Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

O15374 (MOT5_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 111. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Monocarboxylate transporter 5

Short name=MCT 5
Alternative name(s):
Monocarboxylate transporter 4
Short name=MCT 4
Solute carrier family 16 member 4
Gene names
Name:SLC16A4
Synonyms:MCT4, MCT5
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length487 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Proton-linked monocarboxylate transporter. Catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate By similarity.

Subcellular location

Cell membrane; Multi-pass membrane protein.

Sequence similarities

Belongs to the major facilitator superfamily. Monocarboxylate porter (TC 2.A.1.13) family. [View classification]

Ontologies

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: O15374-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: O15374-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: Missing.
     38-73: TKTFAIFFVVFQEEFEGTSEQIGWIGSIMSSLRFCA → DDCDSFFP
Note: No experimental confirmation available.
Isoform 3 (identifier: O15374-3)

The sequence of this isoform differs from the canonical sequence as follows:
     176-343: Missing.
Note: No experimental confirmation available.
Isoform 4 (identifier: O15374-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-120: MLKREGKVQP...PFLCVTMGLL → MGMDDCDSFF
     446-487: GWLYDYTQTY...LAERWKNSLT → EIIPSFQAGY...YHWPKDGKTV
Note: No experimental confirmation available.
Isoform 5 (identifier: O15374-5)

The sequence of this isoform differs from the canonical sequence as follows:
     74-121: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 487487Monocarboxylate transporter 5
PRO_0000211398

Regions

Topological domain1 – 1616Cytoplasmic Potential
Transmembrane17 – 3721Helical; Potential
Topological domain38 – 5922Extracellular Potential
Transmembrane60 – 8021Helical; Potential
Topological domain81 – 877Cytoplasmic Potential
Transmembrane88 – 10821Helical; Potential
Topological domain1091Extracellular Potential
Transmembrane110 – 12920Helical; Potential
Topological domain130 – 14314Cytoplasmic Potential
Transmembrane144 – 16421Helical; Potential
Topological domain165 – 17410Extracellular Potential
Transmembrane175 – 19521Helical; Potential
Topological domain196 – 299104Cytoplasmic Potential
Transmembrane300 – 32021Helical; Potential
Topological domain321 – 33717Extracellular Potential
Transmembrane338 – 35821Helical; Potential
Topological domain359 – 37214Cytoplasmic Potential
Transmembrane373 – 39321Helical; Potential
Topological domain3941Extracellular Potential
Transmembrane395 – 41521Helical; Potential
Topological domain416 – 42510Cytoplasmic Potential
Transmembrane426 – 44621Helical; Potential
Topological domain447 – 45812Extracellular Potential
Transmembrane459 – 47921Helical; Potential
Topological domain480 – 4878Cytoplasmic Potential

Natural variations

Alternative sequence1 – 120120MLKRE…TMGLL → MGMDDCDSFF in isoform 4.
VSP_046456
Alternative sequence1 – 3434Missing in isoform 2.
VSP_046242
Alternative sequence38 – 7336TKTFA…LRFCA → DDCDSFFP in isoform 2.
VSP_046243
Alternative sequence74 – 12148Missing in isoform 5.
VSP_046457
Alternative sequence176 – 343168Missing in isoform 3.
VSP_046244
Alternative sequence446 – 48742GWLYD…KNSLT → EIIPSFQAGYMIIPRHTMAL STSLAYAISSLQFPFFLYHW PKDGKTV in isoform 4.
VSP_046458
Natural variant1851A → T.
Corresponds to variant rs35157487 [ dbSNP | Ensembl ].
VAR_053655
Natural variant2641N → H. Ref.2
Corresponds to variant rs2271885 [ dbSNP | Ensembl ].
VAR_020309

Experimental info

Sequence conflict251I → V in BAF83409. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified January 1, 1998. Version 1.
Checksum: 3CF236C69CC29631

FASTA48754,022
        10         20         30         40         50         60 
MLKREGKVQP YTKTLDGGWG WMIVIHFFLV NVFVMGMTKT FAIFFVVFQE EFEGTSEQIG 

        70         80         90        100        110        120 
WIGSIMSSLR FCAGPLVAII CDILGEKTTS ILGAFVVTGG YLISSWATSI PFLCVTMGLL 

       130        140        150        160        170        180 
PGLGSAFLYQ VAAVVTTKYF KKRLALSTAI ARSGMGLTFL LAPFTKFLID LYDWTGALIL 

       190        200        210        220        230        240 
FGAIALNLVP SSMLLRPIHI KSENNSGIKD KGSSLSAHGP EAHATETHCH ETEESTIKDS 

       250        260        270        280        290        300 
TTQKAGLPSK NLTVSQNQSE EFYNGPNRNR LLLKSDEESD KVISWSCKQL FDISLFRNPF 

       310        320        330        340        350        360 
FYIFTWSFLL SQLAYFIPTF HLVARAKTLG IDIMDASYLV SVAGILETVS QIISGWVADQ 

       370        380        390        400        410        420 
NWIKKYHYHK SYLILCGITN LLAPLATTFP LLMTYTICFA IFAGGYLALI LPVLVDLCRN 

       430        440        450        460        470        480 
STVNRFLGLA SFFAGMAVLS GPPIAGWLYD YTQTYNGSFY FSGICYLLSS VSFFFVPLAE 


RWKNSLT 

« Hide

Isoform 2 [UniParc].

Checksum: 65F0F0C131B01F0F
Show »

FASTA42546,866
Isoform 3 [UniParc].

Checksum: 3B8F0394C218236F
Show »

FASTA31935,362
Isoform 4 [UniParc].

Checksum: 76C55A1F6BE75D4A
Show »

FASTA38242,347
Isoform 5 [UniParc].

Checksum: 7ABA00B613731D36
Show »

FASTA43949,100

References

« Hide 'large scale' references
[1]"Cloning and sequencing of four new mammalian monocarboxylate transporter (MCT) homologues confirms the existence of a transporter family with an ancient past."
Price N.T., Jackson V.N., Halestrap A.P.
Biochem. J. 329:321-328(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Placenta.
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 4 AND 5), VARIANT HIS-264.
Tissue: Lung, Mesangial cell, Placenta and Substantia nigra.
[3]"The DNA sequence and biological annotation of human chromosome 1."
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. expand/collapse author list , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
Tissue: Brain.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
U59185 mRNA. Translation: AAB72035.1.
AK290720 mRNA. Translation: BAF83409.1.
AK295946 mRNA. Translation: BAG58729.1.
AK298539 mRNA. Translation: BAG60739.1.
AK313735 mRNA. Translation: BAG36476.1.
AL355488 Genomic DNA. Translation: CAI19078.1.
AL355488 Genomic DNA. Translation: CAI19079.1.
CH471122 Genomic DNA. Translation: EAW56443.1.
CH471122 Genomic DNA. Translation: EAW56445.1.
CH471122 Genomic DNA. Translation: EAW56446.1.
BC021664 mRNA. Translation: AAH21664.1.
CCDSCCDS55621.1. [O15374-4]
CCDS55622.1. [O15374-2]
CCDS55623.1. [O15374-5]
CCDS55624.1. [O15374-3]
CCDS823.1. [O15374-1]
RefSeqNP_001188475.1. NM_001201546.1. [O15374-5]
NP_001188476.1. NM_001201547.1. [O15374-2]
NP_001188477.1. NM_001201548.1. [O15374-4]
NP_001188478.1. NM_001201549.1. [O15374-3]
NP_004687.1. NM_004696.2. [O15374-1]
XP_005271374.1. XM_005271317.2. [O15374-1]
UniGeneHs.351306.

3D structure databases

ProteinModelPortalO15374.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid114570. 2 interactions.
STRING9606.ENSP00000358794.

Chemistry

DrugBankDB00119. Pyruvic acid.

Protein family/group databases

TCDB2.A.1.13.7. the major facilitator superfamily (mfs).

PTM databases

PhosphoSiteO15374.

Proteomic databases

MaxQBO15374.
PaxDbO15374.
PRIDEO15374.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000369779; ENSP00000358794; ENSG00000168679. [O15374-1]
ENST00000369781; ENSP00000358796; ENSG00000168679. [O15374-3]
ENST00000437429; ENSP00000394790; ENSG00000168679. [O15374-4]
ENST00000472422; ENSP00000432495; ENSG00000168679. [O15374-5]
ENST00000541986; ENSP00000446087; ENSG00000168679. [O15374-2]
GeneID9122.
KEGGhsa:9122.
UCSCuc001dzo.2. human. [O15374-1]
uc001dzp.2. human.
uc009wfs.2. human.
uc010ovy.2. human.

Organism-specific databases

CTD9122.
GeneCardsGC01M110905.
HGNCHGNC:10925. SLC16A4.
HPAHPA046986.
MIM603878. gene.
neXtProtNX_O15374.
PharmGKBPA35816.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG285688.
HOGENOMHOG000059591.
HOVERGENHBG006385.
InParanoidO15374.
KOK08181.
OMAAVVITKY.
OrthoDBEOG7NGQBB.
PhylomeDBO15374.
TreeFamTF313792.

Gene expression databases

ArrayExpressO15374.
BgeeO15374.
CleanExHS_SLC16A4.
GenevestigatorO15374.

Family and domain databases

InterProIPR011701. MFS.
IPR020846. MFS_dom.
IPR016196. MFS_dom_general_subst_transpt.
[Graphical view]
PfamPF07690. MFS_1. 1 hit.
[Graphical view]
SUPFAMSSF103473. SSF103473. 2 hits.
PROSITEPS50850. MFS. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiSLC16A4.
GenomeRNAi9122.
NextBio34189.
PROO15374.
SOURCESearch...

Entry information

Entry nameMOT5_HUMAN
AccessionPrimary (citable) accession number: O15374
Secondary accession number(s): A8K3V5 expand/collapse secondary AC list , B2R9C9, B4DJ67, B4DPX7, E7EPY8, G3V175, Q5T612, Q8WU09
Entry history
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: January 1, 1998
Last modified: July 9, 2014
This is version 111 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 1

Human chromosome 1: entries, gene names and cross-references to MIM