lindner D., Ebert J., Nigg E.A., Conti E. Cell 131:271-285(2007) [PubMed: 17956729] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.8 ANGSTROMS) IN COMPLEX WITH ZINC IONS, SUBUNIT, INTERACTION WITH CDCA8 AND INCENP. |
| [35] | "Phosphorylation of a borealin dimerization domain is required for proper chromosome segregation." Bourhis E., Lingel A., Phung Q., Fairbrother W.J., Cochran A.G. Biochemistry 48:6783-6793(2009) [PubMed: 19530738] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.4 ANGSTROMS). |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U75285 Genomic DNA. Translation: AAC51660.1. AF077350 mRNA. Translation: AAD34226.1. AB154416 mRNA. Translation: BAD11155.1. AY830084 mRNA. Translation: AAW22624.1. AB028869 mRNA. Translation: BAA93676.1. AY927772 mRNA. Translation: AAY15202.1. DQ310375 mRNA. Translation: ABC42341.1. DQ310376 mRNA. Translation: ABC42342.1. DQ310377 mRNA. Translation: ABC42343.1. DQ310378 mRNA. Translation: ABC42344.1. DQ310379 mRNA. Translation: ABC42345.1. CR541740 mRNA. Translation: CAG46540.1. AK223428 mRNA. Translation: BAD97148.1. AK311917 mRNA. Translation: BAG34858.1. AY795969 Genomic DNA. Translation: AAV40840.1. AC087645 Genomic DNA. No translation available. CH471099 Genomic DNA. Translation: EAW89514.1. BC008718 mRNA. Translation: AAH08718.1. BC034148 mRNA. Translation: AAH34148.1. BC065497 mRNA. Translation: AAH65497.1. | ||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00006210. IPI00218095. IPI00735946. IPI00784873. IPI00784916. IPI00784964. IPI00785191. | ||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001012270.1. NP_001012271.1. NP_001159.2. | ||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.514527 | ||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||
| IntAct | O15392. 16 interactions. | ||||||||||||||||||||||||||||||||||||||||||
| STRING | O15392. | ||||||||||||||||||||||||||||||||||||||||||
Protein family/group databases | |||||||||||||||||||||||||||||||||||||||||||
| MEROPS | I32.005. | ||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | O15392. | ||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||
| PRIDE | O15392. | ||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000350051; ENSP00000324180; ENSG00000089685; Homo sapiens. [Genome view] | ||||||||||||||||||||||||||||||||||||||||||
| GeneID | 332. | ||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:332. | ||||||||||||||||||||||||||||||||||||||||||
| NMPDR | fig|9606.3.peg.14485. | ||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc002jvc.2. human. uc002jvf.1. human. uc002jvg.1. human. uc002jvh.1. human. | ||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||
| CTD | 332. | ||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC17P073722. | ||||||||||||||||||||||||||||||||||||||||||
| H-InvDB | HIX0037877. | ||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:593. BIRC5. | ||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB004270. HPA002830. | ||||||||||||||||||||||||||||||||||||||||||
| MIM | 603352. gene. | ||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA25362. | ||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | O15392. | ||||||||||||||||||||||||||||||||||||||||||
| OMA | SCTPERM. | ||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | aurora_a_pathway. Aurora A signaling. aurora_b_pathway. Aurora B signaling. foxm1pathway. FOXM1 transcription factor network. | ||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_152. Cell Cycle, Mitotic. | ||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | O15392. | ||||||||||||||||||||||||||||||||||||||||||
| Bgee | O15392. | ||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_BIRC5. | ||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | O15392. | ||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000089685. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR001370. Prot_inh_I32_IAP. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00653. BIR. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00238. BIR. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS01282. BIR_REPEAT_1. False negative. PS50143. BIR_REPEAT_2. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||
Other Resources | |||||||||||||||||||||||||||||||||||||||||||
| NextBio | 1369. | ||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | BIRC5_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O15392 Secondary accession number(s): B2R4R1 Q9P2W8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


