O15392 (BIRC5_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 157.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Baculoviral IAP repeat-containing protein 5 Alternative name(s): Apoptosis inhibitor 4 Apoptosis inhibitor survivin | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 142 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Multitasking protein that has dual roles in promoting cell proliferation and preventing apoptosis. Component of a chromosome passage protein complex (CPC) which is essential for chromosome alignment and segregation during mitosis and cytokinesis. Acts as an important regulator of the localization of this complex; directs CPC movement to different locations from the inner centromere during prometaphase to midbody during cytokinesis and participates in the organization of the center spindle by associating with polymerized microtubules. The complex with RAN plays a role in mitotic spindle formation by serving as a physical scaffold to help deliver the RAN effector molecule TPX2 to microtubules. May counteract a default induction of apoptosis in G2/M phase. The acetylated form represses STAT3 transactivation of target gene promoters. May play a role in neoplasia. Inhibitor of CASP3 and CASP7. Isoform 2 and isoform 3 do not appear to play vital roles in mitosis. Isoform 3 shows a marked reduction in its anti-apoptotic effects when compared with the displayed wild-type isoform. Ref.2 Ref.16 Ref.18 Ref.23 Ref.28 Ref.33 Ref.34 Ref.37 |
| Subunit structure | Monomer or homodimer. Exists as a homodimer in the apo state and as a monomer in the CPC-bound state. The monomer protects cells against apoptosis more efficiently than the dimer. Only the dimeric form is capable of enhancing tubulin stability in cells. When phosphorylated, interacts with HBXIP; the resulting complex binds pro-CASP9, as well as active CASP9, but much less efficiently. Component of the chromosomal passenger complex (CPC) composed of at least BIRC5/survivin, CDCA8/borealin, INCENP, AURKB and AURKC. Interacts with JTB. Interacts with CDCA8 and INCENP; interaction is direct. Interacts with EVI5. Interacts with GTP-bound RAN in both the S and M phases of the cell cycle. Interacts with USP9X. Interacts with tubulin. Interacts with BIRC2/c-IAP1. The acetylated form at Lys-129 interacts with STAT3. The monomeric form deacetylated at Lys-129 interacts with XPO1/CRM1. The monomeric form interacts with XIAP/BIRC4. Both the dimeric and monomeric form can interact with DIABLO/SMAC. Interacts with BIRC6/bruce. Ref.18 Ref.19 Ref.20 Ref.21 Ref.23 Ref.25 Ref.26 Ref.27 Ref.28 Ref.29 Ref.30 Ref.33 Ref.34 Ref.36 Ref.37 Ref.40 |
| Subcellular location | Cytoplasm. Nucleus. Chromosome. Chromosome › centromere. Cytoplasm › cytoskeleton › spindle. Chromosome › centromere › kinetochore. Midbody. Note: Localizes on chromosome arms and inner centromeres from prophase through metaphase. Localizes to kinetochores in metaphase, distributes to the midzone microtubules in anaphase and at telophase, localizes exclusively to the midbody. Colocalizes with AURKB at mitotic chromosomes. Acetylation at Lys-129 directs its localization to the nucleus by enhancing homodimerization and thereby inhibiting XPO1/CRM1-mediated nuclear export. Ref.3 Ref.18 Ref.19 Ref.21 Ref.23 Ref.33 Ref.34 |
| Tissue specificity | Expressed only in fetal kidney and liver, and to lesser extent, lung and brain. Abundantly expressed in adenocarcinoma (lung, pancreas, colon, breast, and prostate) and in high-grade lymphomas. Also expressed in various renal cell carcinoma cell lines. Ref.2 Ref.4 Ref.5 |
| Developmental stage | Expression is cell cycle-dependent and peaks at mitosis. Ref.33 |
| Induction | Up-regulated by COMP. Ref.31 |
| Domain | The BIR repeat is necessary and sufficient for HBXIP binding. |
| Post-translational modification | Ubiquitination is required for centrosomal targeting. In vitro phosphorylation at Thr-117 by AURKB prevents interaction with INCENP and localization to mitotic chromosomes. Phosphorylation at Thr-48 by CK2 is critical for its mitotic and anti-apoptotic activities. Acetylation at Lys-129 by CBP results in its homodimerization, while deacetylation promotes the formation of monomers which heterodimerize with XPO1/CRM1 which facilitates its nuclear export. The acetylated form represses STAT3 transactivation. The dynamic equilibrium between its acetylation and deacetylation at Lys-129 determines its interaction with XPO1/CRM1, its subsequent subcellular localization, and its ability to inhibit STAT3 transactivation. |
| Sequence similarities | Belongs to the IAP family. Contains 1 BIR repeat. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| AURKB | Q96GD4 | 2 | EBI-518838,EBI-624291 | |
| CDCA8 | Q53HL2 | 10 | EBI-518823,EBI-979174 | |
| CDK1 | P06493 | 6 | EBI-518823,EBI-444308 |
Alternative products
| This entry describes 7 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O15392-1) Also known as: Alpha; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O15392-2) Also known as: 2B; Beta; The sequence of this isoform differs from the canonical sequence as follows: 74-74: I → IGPGTVAYACNTSTLGGRGGRITR | ||||||
| Isoform 3 (identifier: O15392-3) Also known as: DeltaEx3; The sequence of this isoform differs from the canonical sequence as follows: 74-142: IEEHKKHSSG...RAIEQLAAMD → MQRKPTIRRK...SLPVGPLAMS | ||||||
| Isoform 4 (identifier: O15392-4) Also known as: 3B; The sequence of this isoform differs from the canonical sequence as follows: 114-142: AKETNNKKKEFEETAKKVRRAIEQLAAMD → ERALLAE | ||||||
| Isoform 5 (identifier: O15392-5) Also known as: SI; The sequence of this isoform differs from the canonical sequence as follows: 105-142: DRERAKNKIAKETNNKKKEFEETAKKVRRAIEQLAAMD → VRETLPPPRSFIR | ||||||
| Isoform 6 (identifier: O15392-6) Also known as: 3 alpha; The sequence of this isoform differs from the canonical sequence as follows: 74-142: IEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETAKKVRRAIEQLAAMD → MRELC | ||||||
| Isoform 7 (identifier: O15392-7) Also known as: 2 alpha; The sequence of this isoform differs from the canonical sequence as follows: 74-142: IEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETAKKVRRAIEQLAAMD → M |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 142 | 142 | Baculoviral IAP repeat-containing protein 5 | PRO_0000122356 | ||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||
| Repeat | 18 – 88 | 71 | BIR | |||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||
| Metal binding | 57 | 1 | Zinc | |||||||||||||||||||||||||||||||||
| Metal binding | 60 | 1 | Zinc | |||||||||||||||||||||||||||||||||
| Metal binding | 77 | 1 | Zinc | |||||||||||||||||||||||||||||||||
| Metal binding | 84 | 1 | Zinc | |||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||
| Modified residue | 23 | 1 | N6-acetyllysine Ref.34 | |||||||||||||||||||||||||||||||||
| Modified residue | 34 | 1 | Phosphothreonine; by CDK1 Ref.17 Ref.32 | |||||||||||||||||||||||||||||||||
| Modified residue | 48 | 1 | Phosphothreonine; by CK2; in vitro Ref.35 | |||||||||||||||||||||||||||||||||
| Modified residue | 90 | 1 | N6-acetyllysine Ref.34 | |||||||||||||||||||||||||||||||||
| Modified residue | 110 | 1 | N6-acetyllysine Ref.34 | |||||||||||||||||||||||||||||||||
| Modified residue | 112 | 1 | N6-acetyllysine Ref.34 | |||||||||||||||||||||||||||||||||
| Modified residue | 115 | 1 | N6-acetyllysine Ref.34 | |||||||||||||||||||||||||||||||||
| Modified residue | 117 | 1 | Phosphothreonine; by AURKB Ref.19 | |||||||||||||||||||||||||||||||||
| Modified residue | 121 | 1 | N6-acetyllysine Ref.34 | |||||||||||||||||||||||||||||||||
| Modified residue | 129 | 1 | N6-acetyllysine Ref.34 | |||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||
| Alternative sequence | 74 – 142 | 69 | IEEHK…LAAMD → MQRKPTIRRKNLRKLRRKCA VPSSSWLPWIEASGRSCLVP EWLHHFQGLFPGATSLPVGP LAMS in isoform 3. | VSP_020338 | ||||||||||||||||||||||||||||||||
| Alternative sequence | 74 – 142 | 69 | IEEHK…LAAMD → MRELC in isoform 6. | VSP_020339 | ||||||||||||||||||||||||||||||||
| Alternative sequence | 74 – 142 | 69 | IEEHK…LAAMD → M in isoform 7. | VSP_020340 | ||||||||||||||||||||||||||||||||
| Alternative sequence | 74 | 1 | I → IGPGTVAYACNTSTLGGRGG RITR in isoform 2. | VSP_002454 | ||||||||||||||||||||||||||||||||
| Alternative sequence | 105 – 142 | 38 | DRERA…LAAMD → VRETLPPPRSFIR in isoform 5. | VSP_020341 | ||||||||||||||||||||||||||||||||
| Alternative sequence | 114 – 142 | 29 | AKETN…LAAMD → ERALLAE in isoform 4. | VSP_020342 | ||||||||||||||||||||||||||||||||
| Natural variant | 129 | 1 | K → E Loss of acetylation; localization primarily within the cytoplasm; increased likelihood of existing as monomer; stronger binding to XPO1/CRM1. Ref.13 Ref.34 Corresponds to variant rs2071214 [ dbSNP | Ensembl ]. | VAR_021071 | ||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||
| Mutagenesis | 23 | 1 | K → R: Increases ubiquitination and blocks dissociation from centromeres; when associated with R-62; R-78 and R-79. Ref.23 | |||||||||||||||||||||||||||||||||
| Mutagenesis | 34 | 1 | T → A: Loss of HBXIP binding. Ref.18 | |||||||||||||||||||||||||||||||||
| Mutagenesis | 34 | 1 | T → E: Higher affinity for HBXIP binding. Ref.18 | |||||||||||||||||||||||||||||||||
| Mutagenesis | 48 | 1 | T → A or E: Localizes normally during mitosis but cannot support cell proliferation. Increased affinity for CDCA8/borealin. Ref.35 | |||||||||||||||||||||||||||||||||
| Mutagenesis | 62 | 1 | K → R: Increases ubiquitination and blocks dissociation from centromeres; when associated with R-23; R-78 and R-79. Ref.23 | |||||||||||||||||||||||||||||||||
| Mutagenesis | 65 | 1 | E → A: Almost abolishes RAN-binding. Does not disrupt binding to AURKB or CDCA8. Disrupts mitotic spindle assembly. Does not disrupt nuclear export. Ref.33 | |||||||||||||||||||||||||||||||||
| Mutagenesis | 70 | 1 | D → A: No change. Loss of interaction with AURKB; when associated with A-71. Ref.24 | |||||||||||||||||||||||||||||||||
| Mutagenesis | 71 | 1 | D → A: No change. Loss of interaction with AURKB; when associated with A-70. Ref.24 | |||||||||||||||||||||||||||||||||
| Mutagenesis | 78 | 1 | K → R: Increases ubiquitination and blocks dissociation from centromeres; when associated with R-23; R-62 and R-79. Ref.23 | |||||||||||||||||||||||||||||||||
| Mutagenesis | 79 | 1 | K → R: Increases ubiquitination and blocks dissociation from centromeres; when associated with R-23; R-62 and R-78. Ref.23 | |||||||||||||||||||||||||||||||||
| Mutagenesis | 84 | 1 | C → A: Loss of cytoprotection. | |||||||||||||||||||||||||||||||||
| Mutagenesis | 117 | 1 | T → A: Prevents phosphorylation by AURKB. Still able to localize correctly but prevents interaction with INCENP. Ref.19 | |||||||||||||||||||||||||||||||||
| Mutagenesis | 117 | 1 | T → E: Mimics phosphorylation. Disrupts subcellular localization during mitosis and prevents interaction with INCENP. Ref.19 | |||||||||||||||||||||||||||||||||
| Mutagenesis | 129 | 1 | K → A or Q: Mimics acetylation. Localization primarily within the nucleus. Ref.34 | |||||||||||||||||||||||||||||||||
| Mutagenesis | 129 | 1 | K → R: Loss of acetylation. Localization primarily within the cytoplasm. Ref.34 | |||||||||||||||||||||||||||||||||
| Sequence conflict | 57 – 58 | 2 | CF → WV in AAW22624. Ref.5 | |||||||||||||||||||||||||||||||||
| Sequence conflict | 58 | 1 | F → L in BAD97148. Ref.11 | |||||||||||||||||||||||||||||||||
| Sequence conflict | 128 | 1 | A → V in CAG46540. Ref.9 | |||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||
| Turn | 8 – 10 | 3 | ||||||||||||||||||||||||||||||||||
| Helix | 11 – 13 | 3 | ||||||||||||||||||||||||||||||||||
| Helix | 15 – 20 | 6 | ||||||||||||||||||||||||||||||||||
| Beta strand | 31 – 33 | 3 | ||||||||||||||||||||||||||||||||||
| Helix | 35 – 40 | 6 | ||||||||||||||||||||||||||||||||||
| Beta strand | 43 – 45 | 3 | ||||||||||||||||||||||||||||||||||
| Beta strand | 49 – 51 | 3 | ||||||||||||||||||||||||||||||||||
| Beta strand | 55 – 57 | 3 | ||||||||||||||||||||||||||||||||||
| Turn | 58 – 60 | 3 | ||||||||||||||||||||||||||||||||||
| Beta strand | 63 – 65 | 3 | ||||||||||||||||||||||||||||||||||
| Helix | 73 – 80 | 8 | ||||||||||||||||||||||||||||||||||
| Turn | 81 – 83 | 3 | ||||||||||||||||||||||||||||||||||
| Helix | 85 – 88 | 4 | ||||||||||||||||||||||||||||||||||
| Helix | 93 – 95 | 3 | ||||||||||||||||||||||||||||||||||
| Helix | 98 – 139 | 42 | ||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A novel anti-apoptosis gene, survivin, expressed in cancer and lymphoma." Ambrosini G., Adida C., Altieri D.C. Nat. Med. 3:917-921(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1). |
| [2] | "Survivin-deltaEx3 and survivin-2B: two novel splice variants of the apoptosis inhibitor survivin with different antiapoptotic properties." Mahotka C., Wenzel M., Springer E., Gabbert H.E., Gerharz C.D. Cancer Res. 59:6097-6102(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), FUNCTION, TISSUE SPECIFICITY. |
| [3] | "Survivin and the inner centromere protein INCENP show similar cell-cycle localization and gene knockout phenotype." Uren A.G., Wong L., Pakusch M., Fowler K.J., Burrows F.J., Vaux D.L., Choo K.H. Curr. Biol. 10:1319-1328(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION. |
| [4] | "Identification of a novel splice variant of the human anti-apoptosis gene survivin." Badran A., Yoshida A., Ishikawa K., Goi T., Yamaguchi A., Ueda T., Inuzuka M. Biochem. Biophys. Res. Commun. 314:902-907(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), TISSUE SPECIFICITY. Tissue: Myeloid leukemia cell. |
| [5] | "Molecular cloning and bioinformatics analysis of a novel spliced variant of survivin from human breast cancer cells." Zheng W., Ma X., Wei D., Wang T., Ma Y., Yang S. DNA Seq. 16:321-328(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), TISSUE SPECIFICITY. Tissue: Mammary cancer. |
| [6] | "An isoform of survivin (survivin-beta) which has 23 amino acids insertion into the BIR domain." Kageyama H., Islam A., Takayasu H., Nakagawara A. Submitted (JUN-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Tissue: Neuroblastoma. |
| [7] | "Survivin 2 alpha: a novel survivin splice variant expressed in human malignancies." Caldas H., Honsey L.E., Altura R.A. Submitted (FEB-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 7). |
| [8] | "Identification of a novel survivin splicing variant 3alpha in acute myeloid leukemia." Vietri M.T., Cioffi M., Sessa M., Sica V., Molinari A.M. Submitted (NOV-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 6). Tissue: Myeloid leukemia cell. |
| [9] | "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [10] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [11] | Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S. Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [12] | NIEHS SNPs program Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [13] | "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage." Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. Nusbaum C.Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT GLU-129. |
| [14] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [15] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Lung, Mammary gland and Muscle. |
| [16] | "Control of apoptosis and mitotic spindle checkpoint by survivin." Li F., Ambrosini G., Chu E.Y., Plescia J., Tognin S., Marchisio P.C., Altieri D.C. Nature 396:580-584(1998) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [17] | "Regulation of apoptosis at cell division by p34cdc2 phosphorylation of survivin." O'Connor D.S., Grossman D., Plescia J., Li F., Zhang H., Villa A., Tognin S., Marchisio P.C., Altieri D.C. Proc. Natl. Acad. Sci. U.S.A. 97:13103-13107(2000) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT THR-34. |
| [18] | "HBXIP functions as a cofactor of survivin in apoptosis suppression." Marusawa H., Matsuzawa S., Welsh K., Zou H., Armstrong R., Tamm I., Reed J.C. EMBO J. 22:2729-2740(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN APOPTOSIS SUPPRESSION, INTERACTION WITH HBXIP, MUTAGENESIS OF THR-34, SUBCELLULAR LOCATION. |
| [19] | "Aurora-B phosphorylation in vitro identifies a residue of survivin that is essential for its localization and binding to inner centromere protein (INCENP) in vivo." Wheatley S.P., Henzing A.J., Dodson H., Khaled W., Earnshaw W.C. J. Biol. Chem. 279:5655-5660(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH INCENP, SUBCELLULAR LOCATION, PHOSPHORYLATION AT THR-117, MUTAGENESIS OF THR-117. |
| [20] | "Borealin: a novel chromosomal passenger required for stability of the bipolar mitotic spindle." Gassmann R., Carvalho A., Henzing A.J., Ruchaud S., Hudson D.F., Honda R., Nigg E.A., Gerloff D.L., Earnshaw W.C. J. Cell Biol. 166:179-191(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CDCA8. |
| [21] | "cIAP1 Localizes to the nuclear compartment and modulates the cell cycle." Samuel T., Okada K., Hyer M., Welsh K., Zapata J.M., Reed J.C. Cancer Res. 65:210-218(2005) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, INTERACTION WITH BIRC2/C-IAP1. |
| [22] | "Survivin: a protein with dual roles in mitosis and apoptosis." Wheatley S.P., McNeish I.A. Int. Rev. Cytol. 247:35-88(2005) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW ON FUNCTION. |
| [23] | "Chromosome alignment and segregation regulated by ubiquitination of survivin." Vong Q.P., Cao K., Li H.Y., Iglesias P.A., Zheng Y. Science 310:1499-1504(2005) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH USP9X, SUBCELLULAR LOCATION, UBIQUITINATION, MUTAGENESIS OF LYS-23; LYS-62; LYS-78 AND LYS-79. |
| [24] | "Survivin mutant (Surv-DD70, 71AA) disrupts the interaction of Survivin with Aurora B and causes multinucleation in HeLa cells." Cao L., Yan X., Wu Y., Hu H., Li Q., Zhou T., Jiang S., Yu L. Biochem. Biophys. Res. Commun. 346:400-407(2006) [PubMed] [Europe PMC] [Abstract] Cited for: MUTAGENESIS OF ASP-70; ASP-71 AND 70-ASP--ASP-71. |
| [25] | "Survivin mediates targeting of the chromosomal passenger complex to the centromere and midbody." Vader G., Kauw J.J.W., Medema R.H., Lens S.M.A. EMBO Rep. 7:85-92(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CDCA8. |
| [26] | "Borealin/Dasra B is a cell cycle-regulated chromosomal passenger protein and its nuclear accumulation is linked to poor prognosis for human gastric cancer." Chang J.-L., Chen T.-H., Wang C.-F., Chiang Y.-H., Huang Y.-L., Wong F.-H., Chou C.-K., Chen C.-M. Exp. Cell Res. 312:962-973(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CDCA8. |
| [27] | "EVI5 protein associates with the INCENP-aurora B kinase-survivin chromosomal passenger complex and is involved in the completion of cytokinesis." Faitar S.L., Sossey-Alaoui K., Ranalli T.A., Cowell J.K. Exp. Cell Res. 312:2325-2335(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH EVI5. |
| [28] | "Molecular analysis of survivin isoforms: evidence that alternatively spliced variants do not play a role in mitosis." Noton E.A., Colnaghi R., Tate S., Starck C., Carvalho A., Ko Ferrigno P., Wheatley S.P. J. Biol. Chem. 281:1286-1295(2006) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH CDCA8. |
| [29] | "Uncoupling the central spindle-associated function of the chromosomal passenger complex from its role at centromeres." Lens S.M.A., Rodriguez J.A., Vader G., Span S.W., Giaccone G., Medema R.H. Mol. Biol. Cell 17:1897-1909(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CDCA8. |
| [30] | "Final stages of cytokinesis and midbody ring formation are controlled by BRUCE." Pohl C., Jentsch S. Cell 132:832-845(2008) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH BIRC6/BRUCE. |
| [31] | "Cartilage oligomeric matrix protein protects cells against death by elevating members of the IAP family of survival proteins." Gagarina V., Carlberg A.L., Pereira-Mouries L., Hall D.J. J. Biol. Chem. 283:648-659(2008) [PubMed] [Europe PMC] [Abstract] Cited for: INDUCTION. |
| [32] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-34, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [33] | "A survivin-ran complex regulates spindle formation in tumor cells." Xia F., Canovas P.M., Guadagno T.M., Altieri D.C. Mol. Cell. Biol. 28:5299-5311(2008) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH RAN; AURKB AND CDCA8, SUBCELLULAR LOCATION, DEVELOPMENTAL STAGE, MUTAGENESIS OF GLU-65. |
| [34] | "Acetylation directs survivin nuclear localization to repress STAT3 oncogenic activity." Wang H., Holloway M.P., Ma L., Cooper Z.A., Riolo M., Samkari A., Elenitoba-Johnson K.S., Chin Y.E., Altura R.A. J. Biol. Chem. 285:36129-36137(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH STAT3 AND XPO1/CRM1, ACETYLATION AT LYS-23; LYS-90; LYS-110; LYS-112; LYS-115; LYS-121 AND LYS-129, MUTAGENESIS OF LYS-129, CHARACTERIZATION OF VARIANT GLU-129. |
| [35] | "Threonine 48 in the BIR domain of survivin is critical to its mitotic and anti-apoptotic activities and can be phosphorylated by CK2 in vitro." Barrett R.M., Colnaghi R., Wheatley S.P. Cell Cycle 10:538-548(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT THR-48, MUTAGENESIS OF THR-48. |
| [36] | "PAR, a protein involved in the cell cycle, is functionally related to chromosomal passenger proteins." Platica M., Ionescu A., Ivan E., Holland J.F., Mandeli J., Platica O. Int. J. Oncol. 38:777-785(2011) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH JTB. |
| [37] | "Survivin monomer plays an essential role in apoptosis regulation." Pavlyukov M.S., Antipova N.V., Balashova M.V., Vinogradova T.V., Kopantzev E.P., Shakhparonov M.I. J. Biol. Chem. 286:23296-23307(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBUNIT, INTERACTION WITH XIAP/BIRC4 AND DIABLO/SMAC. |
| [38] | "Crystal structure of human survivin reveals a bow tie-shaped dimer with two unusual alpha-helical extensions." Chantalat L., Skoufias D.A., Kleman J.P., Jung B., Dideberg O., Margolis R.L. Mol. Cell 6:183-189(2000) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.71 ANGSTROMS) OF ISOFORM 1. |
| [39] | "Structure of the human anti-apoptotic protein survivin reveals a dimeric arrangement." Verdecia M.A., Huang H., Dutil E., Kaiser D.A., Hunter T., Noel J.P. Nat. Struct. Biol. 7:602-608(2000) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.58 ANGSTROMS) OF ISOFORM 1. |
| [40] | "Structure of a Survivin-Borealin-INCENP core complex reveals how chromosomal passengers travel together." Jeyaprakash A.A., Klein U.R., Lindner D., Ebert J., Nigg E.A., Conti E. Cell 131:271-285(2007) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.8 ANGSTROMS) IN COMPLEX WITH ZINC IONS, SUBUNIT, INTERACTION WITH CDCA8 AND INCENP. |
| [41] | "Phosphorylation of a borealin dimerization domain is required for proper chromosome segregation." Bourhis E., Lingel A., Phung Q., Fairbrother W.J., Cochran A.G. Biochemistry 48:6783-6793(2009) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.4 ANGSTROMS). |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U75285 Genomic DNA. Translation: AAC51660.1. AF077350 mRNA. Translation: AAD34226.1. AB154416 mRNA. Translation: BAD11155.1. AY830084 mRNA. Translation: AAW22624.1. AB028869 mRNA. Translation: BAA93676.1. AY927772 mRNA. Translation: AAY15202.1. DQ227257 mRNA. Translation: ABB76601.1. DQ310375 mRNA. Translation: ABC42341.1. DQ310376 mRNA. Translation: ABC42342.1. DQ310377 mRNA. Translation: ABC42343.1. DQ310378 mRNA. Translation: ABC42344.1. DQ310379 mRNA. Translation: ABC42345.1. CR541740 mRNA. Translation: CAG46540.1. AK223428 mRNA. Translation: BAD97148.1. AK311917 mRNA. Translation: BAG34858.1. AY795969 Genomic DNA. Translation: AAV40840.1. AC087645 Genomic DNA. No translation available. CH471099 Genomic DNA. Translation: EAW89514.1. BC008718 mRNA. Translation: AAH08718.1. BC034148 mRNA. Translation: AAH34148.1. BC065497 mRNA. Translation: AAH65497.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00006210. IPI00218095. IPI00735946. IPI00784873. IPI00784916. IPI00784964. IPI00785191. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001012270.1. NM_001012270.1. NP_001012271.1. NM_001012271.1. NP_001159.2. NM_001168.2. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.514527. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | O15392. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMR | O15392. Positions 5-142. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DIP | DIP-34662N. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | O15392. 10 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MINT | MINT-147138. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000301633. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein family/group databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MEROPS | I32.005. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | O15392. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PaxDb | O15392. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | O15392. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DNASU | 332. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000374948; ENSP00000364086; ENSG00000089685. ENST00000590449; ENSP00000465868; ENSG00000089685. ENST00000590925; ENSP00000467336; ENSG00000089685. ENST00000590946; ENSP00000465671; ENSG00000089685. ENST00000592734; ENSP00000466617; ENSG00000089685. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 332. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:332. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc002jvd.1. human. uc002jvg.3. human. uc002jvh.3. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 332. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC17P076210. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:593. BIRC5. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB004270. HPA002830. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 603352. gene. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_O15392. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA25362. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | NOG271140. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG050690. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KO | K08731. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | aurora_a_pathway. Aurora A signaling. aurora_b_pathway. Aurora B signaling. foxm1pathway. FOXM1 transcription factor network. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_115566. Cell Cycle. REACT_21300. Mitotic M-M/G1 phases. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | O15392. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | O15392. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_BIRC5. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | O15392. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000089685. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene3D | 1.10.1170.10. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR001370. BIR. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00653. BIR. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00238. BIR. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS01282. BIR_REPEAT_1. False negative. PS50143. BIR_REPEAT_2. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| BindingDB | O15392. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ChEMBL | CHEMBL5989. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ChiTaRS | BIRC5. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | O15392. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 332. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 1369. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | BIRC5_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O15392 Secondary accession number(s): A2SUH6 Q9P2W8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
