Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O15374

- MOT5_HUMAN

UniProt

O15374 - MOT5_HUMAN

Protein

Monocarboxylate transporter 5

Gene

SLC16A4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 112 (01 Oct 2014)
      Sequence version 1 (01 Jan 1998)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Proton-linked monocarboxylate transporter. Catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate By similarity.By similarity

    GO - Molecular functioni

    1. monocarboxylic acid transmembrane transporter activity Source: ProtInc
    2. symporter activity Source: UniProtKB-KW

    GO - Biological processi

    1. monocarboxylic acid transport Source: ProtInc

    Keywords - Biological processi

    Symport, Transport

    Protein family/group databases

    TCDBi2.A.1.13.7. the major facilitator superfamily (mfs).

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Monocarboxylate transporter 5
    Short name:
    MCT 5
    Alternative name(s):
    Monocarboxylate transporter 4
    Short name:
    MCT 4
    Solute carrier family 16 member 4
    Gene namesi
    Name:SLC16A4
    Synonyms:MCT4, MCT5
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:10925. SLC16A4.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of plasma membrane Source: ProtInc
    2. membrane Source: ProtInc

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA35816.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 487487Monocarboxylate transporter 5PRO_0000211398Add
    BLAST

    Proteomic databases

    MaxQBiO15374.
    PaxDbiO15374.
    PRIDEiO15374.

    PTM databases

    PhosphoSiteiO15374.

    Expressioni

    Gene expression databases

    ArrayExpressiO15374.
    BgeeiO15374.
    CleanExiHS_SLC16A4.
    GenevestigatoriO15374.

    Organism-specific databases

    HPAiHPA046986.

    Interactioni

    Protein-protein interaction databases

    BioGridi114570. 2 interactions.
    STRINGi9606.ENSP00000358794.

    Structurei

    3D structure databases

    ProteinModelPortaliO15374.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 1616CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini38 – 5922ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini81 – 877CytoplasmicSequence Analysis
    Topological domaini109 – 1091ExtracellularSequence Analysis
    Topological domaini130 – 14314CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini165 – 17410ExtracellularSequence Analysis
    Topological domaini196 – 299104CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini321 – 33717ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini359 – 37214CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini394 – 3941ExtracellularSequence Analysis
    Topological domaini416 – 42510CytoplasmicSequence Analysis
    Topological domaini447 – 45812ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini480 – 4878CytoplasmicSequence Analysis

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei17 – 3721HelicalSequence AnalysisAdd
    BLAST
    Transmembranei60 – 8021HelicalSequence AnalysisAdd
    BLAST
    Transmembranei88 – 10821HelicalSequence AnalysisAdd
    BLAST
    Transmembranei110 – 12920HelicalSequence AnalysisAdd
    BLAST
    Transmembranei144 – 16421HelicalSequence AnalysisAdd
    BLAST
    Transmembranei175 – 19521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei300 – 32021HelicalSequence AnalysisAdd
    BLAST
    Transmembranei338 – 35821HelicalSequence AnalysisAdd
    BLAST
    Transmembranei373 – 39321HelicalSequence AnalysisAdd
    BLAST
    Transmembranei395 – 41521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei426 – 44621HelicalSequence AnalysisAdd
    BLAST
    Transmembranei459 – 47921HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG285688.
    HOGENOMiHOG000059591.
    HOVERGENiHBG006385.
    InParanoidiO15374.
    KOiK08181.
    OMAiAVVITKY.
    OrthoDBiEOG7NGQBB.
    PhylomeDBiO15374.
    TreeFamiTF313792.

    Family and domain databases

    InterProiIPR011701. MFS.
    IPR020846. MFS_dom.
    IPR016196. MFS_dom_general_subst_transpt.
    [Graphical view]
    PfamiPF07690. MFS_1. 1 hit.
    [Graphical view]
    SUPFAMiSSF103473. SSF103473. 2 hits.
    PROSITEiPS50850. MFS. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O15374-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MLKREGKVQP YTKTLDGGWG WMIVIHFFLV NVFVMGMTKT FAIFFVVFQE    50
    EFEGTSEQIG WIGSIMSSLR FCAGPLVAII CDILGEKTTS ILGAFVVTGG 100
    YLISSWATSI PFLCVTMGLL PGLGSAFLYQ VAAVVTTKYF KKRLALSTAI 150
    ARSGMGLTFL LAPFTKFLID LYDWTGALIL FGAIALNLVP SSMLLRPIHI 200
    KSENNSGIKD KGSSLSAHGP EAHATETHCH ETEESTIKDS TTQKAGLPSK 250
    NLTVSQNQSE EFYNGPNRNR LLLKSDEESD KVISWSCKQL FDISLFRNPF 300
    FYIFTWSFLL SQLAYFIPTF HLVARAKTLG IDIMDASYLV SVAGILETVS 350
    QIISGWVADQ NWIKKYHYHK SYLILCGITN LLAPLATTFP LLMTYTICFA 400
    IFAGGYLALI LPVLVDLCRN STVNRFLGLA SFFAGMAVLS GPPIAGWLYD 450
    YTQTYNGSFY FSGICYLLSS VSFFFVPLAE RWKNSLT 487
    Length:487
    Mass (Da):54,022
    Last modified:January 1, 1998 - v1
    Checksum:i3CF236C69CC29631
    GO
    Isoform 2 (identifier: O15374-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-34: Missing.
         38-73: TKTFAIFFVVFQEEFEGTSEQIGWIGSIMSSLRFCA → DDCDSFFP

    Note: No experimental confirmation available.

    Show »
    Length:425
    Mass (Da):46,866
    Checksum:i65F0F0C131B01F0F
    GO
    Isoform 3 (identifier: O15374-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         176-343: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:319
    Mass (Da):35,362
    Checksum:i3B8F0394C218236F
    GO
    Isoform 4 (identifier: O15374-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-120: MLKREGKVQP...PFLCVTMGLL → MGMDDCDSFF
         446-487: GWLYDYTQTY...LAERWKNSLT → EIIPSFQAGY...YHWPKDGKTV

    Note: No experimental confirmation available.

    Show »
    Length:382
    Mass (Da):42,347
    Checksum:i76C55A1F6BE75D4A
    GO
    Isoform 5 (identifier: O15374-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         74-121: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:439
    Mass (Da):49,100
    Checksum:i7ABA00B613731D36
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti25 – 251I → V in BAF83409. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti185 – 1851A → T.
    Corresponds to variant rs35157487 [ dbSNP | Ensembl ].
    VAR_053655
    Natural varianti264 – 2641N → H.1 Publication
    Corresponds to variant rs2271885 [ dbSNP | Ensembl ].
    VAR_020309

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 120120MLKRE…TMGLL → MGMDDCDSFF in isoform 4. 1 PublicationVSP_046456Add
    BLAST
    Alternative sequencei1 – 3434Missing in isoform 2. 1 PublicationVSP_046242Add
    BLAST
    Alternative sequencei38 – 7336TKTFA…LRFCA → DDCDSFFP in isoform 2. 1 PublicationVSP_046243Add
    BLAST
    Alternative sequencei74 – 12148Missing in isoform 5. 1 PublicationVSP_046457Add
    BLAST
    Alternative sequencei176 – 343168Missing in isoform 3. 1 PublicationVSP_046244Add
    BLAST
    Alternative sequencei446 – 48742GWLYD…KNSLT → EIIPSFQAGYMIIPRHTMAL STSLAYAISSLQFPFFLYHW PKDGKTV in isoform 4. 1 PublicationVSP_046458Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U59185 mRNA. Translation: AAB72035.1.
    AK290720 mRNA. Translation: BAF83409.1.
    AK295946 mRNA. Translation: BAG58729.1.
    AK298539 mRNA. Translation: BAG60739.1.
    AK313735 mRNA. Translation: BAG36476.1.
    AL355488 Genomic DNA. Translation: CAI19078.1.
    AL355488 Genomic DNA. Translation: CAI19079.1.
    CH471122 Genomic DNA. Translation: EAW56443.1.
    CH471122 Genomic DNA. Translation: EAW56445.1.
    CH471122 Genomic DNA. Translation: EAW56446.1.
    BC021664 mRNA. Translation: AAH21664.1.
    CCDSiCCDS55621.1. [O15374-4]
    CCDS55622.1. [O15374-2]
    CCDS55623.1. [O15374-5]
    CCDS55624.1. [O15374-3]
    CCDS823.1. [O15374-1]
    RefSeqiNP_001188475.1. NM_001201546.1. [O15374-5]
    NP_001188476.1. NM_001201547.1. [O15374-2]
    NP_001188477.1. NM_001201548.1. [O15374-4]
    NP_001188478.1. NM_001201549.1. [O15374-3]
    NP_004687.1. NM_004696.2. [O15374-1]
    XP_005271374.1. XM_005271317.2. [O15374-1]
    UniGeneiHs.351306.

    Genome annotation databases

    EnsembliENST00000369779; ENSP00000358794; ENSG00000168679. [O15374-1]
    ENST00000369781; ENSP00000358796; ENSG00000168679. [O15374-3]
    ENST00000437429; ENSP00000394790; ENSG00000168679. [O15374-4]
    ENST00000472422; ENSP00000432495; ENSG00000168679. [O15374-5]
    ENST00000541986; ENSP00000446087; ENSG00000168679. [O15374-2]
    GeneIDi9122.
    KEGGihsa:9122.
    UCSCiuc001dzo.2. human. [O15374-1]
    uc001dzp.2. human.
    uc009wfs.2. human.
    uc010ovy.2. human.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U59185 mRNA. Translation: AAB72035.1 .
    AK290720 mRNA. Translation: BAF83409.1 .
    AK295946 mRNA. Translation: BAG58729.1 .
    AK298539 mRNA. Translation: BAG60739.1 .
    AK313735 mRNA. Translation: BAG36476.1 .
    AL355488 Genomic DNA. Translation: CAI19078.1 .
    AL355488 Genomic DNA. Translation: CAI19079.1 .
    CH471122 Genomic DNA. Translation: EAW56443.1 .
    CH471122 Genomic DNA. Translation: EAW56445.1 .
    CH471122 Genomic DNA. Translation: EAW56446.1 .
    BC021664 mRNA. Translation: AAH21664.1 .
    CCDSi CCDS55621.1. [O15374-4 ]
    CCDS55622.1. [O15374-2 ]
    CCDS55623.1. [O15374-5 ]
    CCDS55624.1. [O15374-3 ]
    CCDS823.1. [O15374-1 ]
    RefSeqi NP_001188475.1. NM_001201546.1. [O15374-5 ]
    NP_001188476.1. NM_001201547.1. [O15374-2 ]
    NP_001188477.1. NM_001201548.1. [O15374-4 ]
    NP_001188478.1. NM_001201549.1. [O15374-3 ]
    NP_004687.1. NM_004696.2. [O15374-1 ]
    XP_005271374.1. XM_005271317.2. [O15374-1 ]
    UniGenei Hs.351306.

    3D structure databases

    ProteinModelPortali O15374.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 114570. 2 interactions.
    STRINGi 9606.ENSP00000358794.

    Chemistry

    DrugBanki DB00119. Pyruvic acid.

    Protein family/group databases

    TCDBi 2.A.1.13.7. the major facilitator superfamily (mfs).

    PTM databases

    PhosphoSitei O15374.

    Proteomic databases

    MaxQBi O15374.
    PaxDbi O15374.
    PRIDEi O15374.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000369779 ; ENSP00000358794 ; ENSG00000168679 . [O15374-1 ]
    ENST00000369781 ; ENSP00000358796 ; ENSG00000168679 . [O15374-3 ]
    ENST00000437429 ; ENSP00000394790 ; ENSG00000168679 . [O15374-4 ]
    ENST00000472422 ; ENSP00000432495 ; ENSG00000168679 . [O15374-5 ]
    ENST00000541986 ; ENSP00000446087 ; ENSG00000168679 . [O15374-2 ]
    GeneIDi 9122.
    KEGGi hsa:9122.
    UCSCi uc001dzo.2. human. [O15374-1 ]
    uc001dzp.2. human.
    uc009wfs.2. human.
    uc010ovy.2. human.

    Organism-specific databases

    CTDi 9122.
    GeneCardsi GC01M110905.
    HGNCi HGNC:10925. SLC16A4.
    HPAi HPA046986.
    MIMi 603878. gene.
    neXtProti NX_O15374.
    PharmGKBi PA35816.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG285688.
    HOGENOMi HOG000059591.
    HOVERGENi HBG006385.
    InParanoidi O15374.
    KOi K08181.
    OMAi AVVITKY.
    OrthoDBi EOG7NGQBB.
    PhylomeDBi O15374.
    TreeFami TF313792.

    Miscellaneous databases

    GeneWikii SLC16A4.
    GenomeRNAii 9122.
    NextBioi 34189.
    PROi O15374.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O15374.
    Bgeei O15374.
    CleanExi HS_SLC16A4.
    Genevestigatori O15374.

    Family and domain databases

    InterProi IPR011701. MFS.
    IPR020846. MFS_dom.
    IPR016196. MFS_dom_general_subst_transpt.
    [Graphical view ]
    Pfami PF07690. MFS_1. 1 hit.
    [Graphical view ]
    SUPFAMi SSF103473. SSF103473. 2 hits.
    PROSITEi PS50850. MFS. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and sequencing of four new mammalian monocarboxylate transporter (MCT) homologues confirms the existence of a transporter family with an ancient past."
      Price N.T., Jackson V.N., Halestrap A.P.
      Biochem. J. 329:321-328(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Placenta.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 4 AND 5), VARIANT HIS-264.
      Tissue: Lung, Mesangial cell, Placenta and Substantia nigra.
    3. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Brain.

    Entry informationi

    Entry nameiMOT5_HUMAN
    AccessioniPrimary (citable) accession number: O15374
    Secondary accession number(s): A8K3V5
    , B2R9C9, B4DJ67, B4DPX7, E7EPY8, G3V175, Q5T612, Q8WU09
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 30, 2000
    Last sequence update: January 1, 1998
    Last modified: October 1, 2014
    This is version 112 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3