SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O15374

- MOT5_HUMAN

UniProt

O15374 - MOT5_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Monocarboxylate transporter 5
Gene
SLC16A4, MCT4, MCT5
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at transcript leveli

Functioni

Proton-linked monocarboxylate transporter. Catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate By similarity.

GO - Molecular functioni

  1. monocarboxylic acid transmembrane transporter activity Source: ProtInc
  2. symporter activity Source: UniProtKB-KW

GO - Biological processi

  1. monocarboxylic acid transport Source: ProtInc
Complete GO annotation...

Keywords - Biological processi

Symport, Transport

Protein family/group databases

TCDBi2.A.1.13.7. the major facilitator superfamily (mfs).

Names & Taxonomyi

Protein namesi
Recommended name:
Monocarboxylate transporter 5
Short name:
MCT 5
Alternative name(s):
Monocarboxylate transporter 4
Short name:
MCT 4
Solute carrier family 16 member 4
Gene namesi
Name:SLC16A4
Synonyms:MCT4, MCT5
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:10925. SLC16A4.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 1616Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei17 – 3721Helical; Reviewed prediction
Add
BLAST
Topological domaini38 – 5922Extracellular Reviewed prediction
Add
BLAST
Transmembranei60 – 8021Helical; Reviewed prediction
Add
BLAST
Topological domaini81 – 877Cytoplasmic Reviewed prediction
Transmembranei88 – 10821Helical; Reviewed prediction
Add
BLAST
Topological domaini109 – 1091Extracellular Reviewed prediction
Transmembranei110 – 12920Helical; Reviewed prediction
Add
BLAST
Topological domaini130 – 14314Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei144 – 16421Helical; Reviewed prediction
Add
BLAST
Topological domaini165 – 17410Extracellular Reviewed prediction
Transmembranei175 – 19521Helical; Reviewed prediction
Add
BLAST
Topological domaini196 – 299104Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei300 – 32021Helical; Reviewed prediction
Add
BLAST
Topological domaini321 – 33717Extracellular Reviewed prediction
Add
BLAST
Transmembranei338 – 35821Helical; Reviewed prediction
Add
BLAST
Topological domaini359 – 37214Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei373 – 39321Helical; Reviewed prediction
Add
BLAST
Topological domaini394 – 3941Extracellular Reviewed prediction
Transmembranei395 – 41521Helical; Reviewed prediction
Add
BLAST
Topological domaini416 – 42510Cytoplasmic Reviewed prediction
Transmembranei426 – 44621Helical; Reviewed prediction
Add
BLAST
Topological domaini447 – 45812Extracellular Reviewed prediction
Add
BLAST
Transmembranei459 – 47921Helical; Reviewed prediction
Add
BLAST
Topological domaini480 – 4878Cytoplasmic Reviewed prediction

GO - Cellular componenti

  1. integral component of plasma membrane Source: ProtInc
  2. membrane Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA35816.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 487487Monocarboxylate transporter 5
PRO_0000211398Add
BLAST

Proteomic databases

MaxQBiO15374.
PaxDbiO15374.
PRIDEiO15374.

PTM databases

PhosphoSiteiO15374.

Expressioni

Gene expression databases

ArrayExpressiO15374.
BgeeiO15374.
CleanExiHS_SLC16A4.
GenevestigatoriO15374.

Organism-specific databases

HPAiHPA046986.

Interactioni

Protein-protein interaction databases

BioGridi114570. 2 interactions.
STRINGi9606.ENSP00000358794.

Structurei

3D structure databases

ProteinModelPortaliO15374.

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG285688.
HOGENOMiHOG000059591.
HOVERGENiHBG006385.
InParanoidiO15374.
KOiK08181.
OMAiAVVITKY.
OrthoDBiEOG7NGQBB.
PhylomeDBiO15374.
TreeFamiTF313792.

Family and domain databases

InterProiIPR011701. MFS.
IPR020846. MFS_dom.
IPR016196. MFS_dom_general_subst_transpt.
[Graphical view]
PfamiPF07690. MFS_1. 1 hit.
[Graphical view]
SUPFAMiSSF103473. SSF103473. 2 hits.
PROSITEiPS50850. MFS. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O15374-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MLKREGKVQP YTKTLDGGWG WMIVIHFFLV NVFVMGMTKT FAIFFVVFQE    50
EFEGTSEQIG WIGSIMSSLR FCAGPLVAII CDILGEKTTS ILGAFVVTGG 100
YLISSWATSI PFLCVTMGLL PGLGSAFLYQ VAAVVTTKYF KKRLALSTAI 150
ARSGMGLTFL LAPFTKFLID LYDWTGALIL FGAIALNLVP SSMLLRPIHI 200
KSENNSGIKD KGSSLSAHGP EAHATETHCH ETEESTIKDS TTQKAGLPSK 250
NLTVSQNQSE EFYNGPNRNR LLLKSDEESD KVISWSCKQL FDISLFRNPF 300
FYIFTWSFLL SQLAYFIPTF HLVARAKTLG IDIMDASYLV SVAGILETVS 350
QIISGWVADQ NWIKKYHYHK SYLILCGITN LLAPLATTFP LLMTYTICFA 400
IFAGGYLALI LPVLVDLCRN STVNRFLGLA SFFAGMAVLS GPPIAGWLYD 450
YTQTYNGSFY FSGICYLLSS VSFFFVPLAE RWKNSLT 487
Length:487
Mass (Da):54,022
Last modified:January 1, 1998 - v1
Checksum:i3CF236C69CC29631
GO
Isoform 2 (identifier: O15374-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: Missing.
     38-73: TKTFAIFFVVFQEEFEGTSEQIGWIGSIMSSLRFCA → DDCDSFFP

Note: No experimental confirmation available.

Show »
Length:425
Mass (Da):46,866
Checksum:i65F0F0C131B01F0F
GO
Isoform 3 (identifier: O15374-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     176-343: Missing.

Note: No experimental confirmation available.

Show »
Length:319
Mass (Da):35,362
Checksum:i3B8F0394C218236F
GO
Isoform 4 (identifier: O15374-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-120: MLKREGKVQP...PFLCVTMGLL → MGMDDCDSFF
     446-487: GWLYDYTQTY...LAERWKNSLT → EIIPSFQAGY...YHWPKDGKTV

Note: No experimental confirmation available.

Show »
Length:382
Mass (Da):42,347
Checksum:i76C55A1F6BE75D4A
GO
Isoform 5 (identifier: O15374-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     74-121: Missing.

Note: No experimental confirmation available.

Show »
Length:439
Mass (Da):49,100
Checksum:i7ABA00B613731D36
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti185 – 1851A → T.
Corresponds to variant rs35157487 [ dbSNP | Ensembl ].
VAR_053655
Natural varianti264 – 2641N → H.1 Publication
Corresponds to variant rs2271885 [ dbSNP | Ensembl ].
VAR_020309

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 120120MLKRE…TMGLL → MGMDDCDSFF in isoform 4.
VSP_046456Add
BLAST
Alternative sequencei1 – 3434Missing in isoform 2.
VSP_046242Add
BLAST
Alternative sequencei38 – 7336TKTFA…LRFCA → DDCDSFFP in isoform 2.
VSP_046243Add
BLAST
Alternative sequencei74 – 12148Missing in isoform 5.
VSP_046457Add
BLAST
Alternative sequencei176 – 343168Missing in isoform 3.
VSP_046244Add
BLAST
Alternative sequencei446 – 48742GWLYD…KNSLT → EIIPSFQAGYMIIPRHTMAL STSLAYAISSLQFPFFLYHW PKDGKTV in isoform 4.
VSP_046458Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti25 – 251I → V in BAF83409. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U59185 mRNA. Translation: AAB72035.1.
AK290720 mRNA. Translation: BAF83409.1.
AK295946 mRNA. Translation: BAG58729.1.
AK298539 mRNA. Translation: BAG60739.1.
AK313735 mRNA. Translation: BAG36476.1.
AL355488 Genomic DNA. Translation: CAI19078.1.
AL355488 Genomic DNA. Translation: CAI19079.1.
CH471122 Genomic DNA. Translation: EAW56443.1.
CH471122 Genomic DNA. Translation: EAW56445.1.
CH471122 Genomic DNA. Translation: EAW56446.1.
BC021664 mRNA. Translation: AAH21664.1.
CCDSiCCDS55621.1. [O15374-4]
CCDS55622.1. [O15374-2]
CCDS55623.1. [O15374-5]
CCDS55624.1. [O15374-3]
CCDS823.1. [O15374-1]
RefSeqiNP_001188475.1. NM_001201546.1. [O15374-5]
NP_001188476.1. NM_001201547.1. [O15374-2]
NP_001188477.1. NM_001201548.1. [O15374-4]
NP_001188478.1. NM_001201549.1. [O15374-3]
NP_004687.1. NM_004696.2. [O15374-1]
XP_005271374.1. XM_005271317.2. [O15374-1]
UniGeneiHs.351306.

Genome annotation databases

EnsembliENST00000369779; ENSP00000358794; ENSG00000168679. [O15374-1]
ENST00000369781; ENSP00000358796; ENSG00000168679. [O15374-3]
ENST00000437429; ENSP00000394790; ENSG00000168679. [O15374-4]
ENST00000472422; ENSP00000432495; ENSG00000168679. [O15374-5]
ENST00000541986; ENSP00000446087; ENSG00000168679. [O15374-2]
GeneIDi9122.
KEGGihsa:9122.
UCSCiuc001dzo.2. human. [O15374-1]
uc001dzp.2. human.
uc009wfs.2. human.
uc010ovy.2. human.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U59185 mRNA. Translation: AAB72035.1 .
AK290720 mRNA. Translation: BAF83409.1 .
AK295946 mRNA. Translation: BAG58729.1 .
AK298539 mRNA. Translation: BAG60739.1 .
AK313735 mRNA. Translation: BAG36476.1 .
AL355488 Genomic DNA. Translation: CAI19078.1 .
AL355488 Genomic DNA. Translation: CAI19079.1 .
CH471122 Genomic DNA. Translation: EAW56443.1 .
CH471122 Genomic DNA. Translation: EAW56445.1 .
CH471122 Genomic DNA. Translation: EAW56446.1 .
BC021664 mRNA. Translation: AAH21664.1 .
CCDSi CCDS55621.1. [O15374-4 ]
CCDS55622.1. [O15374-2 ]
CCDS55623.1. [O15374-5 ]
CCDS55624.1. [O15374-3 ]
CCDS823.1. [O15374-1 ]
RefSeqi NP_001188475.1. NM_001201546.1. [O15374-5 ]
NP_001188476.1. NM_001201547.1. [O15374-2 ]
NP_001188477.1. NM_001201548.1. [O15374-4 ]
NP_001188478.1. NM_001201549.1. [O15374-3 ]
NP_004687.1. NM_004696.2. [O15374-1 ]
XP_005271374.1. XM_005271317.2. [O15374-1 ]
UniGenei Hs.351306.

3D structure databases

ProteinModelPortali O15374.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 114570. 2 interactions.
STRINGi 9606.ENSP00000358794.

Chemistry

DrugBanki DB00119. Pyruvic acid.

Protein family/group databases

TCDBi 2.A.1.13.7. the major facilitator superfamily (mfs).

PTM databases

PhosphoSitei O15374.

Proteomic databases

MaxQBi O15374.
PaxDbi O15374.
PRIDEi O15374.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000369779 ; ENSP00000358794 ; ENSG00000168679 . [O15374-1 ]
ENST00000369781 ; ENSP00000358796 ; ENSG00000168679 . [O15374-3 ]
ENST00000437429 ; ENSP00000394790 ; ENSG00000168679 . [O15374-4 ]
ENST00000472422 ; ENSP00000432495 ; ENSG00000168679 . [O15374-5 ]
ENST00000541986 ; ENSP00000446087 ; ENSG00000168679 . [O15374-2 ]
GeneIDi 9122.
KEGGi hsa:9122.
UCSCi uc001dzo.2. human. [O15374-1 ]
uc001dzp.2. human.
uc009wfs.2. human.
uc010ovy.2. human.

Organism-specific databases

CTDi 9122.
GeneCardsi GC01M110905.
HGNCi HGNC:10925. SLC16A4.
HPAi HPA046986.
MIMi 603878. gene.
neXtProti NX_O15374.
PharmGKBi PA35816.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG285688.
HOGENOMi HOG000059591.
HOVERGENi HBG006385.
InParanoidi O15374.
KOi K08181.
OMAi AVVITKY.
OrthoDBi EOG7NGQBB.
PhylomeDBi O15374.
TreeFami TF313792.

Miscellaneous databases

GeneWikii SLC16A4.
GenomeRNAii 9122.
NextBioi 34189.
PROi O15374.
SOURCEi Search...

Gene expression databases

ArrayExpressi O15374.
Bgeei O15374.
CleanExi HS_SLC16A4.
Genevestigatori O15374.

Family and domain databases

InterProi IPR011701. MFS.
IPR020846. MFS_dom.
IPR016196. MFS_dom_general_subst_transpt.
[Graphical view ]
Pfami PF07690. MFS_1. 1 hit.
[Graphical view ]
SUPFAMi SSF103473. SSF103473. 2 hits.
PROSITEi PS50850. MFS. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and sequencing of four new mammalian monocarboxylate transporter (MCT) homologues confirms the existence of a transporter family with an ancient past."
    Price N.T., Jackson V.N., Halestrap A.P.
    Biochem. J. 329:321-328(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Placenta.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 4 AND 5), VARIANT HIS-264.
    Tissue: Lung, Mesangial cell, Placenta and Substantia nigra.
  3. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Brain.

Entry informationi

Entry nameiMOT5_HUMAN
AccessioniPrimary (citable) accession number: O15374
Secondary accession number(s): A8K3V5
, B2R9C9, B4DJ67, B4DPX7, E7EPY8, G3V175, Q5T612, Q8WU09
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: January 1, 1998
Last modified: July 9, 2014
This is version 111 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi