Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Monocarboxylate transporter 6

Gene

SLC16A5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

Proton-linked monocarboxylate transporter. Catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

  • monocarboxylic acid transport Source: ProtInc
  • plasma membrane lactate transport Source: GO_Central
Complete GO annotation...

Keywords - Biological processi

Symport, Transport

Protein family/group databases

TCDBi2.A.1.13.11. the major facilitator superfamily (mfs).

Names & Taxonomyi

Protein namesi
Recommended name:
Monocarboxylate transporter 6
Short name:
MCT 6
Alternative name(s):
Monocarboxylate transporter 5
Short name:
MCT 5
Solute carrier family 16 member 5
Gene namesi
Name:SLC16A5
Synonyms:MCT5, MCT6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:10926. SLC16A5.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 1717CytoplasmicSequence analysisAdd
BLAST
Transmembranei18 – 3821HelicalSequence analysisAdd
BLAST
Topological domaini39 – 5315ExtracellularSequence analysisAdd
BLAST
Transmembranei54 – 7421HelicalSequence analysisAdd
BLAST
Topological domaini75 – 806CytoplasmicSequence analysis
Transmembranei81 – 10121HelicalSequence analysisAdd
BLAST
Topological domaini102 – 1109ExtracellularSequence analysis
Transmembranei111 – 13121HelicalSequence analysisAdd
BLAST
Topological domaini132 – 1376CytoplasmicSequence analysis
Transmembranei138 – 15821HelicalSequence analysisAdd
BLAST
Topological domaini159 – 17113ExtracellularSequence analysisAdd
BLAST
Transmembranei172 – 19221HelicalSequence analysisAdd
BLAST
Topological domaini193 – 23947CytoplasmicSequence analysisAdd
BLAST
Transmembranei240 – 26021HelicalSequence analysisAdd
BLAST
Topological domaini261 – 27414ExtracellularSequence analysisAdd
BLAST
Transmembranei275 – 29521HelicalSequence analysisAdd
BLAST
Topological domaini296 – 30510CytoplasmicSequence analysis
Transmembranei306 – 32621HelicalSequence analysisAdd
BLAST
Topological domaini327 – 3293ExtracellularSequence analysis
Transmembranei330 – 35021HelicalSequence analysisAdd
BLAST
Topological domaini351 – 36717CytoplasmicSequence analysisAdd
BLAST
Transmembranei368 – 38821HelicalSequence analysisAdd
BLAST
Topological domaini389 – 3968ExtracellularSequence analysis
Transmembranei397 – 41721HelicalSequence analysisAdd
BLAST
Topological domaini418 – 50588CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

  • integral component of plasma membrane Source: ProtInc
  • membrane Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA35817.

Chemistry

DrugBankiDB00119. Pyruvic acid.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 505505Monocarboxylate transporter 6PRO_0000211399Add
BLAST

Proteomic databases

MaxQBiO15375.
PaxDbiO15375.
PRIDEiO15375.

PTM databases

iPTMnetiO15375.
PhosphoSiteiO15375.

Expressioni

Tissue specificityi

Highly expressed in kidney.

Gene expression databases

BgeeiO15375.
CleanExiHS_SLC16A5.
ExpressionAtlasiO15375. baseline and differential.
GenevisibleiO15375. HS.

Organism-specific databases

HPAiHPA046944.

Interactioni

Protein-protein interaction databases

BioGridi114569. 1 interaction.
STRINGi9606.ENSP00000330141.

Structurei

3D structure databases

ProteinModelPortaliO15375.
SMRiO15375. Positions 57-84.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG2504. Eukaryota.
COG0477. LUCA.
GeneTreeiENSGT00760000118926.
HOGENOMiHOG000280688.
HOVERGENiHBG006384.
InParanoidiO15375.
KOiK08182.
OMAiEGCWAWV.
PhylomeDBiO15375.
TreeFamiTF313792.

Family and domain databases

InterProiIPR004743. MCT.
IPR030760. MCT6.
IPR011701. MFS.
IPR020846. MFS_dom.
[Graphical view]
PANTHERiPTHR11360:SF21. PTHR11360:SF21. 1 hit.
PfamiPF07690. MFS_1. 1 hit.
[Graphical view]
SUPFAMiSSF103473. SSF103473. 1 hit.
TIGRFAMsiTIGR00892. 2A0113. 1 hit.
PROSITEiPS50850. MFS. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O15375-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPQALERADG SWAWVVLLAT MVTQGLTLGF PTCIGIFFTE LQWEFQASNS
60 70 80 90 100
ETSWFPSILT AVLHMAGPLC SILVGRFGCR VTVMLGGVLA SLGMVASSFS
110 120 130 140 150
HNLSQLYFTA GFITGLGMCF SFQSSITVLG FYFVRRRVLA NALASMGVSL
160 170 180 190 200
GITLWPLLSR YLLENLGWRG TFLVFGGIFL HCCICGAIIR PVATSVAPET
210 220 230 240 250
KECPPPPPET PALGCLAACG RTIQRHLAFD ILRHNTGYCV YILGVMWSVL
260 270 280 290 300
GFPLPQVFLV PYAMWHSVDE QQAALLISII GFSNIFLRPL AGLMAGRPAF
310 320 330 340 350
ASHRKYLFSL ALLLNGLTNL VCAASGDFWV LVGYCLAYSV SMSGIGALIF
360 370 380 390 400
QVLMDIVPMD QFPRALGLFT VLDGLAFLIS PPLAGLLLDA TNNFSYVFYM
410 420 430 440 450
SSFFLISAAL FMGGSFYALQ KKEQGKQAVA ADALERDLFL EAKDGPGKQR
460 470 480 490 500
SPEIMCQSSR QPRPAGVNKH LWGCPASSRT SHEWLLWPKA VLQAKQTALG

WNSPT
Length:505
Mass (Da):54,994
Last modified:January 1, 1998 - v1
Checksum:iE0F7B4BD607D2364
GO
Isoform 2 (identifier: O15375-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MPRPTRGPLATSQGWCPSVTPGTWAAATLAVRPWQRRQQRM
     456-505: CQSSRQPRPAGVNKHLWGCPASSRTSHEWLLWPKAVLQAKQTALGWNSPT → YVTSV

Note: No experimental confirmation available.
Show »
Length:500
Mass (Da):54,449
Checksum:i04108AC8476765C6
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MPRPTRGPLATSQGWCPSVT PGTWAAATLAVRPWQRRQQR M in isoform 2. 1 PublicationVSP_056660
Alternative sequencei456 – 50550CQSSR…WNSPT → YVTSV in isoform 2. 1 PublicationVSP_056661Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U59299 mRNA. Translation: AAC52013.1.
AK304163 mRNA. Translation: BAG65050.1.
AC111186 Genomic DNA. No translation available.
BC009684 mRNA. Translation: AAH09684.1.
BC033611 mRNA. Translation: AAH33611.1.
CCDSiCCDS11713.1. [O15375-1]
RefSeqiNP_001258694.1. NM_001271765.1. [O15375-1]
NP_004686.1. NM_004695.3. [O15375-1]
XP_005257848.1. XM_005257791.2. [O15375-2]
UniGeneiHs.592095.

Genome annotation databases

EnsembliENST00000329783; ENSP00000330141; ENSG00000170190. [O15375-1]
ENST00000450736; ENSP00000390564; ENSG00000170190. [O15375-1]
ENST00000538213; ENSP00000440212; ENSG00000170190. [O15375-2]
ENST00000580123; ENSP00000463434; ENSG00000170190. [O15375-1]
GeneIDi9121.
KEGGihsa:9121.
UCSCiuc002jmr.5. human. [O15375-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U59299 mRNA. Translation: AAC52013.1.
AK304163 mRNA. Translation: BAG65050.1.
AC111186 Genomic DNA. No translation available.
BC009684 mRNA. Translation: AAH09684.1.
BC033611 mRNA. Translation: AAH33611.1.
CCDSiCCDS11713.1. [O15375-1]
RefSeqiNP_001258694.1. NM_001271765.1. [O15375-1]
NP_004686.1. NM_004695.3. [O15375-1]
XP_005257848.1. XM_005257791.2. [O15375-2]
UniGeneiHs.592095.

3D structure databases

ProteinModelPortaliO15375.
SMRiO15375. Positions 57-84.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114569. 1 interaction.
STRINGi9606.ENSP00000330141.

Chemistry

DrugBankiDB00119. Pyruvic acid.

Protein family/group databases

TCDBi2.A.1.13.11. the major facilitator superfamily (mfs).

PTM databases

iPTMnetiO15375.
PhosphoSiteiO15375.

Proteomic databases

MaxQBiO15375.
PaxDbiO15375.
PRIDEiO15375.

Protocols and materials databases

DNASUi9121.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000329783; ENSP00000330141; ENSG00000170190. [O15375-1]
ENST00000450736; ENSP00000390564; ENSG00000170190. [O15375-1]
ENST00000538213; ENSP00000440212; ENSG00000170190. [O15375-2]
ENST00000580123; ENSP00000463434; ENSG00000170190. [O15375-1]
GeneIDi9121.
KEGGihsa:9121.
UCSCiuc002jmr.5. human. [O15375-1]

Organism-specific databases

CTDi9121.
GeneCardsiSLC16A5.
HGNCiHGNC:10926. SLC16A5.
HPAiHPA046944.
MIMi603879. gene.
neXtProtiNX_O15375.
PharmGKBiPA35817.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2504. Eukaryota.
COG0477. LUCA.
GeneTreeiENSGT00760000118926.
HOGENOMiHOG000280688.
HOVERGENiHBG006384.
InParanoidiO15375.
KOiK08182.
OMAiEGCWAWV.
PhylomeDBiO15375.
TreeFamiTF313792.

Miscellaneous databases

GenomeRNAii9121.
NextBioi34183.
PROiO15375.
SOURCEiSearch...

Gene expression databases

BgeeiO15375.
CleanExiHS_SLC16A5.
ExpressionAtlasiO15375. baseline and differential.
GenevisibleiO15375. HS.

Family and domain databases

InterProiIPR004743. MCT.
IPR030760. MCT6.
IPR011701. MFS.
IPR020846. MFS_dom.
[Graphical view]
PANTHERiPTHR11360:SF21. PTHR11360:SF21. 1 hit.
PfamiPF07690. MFS_1. 1 hit.
[Graphical view]
SUPFAMiSSF103473. SSF103473. 1 hit.
TIGRFAMsiTIGR00892. 2A0113. 1 hit.
PROSITEiPS50850. MFS. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and sequencing of four new mammalian monocarboxylate transporter (MCT) homologues confirms the existence of a transporter family with an ancient past."
    Price N.T., Jackson V.N., Halestrap A.P.
    Biochem. J. 329:321-328(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Placenta.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Trachea.
  3. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
    Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
    , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
    Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Blood and Pancreas.

Entry informationi

Entry nameiMOT6_HUMAN
AccessioniPrimary (citable) accession number: O15375
Secondary accession number(s): B4E288
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: January 1, 1998
Last modified: March 16, 2016
This is version 130 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.