Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O15374

- MOT5_HUMAN

UniProt

O15374 - MOT5_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Monocarboxylate transporter 5

Gene

SLC16A4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli

Functioni

Proton-linked monocarboxylate transporter. Catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate (By similarity).By similarity

GO - Molecular functioni

  1. monocarboxylic acid transmembrane transporter activity Source: ProtInc
  2. symporter activity Source: UniProtKB-KW

GO - Biological processi

  1. monocarboxylic acid transport Source: ProtInc
Complete GO annotation...

Keywords - Biological processi

Symport, Transport

Protein family/group databases

TCDBi2.A.1.13.7. the major facilitator superfamily (mfs).

Names & Taxonomyi

Protein namesi
Recommended name:
Monocarboxylate transporter 5
Short name:
MCT 5
Alternative name(s):
Monocarboxylate transporter 4
Short name:
MCT 4
Solute carrier family 16 member 4
Gene namesi
Name:SLC16A4
Synonyms:MCT4, MCT5
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:10925. SLC16A4.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 1616CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei17 – 3721HelicalSequence AnalysisAdd
BLAST
Topological domaini38 – 5922ExtracellularSequence AnalysisAdd
BLAST
Transmembranei60 – 8021HelicalSequence AnalysisAdd
BLAST
Topological domaini81 – 877CytoplasmicSequence Analysis
Transmembranei88 – 10821HelicalSequence AnalysisAdd
BLAST
Topological domaini109 – 1091ExtracellularSequence Analysis
Transmembranei110 – 12920HelicalSequence AnalysisAdd
BLAST
Topological domaini130 – 14314CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei144 – 16421HelicalSequence AnalysisAdd
BLAST
Topological domaini165 – 17410ExtracellularSequence Analysis
Transmembranei175 – 19521HelicalSequence AnalysisAdd
BLAST
Topological domaini196 – 299104CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei300 – 32021HelicalSequence AnalysisAdd
BLAST
Topological domaini321 – 33717ExtracellularSequence AnalysisAdd
BLAST
Transmembranei338 – 35821HelicalSequence AnalysisAdd
BLAST
Topological domaini359 – 37214CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei373 – 39321HelicalSequence AnalysisAdd
BLAST
Topological domaini394 – 3941ExtracellularSequence Analysis
Transmembranei395 – 41521HelicalSequence AnalysisAdd
BLAST
Topological domaini416 – 42510CytoplasmicSequence Analysis
Transmembranei426 – 44621HelicalSequence AnalysisAdd
BLAST
Topological domaini447 – 45812ExtracellularSequence AnalysisAdd
BLAST
Transmembranei459 – 47921HelicalSequence AnalysisAdd
BLAST
Topological domaini480 – 4878CytoplasmicSequence Analysis

GO - Cellular componenti

  1. integral component of plasma membrane Source: ProtInc
  2. membrane Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA35816.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 487487Monocarboxylate transporter 5PRO_0000211398Add
BLAST

Proteomic databases

MaxQBiO15374.
PaxDbiO15374.
PRIDEiO15374.

PTM databases

PhosphoSiteiO15374.

Expressioni

Gene expression databases

BgeeiO15374.
CleanExiHS_SLC16A4.
ExpressionAtlasiO15374. baseline and differential.
GenevestigatoriO15374.

Organism-specific databases

HPAiHPA046986.

Interactioni

Protein-protein interaction databases

BioGridi114570. 2 interactions.
STRINGi9606.ENSP00000358794.

Structurei

3D structure databases

ProteinModelPortaliO15374.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG285688.
GeneTreeiENSGT00760000118926.
HOGENOMiHOG000059591.
HOVERGENiHBG006385.
InParanoidiO15374.
KOiK08181.
OMAiAVVITKY.
OrthoDBiEOG7NGQBB.
PhylomeDBiO15374.
TreeFamiTF313792.

Family and domain databases

InterProiIPR011701. MFS.
IPR020846. MFS_dom.
IPR016196. MFS_dom_general_subst_transpt.
[Graphical view]
PfamiPF07690. MFS_1. 1 hit.
[Graphical view]
SUPFAMiSSF103473. SSF103473. 2 hits.
PROSITEiPS50850. MFS. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O15374-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLKREGKVQP YTKTLDGGWG WMIVIHFFLV NVFVMGMTKT FAIFFVVFQE
60 70 80 90 100
EFEGTSEQIG WIGSIMSSLR FCAGPLVAII CDILGEKTTS ILGAFVVTGG
110 120 130 140 150
YLISSWATSI PFLCVTMGLL PGLGSAFLYQ VAAVVTTKYF KKRLALSTAI
160 170 180 190 200
ARSGMGLTFL LAPFTKFLID LYDWTGALIL FGAIALNLVP SSMLLRPIHI
210 220 230 240 250
KSENNSGIKD KGSSLSAHGP EAHATETHCH ETEESTIKDS TTQKAGLPSK
260 270 280 290 300
NLTVSQNQSE EFYNGPNRNR LLLKSDEESD KVISWSCKQL FDISLFRNPF
310 320 330 340 350
FYIFTWSFLL SQLAYFIPTF HLVARAKTLG IDIMDASYLV SVAGILETVS
360 370 380 390 400
QIISGWVADQ NWIKKYHYHK SYLILCGITN LLAPLATTFP LLMTYTICFA
410 420 430 440 450
IFAGGYLALI LPVLVDLCRN STVNRFLGLA SFFAGMAVLS GPPIAGWLYD
460 470 480
YTQTYNGSFY FSGICYLLSS VSFFFVPLAE RWKNSLT
Length:487
Mass (Da):54,022
Last modified:January 1, 1998 - v1
Checksum:i3CF236C69CC29631
GO
Isoform 2 (identifier: O15374-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: Missing.
     38-73: TKTFAIFFVVFQEEFEGTSEQIGWIGSIMSSLRFCA → DDCDSFFP

Note: No experimental confirmation available.

Show »
Length:425
Mass (Da):46,866
Checksum:i65F0F0C131B01F0F
GO
Isoform 3 (identifier: O15374-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     176-343: Missing.

Note: No experimental confirmation available.

Show »
Length:319
Mass (Da):35,362
Checksum:i3B8F0394C218236F
GO
Isoform 4 (identifier: O15374-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-120: MLKREGKVQP...PFLCVTMGLL → MGMDDCDSFF
     446-487: GWLYDYTQTY...LAERWKNSLT → EIIPSFQAGY...YHWPKDGKTV

Note: No experimental confirmation available.

Show »
Length:382
Mass (Da):42,347
Checksum:i76C55A1F6BE75D4A
GO
Isoform 5 (identifier: O15374-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     74-121: Missing.

Note: No experimental confirmation available.

Show »
Length:439
Mass (Da):49,100
Checksum:i7ABA00B613731D36
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti25 – 251I → V in BAF83409. (PubMed:14702039)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti185 – 1851A → T.
Corresponds to variant rs35157487 [ dbSNP | Ensembl ].
VAR_053655
Natural varianti264 – 2641N → H.1 Publication
Corresponds to variant rs2271885 [ dbSNP | Ensembl ].
VAR_020309

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 120120MLKRE…TMGLL → MGMDDCDSFF in isoform 4. 1 PublicationVSP_046456Add
BLAST
Alternative sequencei1 – 3434Missing in isoform 2. 1 PublicationVSP_046242Add
BLAST
Alternative sequencei38 – 7336TKTFA…LRFCA → DDCDSFFP in isoform 2. 1 PublicationVSP_046243Add
BLAST
Alternative sequencei74 – 12148Missing in isoform 5. 1 PublicationVSP_046457Add
BLAST
Alternative sequencei176 – 343168Missing in isoform 3. 1 PublicationVSP_046244Add
BLAST
Alternative sequencei446 – 48742GWLYD…KNSLT → EIIPSFQAGYMIIPRHTMAL STSLAYAISSLQFPFFLYHW PKDGKTV in isoform 4. 1 PublicationVSP_046458Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U59185 mRNA. Translation: AAB72035.1.
AK290720 mRNA. Translation: BAF83409.1.
AK295946 mRNA. Translation: BAG58729.1.
AK298539 mRNA. Translation: BAG60739.1.
AK313735 mRNA. Translation: BAG36476.1.
AL355488 Genomic DNA. Translation: CAI19078.1.
AL355488 Genomic DNA. Translation: CAI19079.1.
CH471122 Genomic DNA. Translation: EAW56443.1.
CH471122 Genomic DNA. Translation: EAW56445.1.
CH471122 Genomic DNA. Translation: EAW56446.1.
BC021664 mRNA. Translation: AAH21664.1.
CCDSiCCDS55621.1. [O15374-4]
CCDS55622.1. [O15374-2]
CCDS55623.1. [O15374-5]
CCDS55624.1. [O15374-3]
CCDS823.1. [O15374-1]
RefSeqiNP_001188475.1. NM_001201546.1. [O15374-5]
NP_001188476.1. NM_001201547.1. [O15374-2]
NP_001188477.1. NM_001201548.1. [O15374-4]
NP_001188478.1. NM_001201549.1. [O15374-3]
NP_004687.1. NM_004696.2. [O15374-1]
XP_005271374.1. XM_005271317.2. [O15374-1]
UniGeneiHs.351306.

Genome annotation databases

EnsembliENST00000369779; ENSP00000358794; ENSG00000168679. [O15374-1]
ENST00000369781; ENSP00000358796; ENSG00000168679. [O15374-3]
ENST00000437429; ENSP00000394790; ENSG00000168679. [O15374-4]
ENST00000472422; ENSP00000432495; ENSG00000168679. [O15374-5]
ENST00000541986; ENSP00000446087; ENSG00000168679. [O15374-2]
GeneIDi9122.
KEGGihsa:9122.
UCSCiuc001dzo.2. human. [O15374-1]
uc001dzp.2. human.
uc009wfs.2. human.
uc010ovy.2. human.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U59185 mRNA. Translation: AAB72035.1 .
AK290720 mRNA. Translation: BAF83409.1 .
AK295946 mRNA. Translation: BAG58729.1 .
AK298539 mRNA. Translation: BAG60739.1 .
AK313735 mRNA. Translation: BAG36476.1 .
AL355488 Genomic DNA. Translation: CAI19078.1 .
AL355488 Genomic DNA. Translation: CAI19079.1 .
CH471122 Genomic DNA. Translation: EAW56443.1 .
CH471122 Genomic DNA. Translation: EAW56445.1 .
CH471122 Genomic DNA. Translation: EAW56446.1 .
BC021664 mRNA. Translation: AAH21664.1 .
CCDSi CCDS55621.1. [O15374-4 ]
CCDS55622.1. [O15374-2 ]
CCDS55623.1. [O15374-5 ]
CCDS55624.1. [O15374-3 ]
CCDS823.1. [O15374-1 ]
RefSeqi NP_001188475.1. NM_001201546.1. [O15374-5 ]
NP_001188476.1. NM_001201547.1. [O15374-2 ]
NP_001188477.1. NM_001201548.1. [O15374-4 ]
NP_001188478.1. NM_001201549.1. [O15374-3 ]
NP_004687.1. NM_004696.2. [O15374-1 ]
XP_005271374.1. XM_005271317.2. [O15374-1 ]
UniGenei Hs.351306.

3D structure databases

ProteinModelPortali O15374.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 114570. 2 interactions.
STRINGi 9606.ENSP00000358794.

Chemistry

DrugBanki DB00119. Pyruvic acid.

Protein family/group databases

TCDBi 2.A.1.13.7. the major facilitator superfamily (mfs).

PTM databases

PhosphoSitei O15374.

Proteomic databases

MaxQBi O15374.
PaxDbi O15374.
PRIDEi O15374.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000369779 ; ENSP00000358794 ; ENSG00000168679 . [O15374-1 ]
ENST00000369781 ; ENSP00000358796 ; ENSG00000168679 . [O15374-3 ]
ENST00000437429 ; ENSP00000394790 ; ENSG00000168679 . [O15374-4 ]
ENST00000472422 ; ENSP00000432495 ; ENSG00000168679 . [O15374-5 ]
ENST00000541986 ; ENSP00000446087 ; ENSG00000168679 . [O15374-2 ]
GeneIDi 9122.
KEGGi hsa:9122.
UCSCi uc001dzo.2. human. [O15374-1 ]
uc001dzp.2. human.
uc009wfs.2. human.
uc010ovy.2. human.

Organism-specific databases

CTDi 9122.
GeneCardsi GC01M110905.
HGNCi HGNC:10925. SLC16A4.
HPAi HPA046986.
MIMi 603878. gene.
neXtProti NX_O15374.
PharmGKBi PA35816.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG285688.
GeneTreei ENSGT00760000118926.
HOGENOMi HOG000059591.
HOVERGENi HBG006385.
InParanoidi O15374.
KOi K08181.
OMAi AVVITKY.
OrthoDBi EOG7NGQBB.
PhylomeDBi O15374.
TreeFami TF313792.

Miscellaneous databases

GeneWikii SLC16A4.
GenomeRNAii 9122.
NextBioi 34189.
PROi O15374.
SOURCEi Search...

Gene expression databases

Bgeei O15374.
CleanExi HS_SLC16A4.
ExpressionAtlasi O15374. baseline and differential.
Genevestigatori O15374.

Family and domain databases

InterProi IPR011701. MFS.
IPR020846. MFS_dom.
IPR016196. MFS_dom_general_subst_transpt.
[Graphical view ]
Pfami PF07690. MFS_1. 1 hit.
[Graphical view ]
SUPFAMi SSF103473. SSF103473. 2 hits.
PROSITEi PS50850. MFS. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and sequencing of four new mammalian monocarboxylate transporter (MCT) homologues confirms the existence of a transporter family with an ancient past."
    Price N.T., Jackson V.N., Halestrap A.P.
    Biochem. J. 329:321-328(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Placenta.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 4 AND 5), VARIANT HIS-264.
    Tissue: Lung, Mesangial cell, Placenta and Substantia nigra.
  3. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Brain.

Entry informationi

Entry nameiMOT5_HUMAN
AccessioniPrimary (citable) accession number: O15374
Secondary accession number(s): A8K3V5
, B2R9C9, B4DJ67, B4DPX7, E7EPY8, G3V175, Q5T612, Q8WU09
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: January 1, 1998
Last modified: October 29, 2014
This is version 113 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3