O15350 (P73_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 139.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Tumor protein p73 Alternative name(s): p53-like transcription factor p53-related protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 636 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Participates in the apoptotic response to DNA damage. Isoforms containing the transactivation domain are pro-apoptotic, isoforms lacking the domain are anti-apoptotic and block the function of p53 and transactivating p73 isoforms. May be a tumor suppressor protein. Ref.6 Ref.14 Ref.23 |
| Cofactor | Binds 1 zinc ion per subunit By similarity. |
| Subunit structure | Found in a complex with p53/TP53 and CABLES1. The C-terminal oligomerization domain binds to the ABL1 tyrosine kinase SH3 domain. Interacts with HECW2. Isoform Beta interacts homotypically and with p53/TP53, whereas isoform Alpha does not. Isoform Gamma interacts homotypically and with all p73 isoforms. Isoform Delta interacts with isoform Gamma, isoform Alpha, and homotypically. Isoforms Alpha and Beta interact with HIPK2. Isoform Alpha interacts with RANBP9. Isoform Beta interacts with WWOX. Interacts (via SAM domain) with FBXO45 (via B30.2/SPRY domain). Interacts with YAP1 (phosphorylated form). Interacts with HCK (via SH3 domain); this inhibits TP73 activity and degradation. Ref.12 Ref.17 Ref.18 Ref.19 Ref.20 Ref.24 Ref.25 Ref.27 |
| Subcellular location | Nucleus. Cytoplasm. Note: Accumulates in the nucleus in response to DNA damage. Ref.20 Ref.24 |
| Tissue specificity | Expressed in striatal neurons of patients with Huntington disease (at protein level). Brain, kidney, placenta, colon, heart, liver, spleen, skeletal muscle, prostate, thymus and pancreas. Highly expressed in fetal tissue. Ref.6 Ref.21 |
| Induction | Not induced by DNA damage. Isoforms lacking the transactivation domain block gene induction. Ref.6 |
| Domain | Possesses an acidic transactivation domain, a central DNA binding domain and a C-terminal oligomerization domain that binds to the ABL1 tyrosine kinase SH3 domain. Ref.19 The WW-binding motif mediates interaction with WWOX. Ref.19 |
| Post-translational modification | Isoform alpha (but not isoform beta) is sumoylated on Lys-627, which potentiates proteasomal degradation but does not affect transcriptional activity. Phosphorylation by PLK1 and PLK3 inhibits the transcription regulator activity and pro-apoptotic function. Ref.15 Higher levels of phosphorylation seen in the brain from patients with Huntington disease. Ubiquitinated; leading to its degradation by the proteasome. Ref.27 |
| Miscellaneous | Maps to a chromosome region frequently mutated in diverse cell lines of human cancer. Appears not to be frequently mutated in human cancers, in contrast to p53. Hemizygosity is observed in neuroblastoma and oligodendroglioma. Activated and stabilized by interaction with RANBP9. |
| Sequence similarities | Belongs to the p53 family. Contains 1 SAM (sterile alpha motif) domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| Cables1 | Q9ESJ1 | 3 | EBI-389606,EBI-604411 | From a different organism. |
| E6 | P03126 | 2 | EBI-389619,EBI-1177242 | From a different organism. |
Alternative products
| This entry describes 9 isoforms produced by alternative promoter usage and alternative splicing. [Align] [Select] | ||||||
| Isoform Alpha (identifier: O15350-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Beta (identifier: O15350-2) The sequence of this isoform differs from the canonical sequence as follows: 495-636: SFLTGLGCPN...KEEFTEAEIH → RTWGP | ||||||
| Note: Produced by alternative splicing of isoform Alpha. | ||||||
| Isoform Gamma (identifier: O15350-3) The sequence of this isoform differs from the canonical sequence as follows: 400-476: SHLQPPSYGP...SSSHSAQSMV → PRDAQQPWPR...EHLPPAEPDH 477-636: Missing. | ||||||
| Note: Produced by alternative splicing of isoform Alpha. The splicing of exon 11 results in a frameshift from the original reading frame. | ||||||
| Isoform Delta (identifier: O15350-4) The sequence of this isoform differs from the canonical sequence as follows: 400-403: SHLQ → TWGP 404-636: Missing. | ||||||
| Note: Produced by alternative splicing of isoform Alpha. | ||||||
| Isoform Epsilon (identifier: O15350-5) The sequence of this isoform differs from the canonical sequence as follows: 400-445: SHLQPPSYGP...PHSSAATPNL → PRDAQQPWPR...TPLPRRPQPR 446-526: Missing. | ||||||
| Note: Produced by alternative splicing of isoform Alpha. The splicing of exon 11 results in a frameshift from the original reading frame. The splicing of exon 13 reverts the reading frame to the sequence of isoform Alpha. | ||||||
| Isoform Zeta (identifier: O15350-6) The sequence of this isoform differs from the canonical sequence as follows: 400-495: Missing. | ||||||
| Note: Produced by alternative splicing of isoform Alpha. | ||||||
| Isoform dN-Alpha (identifier: O15350-8) The sequence of this isoform differs from the canonical sequence as follows: 1-62: MAQSTATSPDGGTTFEHLWSSLEPDSTYFDLPQSSRGNNEVVGGTDSSMDVFHLEGMTTSVM → MLYVGDPARHLAT | ||||||
| Note: Produced by alternative promoter usage. | ||||||
| Isoform dN-Beta (identifier: O15350-9) The sequence of this isoform differs from the canonical sequence as follows: 1-62: MAQSTATSPDGGTTFEHLWSSLEPDSTYFDLPQSSRGNNEVVGGTDSSMDVFHLEGMTTSVM → MLYVGDPARHLAT 495-636: SFLTGLGCPN...KEEFTEAEIH → RTWGP | ||||||
| Note: Produced by alternative splicing of isoform dN-Alpha. | ||||||
| Isoform dN-Gamma (identifier: O15350-10) The sequence of this isoform differs from the canonical sequence as follows: 1-62: MAQSTATSPDGGTTFEHLWSSLEPDSTYFDLPQSSRGNNEVVGGTDSSMDVFHLEGMTTSVM → MLYVGDPARHLAT 400-476: SHLQPPSYGP...SSSHSAQSMV → PRDAQQPWPR...EHLPPAEPDH 477-636: Missing. | ||||||
| Note: Produced by alternative splicing of isoform dN-Alpha. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||
Molecule processing | |||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 636 | 636 | Tumor protein p73 | PRO_0000185728 | |||||||||||||||||
Regions | |||||||||||||||||||||
| Domain | 485 – 551 | 67 | SAM | ||||||||||||||||||
| Region | 1 – 46 | 46 | Transactivation By similarity | ||||||||||||||||||
| Region | 131 – 310 | 180 | DNA-binding Potential | ||||||||||||||||||
| Region | 345 – 386 | 42 | Oligomerization Potential | ||||||||||||||||||
| Region | 345 – 380 | 36 | Interaction with HIPK2 | ||||||||||||||||||
| Motif | 483 – 487 | 5 | WW-binding | ||||||||||||||||||
| Compositional bias | 1 – 55 | 55 | Asp/Glu-rich (acidic) | ||||||||||||||||||
| Compositional bias | 168 – 171 | 4 | Poly-Pro | ||||||||||||||||||
| Compositional bias | 391 – 394 | 4 | Poly-Gln | ||||||||||||||||||
| Compositional bias | 483 – 486 | 4 | Poly-Pro | ||||||||||||||||||
Sites | |||||||||||||||||||||
| Metal binding | 194 | 1 | Zinc By similarity | ||||||||||||||||||
| Metal binding | 197 | 1 | Zinc By similarity | ||||||||||||||||||
| Metal binding | 258 | 1 | Zinc By similarity | ||||||||||||||||||
| Metal binding | 262 | 1 | Zinc By similarity | ||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||
| Modified residue | 27 | 1 | Phosphothreonine; by PLK1 Ref.22 Ref.23 | ||||||||||||||||||
| Modified residue | 28 | 1 | Phosphotyrosine; by SRC and HCK Ref.24 | ||||||||||||||||||
| Modified residue | 99 | 1 | Phosphotyrosine; by ABL1 Ref.12 | ||||||||||||||||||
| Cross-link | 627 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO); in isoform Alpha Ref.15 | |||||||||||||||||||
Natural variations | |||||||||||||||||||||
| Alternative sequence | 1 – 62 | 62 | MAQST…TTSVM → MLYVGDPARHLAT in isoform dN-Alpha, isoform dN-Beta and isoform dN-Gamma. | VSP_014368 | |||||||||||||||||
| Alternative sequence | 400 – 495 | 96 | Missing in isoform Zeta. | VSP_006546 | |||||||||||||||||
| Alternative sequence | 400 – 476 | 77 | SHLQP…AQSMV → PRDAQQPWPRSASQQRRDEQ QPQRPVHGLGVPLHSATPLP RRPQPRQFFNRIGVSKLHRV FHLPRVTEHLPPAEPDH in isoform Gamma and isoform dN-Gamma. | VSP_006540 | |||||||||||||||||
| Alternative sequence | 400 – 445 | 46 | SHLQP…ATPNL → PRDAQQPWPRSASQQRRDEQ QPQRPVHGLGVPLHSATPLP RRPQPR in isoform Epsilon. | VSP_006544 | |||||||||||||||||
| Alternative sequence | 400 – 403 | 4 | SHLQ → TWGP in isoform Delta. | VSP_006542 | |||||||||||||||||
| Alternative sequence | 404 – 636 | 233 | Missing in isoform Delta. | VSP_006543 | |||||||||||||||||
| Alternative sequence | 446 – 526 | 81 | Missing in isoform Epsilon. | VSP_006545 | |||||||||||||||||
| Alternative sequence | 477 – 636 | 160 | Missing in isoform Gamma and isoform dN-Gamma. | VSP_006541 | |||||||||||||||||
| Alternative sequence | 495 – 636 | 142 | SFLTG…EAEIH → RTWGP in isoform Beta and isoform dN-Beta. | VSP_006539 | |||||||||||||||||
Experimental info | |||||||||||||||||||||
| Mutagenesis | 27 | 1 | T → A: Impaired phosphorylation. Ref.23 | ||||||||||||||||||
| Mutagenesis | 99 | 1 | Y → F: Impaired phosphorylation of isoform beta by ABL1. Ref.12 | ||||||||||||||||||
| Mutagenesis | 487 | 1 | Y → A: Loss of interaction with WWOX. Ref.19 | ||||||||||||||||||
| Mutagenesis | 627 | 1 | K → R: Strongly diminishes sumoylation but does not affect transcriptional activity. Ref.15 | ||||||||||||||||||
Secondary structure | |||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||
| Helix | 493 – 499 | 7 | |||||||||||||||||||
| Helix | 506 – 510 | 5 | |||||||||||||||||||
| Turn | 511 – 513 | 3 | |||||||||||||||||||
| Helix | 517 – 521 | 5 | |||||||||||||||||||
| Helix | 525 – 530 | 6 | |||||||||||||||||||
| Turn | 535 – 537 | 3 | |||||||||||||||||||
| Helix | 538 – 547 | 10 | |||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Monoallelically expressed gene related to p53 at 1p36, a region frequently deleted in neuroblastoma and other human cancers." Kaghad M., Bonnet H., Yang A., Creancier L., Biscan J.-C., Valent A., Minty A., Chalon P., Lelias J.-M., Dumont X., Ferrara P., McKeon F., Caput D. Cell 90:809-819(1997) [PubMed: 9288759] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ALPHA AND BETA). Tissue: Colon. |
| [2] | "Genomic organization and mutation analysis of p73 in oligodendrogliomas with chromosome 1 p-arm deletions." Mai M., Huang H., Reed C., Qian C., Smith J.S., Alderete B., Jenkins R., Smith D.I., Liu W. Genomics 51:359-363(1998) [PubMed: 9721206] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM ALPHA). |
| [3] | "Two new p73 splice variants, gamma and delta, with different transcriptional activity." De Laurenzi V., Costanzo A., Barcaroli D., Terrinoni A., Falco M., Annicchiarico-Petruzzelli M., Levrero M., Melino G. J. Exp. Med. 188:1763-1768(1998) [PubMed: 9802988] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS GAMMA AND DELTA). Tissue: Neuroblastoma. |
| [4] | "Additional complexity in p73: induction by mitogens in lymphoid cells and identification of two new splicing variants epsilon and zeta." De Laurenzi V., Catani M.V., Terrinoni A., Corazzari M., Melino G., Costanzo A., Levrero M., Knight R.A. Cell Death Differ. 6:389-390(1999) [PubMed: 10381648] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS EPSILON AND ZETA). Tissue: Hepatoma, Lymphocyte, Mammary cancer and Skin. |
| [5] | "Mutational analysis of p73 and p53 in human cancer cell lines." Yoshikawa H., Nagashima M., Khan M.A., McMenamin M.G., Hagiwara K., Harris C.C. Oncogene 18:3415-3421(1999) [PubMed: 10362363] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM ALPHA). |
| [6] | "Human DeltaNp73 regulates a dominant negative feedback loop for TAp73 and p53." Grob T.J., Novak U., Maisse C., Barcaroli D., Luthi A.U., Pirnia F., Hugli B., Graber H.U., De Laurenzi V., Fey M.F., Melino G., Tobler A. Cell Death Differ. 8:1213-1223(2001) [PubMed: 11753569] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS DN-ALPHA; DN-BETA AND DN-GAMMA), FUNCTION, TISSUE SPECIFICITY, INDUCTION. |
| [7] | "Identification of the p73-specific target sequence present in the deltaNp73 proper promoter." Nakagawa T., Takahashi M., Ozaki T., Watanabe K., Nakagawara A. Submitted (JAN-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS DN-ALPHA AND DN-BETA). |
| [8] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM DN-ALPHA). Tissue: Uterus. |
| [9] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed: 16710414] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [10] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [11] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM ALPHA). Tissue: Colon. |
| [12] | "p73 is regulated by tyrosine kinase c-Abl in the apoptotic response to DNA damage." Yuan Z.-M., Shioya H., Ishiko T., Sun X., Gu J., Huang Y., Lu H., Kharbanda S., Weichselbaum R., Kufe D. Nature 399:814-817(1999) [PubMed: 10391251] [Abstract] Cited for: INTERACTION WITH ABL1, PHOSPHORYLATION AT TYR-99 BY ABL1, MUTAGENESIS OF TYR-99. |
| [13] | Erratum Yuan Z.-M., Shioya H., Ishiko T., Sun X., Gu J., Huang Y., Lu H., Kharbanda S., Weichselbaum R., Kufe D. Nature 400:792-792(1999) |
| [14] | "The emerging p53 gene family." Kaelin W.G. Jr. J. Natl. Cancer Inst. 91:594-598(1999) [PubMed: 10203277] [Abstract] Cited for: FUNCTION. |
| [15] | "Covalent modification of p73alpha by SUMO-1. Two-hybrid screening with p73 identifies novel SUMO-1-interacting proteins and a SUMO-1 interaction motif." Minty A., Dumont X., Kaghad M., Caput D. J. Biol. Chem. 275:36316-36323(2000) [PubMed: 10961991] [Abstract] Cited for: SUMOYLATION AT LYS-627, MUTAGENESIS OF LYS-627. |
| [16] | "Differential effect of ik3-1/cables on p53- and p73-induced cell death." Tsuji K., Mizumoto K., Yamochi T., Nishimoto I., Matsuoka M. J. Biol. Chem. 277:2951-2957(2002) [PubMed: 11706030] [Abstract] Cited for: IDENTIFICATION IN A COMPLEX WITH CABLES1 AND TP53. |
| [17] | "Identification and characterization of HIPK2 interacting with p73 and modulating functions of the p53 family in vivo." Kim E.-J., Park J.-S., Um S.-J. J. Biol. Chem. 277:32020-32028(2002) [PubMed: 11925430] [Abstract] Cited for: INTERACTION WITH HIPK2. |
| [18] | "A novel HECT-type E3 ubiquitin ligase, NEDL2, stabilizes p73 and enhances its transcriptional activity." Miyazaki K., Ozaki T., Kato C., Hanamoto T., Fujita T., Irino S., Watanabe K., Nakagawa T., Nakagawara A. Biochem. Biophys. Res. Commun. 308:106-113(2003) [PubMed: 12890487] [Abstract] Cited for: INTERACTION WITH HECW2. |
| [19] | "Functional association between Wwox tumor suppressor protein and p73, a p53 homolog." Aqeilan R.I., Pekarsky Y., Herrero J.J., Palamarchuk A., Letofsky J., Druck T., Trapasso F., Han S.-Y., Melino G., Huebner K., Croce C.M. Proc. Natl. Acad. Sci. U.S.A. 101:4401-4406(2004) [PubMed: 15070730] [Abstract] Cited for: INTERACTION WITH WWOX, DOMAIN, MUTAGENESIS OF TYR-487. |
| [20] | "Protein stability and function of p73 are modulated by a physical interaction with RanBPM in mammalian cultured cells." Kramer S., Ozaki T., Miyazaki K., Kato C., Hanamoto T., Nakagawara A. Oncogene 24:938-944(2005) [PubMed: 15558019] [Abstract] Cited for: INTERACTION WITH RANBP9, SUBCELLULAR LOCATION. |
| [21] | "Transcriptional repression induces a slowly progressive atypical neuronal death associated with changes of YAP isoforms and p73." Hoshino M., Qi M.-L., Yoshimura N., Tagawa K., Wada Y.-I., Enokido Y., Marubuchi S., Harjes P., Arai N., Oyanagi K., Blandino G., Sudol M., Rich T., Kanazawa I., Wanker E.E., Saitoe M., Okazawa H. J. Cell Biol. 172:589-604(2006) [PubMed: 16461361] [Abstract] Cited for: PHOSPHORYLATION, TISSUE SPECIFICITY. |
| [22] | "p73-mediated transcriptional activity is negatively regulated by polo-like kinase 1." Soond S.M., Barry S.P., Melino G., Knight R.A., Latchman D.S., Stephanou A. Cell Cycle 7:1214-1223(2008) [PubMed: 18418051] [Abstract] Cited for: PHOSPHORYLATION AT THR-27. |
| [23] | "Inhibitory role of Plk1 in the regulation of p73-dependent apoptosis through physical interaction and phosphorylation." Koida N., Ozaki T., Yamamoto H., Ono S., Koda T., Ando K., Okoshi R., Kamijo T., Omura K., Nakagawara A. J. Biol. Chem. 283:8555-8563(2008) [PubMed: 18174154] [Abstract] Cited for: FUNCTION, PHOSPHORYLATION AT THR-27, MUTAGENESIS OF THR-27. |
| [24] | "Regulation of p73 by Hck through kinase-dependent and independent mechanisms." Paliwal P., Radha V., Swarup G. BMC Mol. Biol. 8:45-45(2007) [PubMed: 17535448] [Abstract] Cited for: PHOSPHORYLATION AT TYR-28, SUBCELLULAR LOCATION, INTERACTION WITH HCK. |
| [25] | "Yap1 phosphorylation by c-Abl is a critical step in selective activation of proapoptotic genes in response to DNA damage." Levy D., Adamovich Y., Reuven N., Shaul Y. Mol. Cell 29:350-361(2008) [PubMed: 18280240] [Abstract] Cited for: INTERACTION WITH YAP1. |
| [26] | "Plk3 inhibits pro-apoptotic activity of p73 through physical interaction and phosphorylation." Sang M., Ando K., Okoshi R., Koida N., Li Y., Zhu Y., Shimozato O., Geng C., Shan B., Nakagawara A., Ozaki T. Genes Cells 14:775-788(2009) [PubMed: 19490146] [Abstract] Cited for: PHOSPHORYLATION BY PLK3. |
| [27] | "The F-box protein FBXO45 promotes the proteasome-dependent degradation of p73." Peschiaroli A., Scialpi F., Bernassola F., Pagano M., Melino G. Oncogene 28:3157-3166(2009) [PubMed: 19581926] [Abstract] Cited for: INTERACTION WITH FBXO45, UBIQUITINATION. |
| [28] | "Solution structure of a conserved C-terminal domain of p73 with structural homology to the SAM domain." Chi S.W., Ayed A., Arrowsmith C.H. EMBO J. 18:4438-4445(1999) [PubMed: 10449409] [Abstract] Cited for: STRUCTURE BY NMR OF 487-554. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | Y11416 mRNA. Translation: CAA72220.1. Y11416 mRNA. Translation: CAA72221.1. Y11416 mRNA. Translation: CAA72219.1. AF079094 AF079093 Genomic DNA. Translation: AAD39696.1.AF077628 AF077627 Genomic DNA. Translation: AAC61887.1.AY040827 mRNA. Translation: AAK81884.1. AY040828 mRNA. Translation: AAK81885.1. AY040829 mRNA. Translation: AAK81886.1. AB055065 mRNA. Translation: BAB87244.1. AB055066 mRNA. Translation: BAB87245.1. AK304784 mRNA. Translation: BAH14257.1. AL136528 Genomic DNA. Translation: CAI19123.1. AL136528 Genomic DNA. Translation: CAI19124.1. AL136528 Genomic DNA. Translation: CAI19125.1. AL136528 Genomic DNA. Translation: CAI19126.1. AL136528 Genomic DNA. Translation: CAI19127.1. CH471130 Genomic DNA. Translation: EAW71464.1. BC117251 mRNA. Translation: AAI17252.1. BC117253 mRNA. Translation: AAI17254.1. | ||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00006160. IPI00215708. IPI00215709. IPI00215710. IPI00215711. IPI00215712. IPI00607588. IPI00607833. IPI00607886. | ||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001119712.1. NM_001126240.2. NP_001119713.1. NM_001126241.2. NP_001119714.1. NM_001126242.2. NP_001191113.1. NM_001204184.1. NP_001191114.1. NM_001204185.1. NP_001191115.1. NM_001204186.1. NP_001191117.1. NM_001204188.1. NP_001191118.1. NM_001204189.1. NP_001191119.1. NM_001204190.1. NP_001191120.1. NM_001204191.1. NP_005418.1. NM_005427.3. | ||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.697294. Hs.706990. | ||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | O15350. | ||||||||||||||||||||||||||||||||||||||||||||||||
| SMR | O15350. Positions 112-396, 487-554. | ||||||||||||||||||||||||||||||||||||||||||||||||
| DisProt | DP00319. | ||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| DIP | DIP-24202N. DIP-46294N. | ||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | O15350. 5 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||
| MINT | MINT-97729. | ||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | O15350. | ||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | O15350. | ||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | O15350. | ||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000378295; ENSP00000367545; ENSG00000078900. | ||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 7161. | ||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:7161. | ||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc001akp.2. human. uc001akq.1. human. uc001akr.2. human. uc001aks.2. human. uc009vlk.1. human. | ||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 7161. | ||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC01P003592. | ||||||||||||||||||||||||||||||||||||||||||||||||
| H-InvDB | HIX0028501. | ||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:12003. TP73. | ||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB002514. CAB003022. | ||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 601990. gene. | ||||||||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_O15350. | ||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA36684. | ||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | prNOG06224. | ||||||||||||||||||||||||||||||||||||||||||||||||
| GeneTree | ENSGT00390000015092. | ||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG005201. | ||||||||||||||||||||||||||||||||||||||||||||||||
| InParanoid | O15350. | ||||||||||||||||||||||||||||||||||||||||||||||||
| OMA | VGQPPPH. | ||||||||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG4P5K8S. | ||||||||||||||||||||||||||||||||||||||||||||||||
| PhylomeDB | O15350. | ||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | O15350. | ||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | O15350. | ||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | O15350. | ||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000078900. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR008967. p53-like_TF_DNA-bd. IPR012346. p53/RUNT-type_TF_DNA-bd. IPR011615. p53_DNA-bd. IPR010991. p53_tetrameristn. IPR002117. p53_tumour_suppressor. IPR001660. SAM. IPR013761. SAM/pointed. IPR011510. SAM_2. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||
| Gene3D | G3DSA:2.60.40.720. p53_RUNT_DNA_bd. 1 hit. G3DSA:4.10.170.10. p53_tetrameristn. 1 hit. G3DSA:1.10.150.50. SAM_type. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||
| KO | K10148. | ||||||||||||||||||||||||||||||||||||||||||||||||
| PANTHER | PTHR11447. Trp53. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00870. P53. 1 hit. PF07710. P53_tetramer. 1 hit. PF07647. SAM_2. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||
| PRINTS | PR00386. P53SUPPRESSR. | ||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00454. SAM. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF49417. P53_like_DNA_bnd. 1 hit. SSF47719. p53_tetrameristn. 1 hit. SSF47769. SAM_homology. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS00348. P53. 1 hit. PS50105. SAM_DOMAIN. False negative. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 28022. | ||||||||||||||||||||||||||||||||||||||||||||||||
| PMAP-CutDB | O15350. | ||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | P73_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O15350 Secondary accession number(s): B7Z9C1 Q9NTK8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with