Reviewed,
UniProtKB/Swiss-Prot O15315 (RA51B_HUMAN)
Last modified
January 19, 2010.
Version 90.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: DNA repair protein RAD51 homolog 2 Short name=R51H2 Alternative name(s): RAD51-like protein 1 Rad51B | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 384 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Involved in the homologous recombination repair (HRR) pathway of double-stranded DNA breaks arising during DNA replication or induced by DNA-damaging agents. May promote the assembly of presynaptic RAD51 nucleoprotein filaments. The RAD51B-RAD51C dimer exhibits single-stranded DNA-dependent ATPase activity. The BCDX2 complex binds single-stranded DNA, single-stranded gaps in duplex DNA and specifically to nicks in duplex DNA. Ref.11 Ref.12 Ref.13 |
| Subunit structure | Interacts with RAD51C. Part of a BCDX2 complex consisting of RAD51B, RAD51C, RAD51D and XRCC2. Part of a complex consisting of RAD51B, RAD51C, RAD51D, XRCC2 and XRCC3. Part of a complex with RAD51C and RAD51. Ref.12 |
| Subcellular location | Nucleus Probable. |
| Tissue specificity | Expressed in a wide range of tissues. |
| Involvement in disease | A chromosomal aberration involving RAD51L1 is found in pulmonary chondroid hamartoma. Translocation t(6;14)(p21;q23-24) with HMGA1. A chromosomal aberration involving RAD51L1 is found in uterine leiomyoma (UL) [MIM:150699]. Translocation t(12;14)(q15;q23-24) with HMGA2. |
| Sequence similarities | Belongs to the recA family. RAD51 subfamily. |
Ontologies
| Keywords | |
|---|---|
| Biological process | DNA damage DNA recombination DNA repair |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing Chromosomal rearrangement Polymorphism |
| Ligand | ATP-binding DNA-binding Nucleotide-binding |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | DNA repair Ref.3 Traceable author statement. Source: ProtInc reciprocal meiotic recombination Ref.2Traceable author statement. Source: ProtInc |
| Cellular component | nucleus Ref.3 Traceable author statement. Source: ProtInc |
| Molecular function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW DNA binding Ref.3Traceable author statement. Source: ProtInc DNA-dependent ATPase activityInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O15315-3) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O15315-1) Also known as: RAD51L1a; The sequence of this isoform differs from the canonical sequence as follows: 346-384: ETTFCSVTQAELNWAPEILPPQPPEQLGLQMCHHTQLIF → AYGNS | ||||||
| Isoform 3 (identifier: O15315-2) Also known as: RAD51L1b; The sequence of this isoform differs from the canonical sequence as follows: 346-384: ETTFCSVTQAELNWAPEILPPQPPEQLGLQMCHHTQLIF → GQEKP | ||||||
| Isoform 4 (identifier: O15315-4) The sequence of this isoform differs from the canonical sequence as follows: 347-384: TTFCSVTQAELNWAPEILPPQPPEQLGLQMCHHTQLIF → FWHICISGFSIQNRLKENES | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 5 (identifier: O15315-5) The sequence of this isoform differs from the canonical sequence as follows: 1-119: Missing. 346-384: ETTFCSVTQAELNWAPEILPPQPPEQLGLQMCHHTQLIF → GQEKP | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 384 | 384 | DNA repair protein RAD51 homolog 2 | PRO_0000122939 | |||||
Regions | |||||||||
| Nucleotide binding | 108 – 115 | 8 | ATP Potential | ||||||
Sites | |||||||||
| Site | 252 – 253 | 2 | Breakpoint for translocation to form HMGA2-RAD51L1 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 119 | 119 | Missing in isoform 5. | VSP_008817 | |||||
| Alternative sequence | 346 – 384 | 39 | ETTFC…TQLIF → AYGNS in isoform 2. | VSP_008819 | |||||
| Alternative sequence | 346 – 384 | 39 | ETTFC…TQLIF → GQEKP in isoform 3 and isoform 5. | VSP_008818 | |||||
| Alternative sequence | 347 – 384 | 38 | TTFCS…TQLIF → FWHICISGFSIQNRLKENES in isoform 4. | VSP_008820 | |||||
| Natural variant | 9 | 1 | V → M: dbSNP rs34583846. Ref.5 | VAR_025243 | |||||
| Natural variant | 82 | 1 | F → C: dbSNP rs35282642. Ref.5 | VAR_025244 | |||||
| Natural variant | 172 | 1 | L → W: dbSNP rs34094401. Ref.5 | VAR_025245 | |||||
| Natural variant | 180 | 1 | Y → C: dbSNP rs28910275. Ref.5 | VAR_025246 | |||||
| Natural variant | 207 | 1 | V → L: dbSNP rs28908168. | VAR_035437 | |||||
| Natural variant | 243 | 1 | K → R: dbSNP rs34594234. Ref.5 | VAR_025247 | |||||
| Natural variant | 250 | 1 | S → A: dbSNP rs33929366. Ref.5 | VAR_025248 | |||||
| Natural variant | 365 | 1 | P → R: dbSNP rs28908468. | VAR_051730 | |||||
Experimental info | |||||||||
| Sequence conflict | 281 | 1 | S → P in AAN60542. Ref.9 | ||||||
| Sequence conflict | 281 | 1 | S → P in AAN60543. Ref.9 | ||||||
| Sequence conflict | 281 | 1 | S → P in AAN60544. Ref.9 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Isolation of human and mouse genes based on homology to REC2, a recombinational repair gene from the fungus Ustilago maydis." Rice M.C., Smith S.T., Bullrich F., Havre P., Kmiec E.B. Proc. Natl. Acad. Sci. U.S.A. 94:7417-7422(1997) [PubMed: 9207106] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [2] | "Identification of a novel human RAD51 homolog, RAD51B." Albala J.S., Thelen M.P., Prange C.K., Fan W., Christensen M., Thompson L.H., Lennon G.G. Genomics 46:476-479(1997) [PubMed: 9441753] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [3] | "Isolation of novel human and mouse genes of the recA/RAD51 recombination-repair gene family." Cartwright R., Dunn A.M., Simpson P.J., Tambini C.E., Thacker J. Nucleic Acids Res. 26:1653-1659(1998) [PubMed: 9512535] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3). |
| [4] | "Full-length cDNA libraries and normalization." Li W.B., Gruber C., Jessee J., Polayes D. Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 4 AND 5). Tissue: Neuroblastoma. |
| [5] | NIEHS SNPs program Submitted (AUG-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS MET-9; CYS-82; TRP-172; CYS-180; ARG-243 AND ALA-250. |
| [6] | "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [7] | "The DNA sequence and analysis of human chromosome 14." Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H. Weissenbach J.Nature 421:601-607(2003) [PubMed: 12508121] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Lung. |
| [10] | "Fusion transcripts involving HMGA2 are not a common molecular mechanism in uterine leiomyomata with rearrangements in 12q15." Quade B.J., Weremowicz S., Neskey D.M., Vanni R., Ladd C., Dal Cin P., Morton C.C. Cancer Res. 63:1351-1358(2003) [PubMed: 12649198] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 253-310, CHROMOSOMAL TRANSLOCATION WITH HMGA2. |
| [11] | "Identification and purification of two distinct complexes containing the five RAD51 paralogs." Masson J.Y., Tarsounas M.C., Stasiak A.Z., Stasiak A., Shah R., McIlwraith M.J., Benson F.E., West S.C. Genes Dev. 15:3296-3307(2001) [PubMed: 11751635] [Abstract] Cited for: FUNCTION, IDENTIFICATION IN A COMPLEX WITH RAD51C; RAD51D AND XRCC2. |
| [12] | "Mediator function of the human Rad51B-Rad51C complex in Rad51/RPA-catalyzed DNA strand exchange." Sigurdsson S., Van Komen S., Bussen W., Schild D., Albala J.S., Sung P. Genes Dev. 15:3308-3318(2001) [PubMed: 11751636] [Abstract] Cited for: FUNCTION, INTERACTION WITH RAD51C. |
| [13] | "Involvement of Rad51C in two distinct protein complexes of Rad51 paralogs in human cells." Liu N., Schild D., Thelen M.P., Thompson L.H. Nucleic Acids Res. 30:1009-1015(2002) [PubMed: 11842113] [Abstract] Cited for: FUNCTION, IDENTIFICATION IN A COMPLEX WITH RAD51C; RAD51D AND XRCC2. |
| [14] | "RAD51C interacts with RAD51B and is central to a larger protein complex in vivo exclusive of RAD51." Miller K.A., Yoshikawa D.M., McConnell I.R., Clark R., Schild D., Albala J.S. J. Biol. Chem. 277:8406-8411(2002) [PubMed: 11744692] [Abstract] Cited for: IDENTIFICATION IN A COMPLEX WITH RAD51C; RAD51D; XRCC2 AND XRCC3. |
| [15] | "Interactions involving the Rad51 paralogs Rad51C and XRCC3 in human cells." Wiese C., Collins D.W., Albala J.S., Thompson L.H., Kronenberg A., Schild D. Nucleic Acids Res. 30:1001-1008(2002) [PubMed: 11842112] [Abstract] Cited for: IDENTIFICATION IN A COMPLEX WITH RAD51C; RAD51D AND XRCC2. |
| [16] | "Complex formation by the human Rad51B and Rad51C DNA repair proteins and their activities in vitro." Lio Y.-C., Mazin A.V., Kowalczykowski S.C., Chen D.J. J. Biol. Chem. 278:2469-2478(2003) [PubMed: 12427746] [Abstract] Cited for: IDENTIFICATION IN A COMPLEX WITH RAD51 AND RAD51C. |
| [17] | "Allelic knockout of novel splice variants of human recombination repair gene RAD51B in t(12;14) uterine leiomyomas." Schoenmakers E.F.P.M., Huysmans C., Van de Ven W.J.M. Cancer Res. 59:19-23(1999) [PubMed: 9892177] [Abstract] Cited for: CHROMOSOMAL TRANSLOCATION WITH HMGA2. |
| [18] | "Intragenic breakpoint within RAD51L1 in a t(6;14)(p21.3;q24) of a pulmonary chondroid hamartoma." Blank C., Schoenmakers E.F.P.M., Rogalla P., Huys E.H., van Rijk A.A., Drieschner N., Bullerdiek J. Cytogenet. Cell Genet. 95:17-19(2001) [PubMed: 11978964] [Abstract] Cited for: CHROMOSOMAL TRANSLOCATION WITH HMGA1. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U92074 mRNA. Translation: AAB63358.1. U84138 mRNA. Translation: AAC39723.1. Y15571 mRNA. Translation: CAA75680.1. BX161515 mRNA. Translation: CAD61950.1. BX248061 mRNA. Translation: CAD62357.1. Different initiation. BX248766 mRNA. Translation: CAD66573.1. Different initiation. DQ160197 Genomic DNA. Translation: AAZ85144.1. AC004518 Genomic DNA. Translation: AAC32426.1. AC004518 Genomic DNA. Translation: AAC32425.1. CR536560 mRNA. Translation: CAG38797.1. CH471061 Genomic DNA. Translation: EAW80957.1. BC030219 mRNA. Translation: AAH30219.1. AY138857 mRNA. Translation: AAN60542.1. AY138858 mRNA. Translation: AAN60543.1. AY138859 mRNA. Translation: AAN60544.1. |
| IPI | IPI00006105. IPI00220523. IPI00386489. IPI00386490. IPI00395987. |
| RefSeq | NP_002868.1. NP_598193.2. NP_598194.1. |
| UniGene | Hs.172587 |
3D structure databases | |
| SMR | O15315. Positions 4-343. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | O15315. |
Genome annotation databases | |
| Ensembl | ENST00000402498; ENSP00000385485; ENSG00000182185; Homo sapiens. [Genome view] ENST00000487270; ENSP00000419471; ENSG00000182185; Homo sapiens. [Genome view] |
| GeneID | 5890. |
| KEGG | hsa:5890. |
| NMPDR | fig|9606.3.peg.9776. |
| UCSC | uc001xkd.1. human. uc001xkf.1. human. uc001xkg.1. human. |
Organism-specific databases | |
| CTD | 5890. |
| GeneCards | GC14P067356. |
| H-InvDB | HIX0022466. |
| HGNC | HGNC:9822. RAD51L1. |
| HPA | CAB016191. |
| MIM | 150699. phenotype. 602948. gene. |
| PharmGKB | PA34178. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG16975. |
| HOVERGEN | O15315. |
| InParanoid | O15315. |
| OMA | RKEFDTQ. |
| PhylomeDB | O15315. |
Gene expression databases | |
| ArrayExpress | O15315. |
| Bgee | O15315. |
| Genevestigator | O15315. |
Family and domain databases | |
| InterPro | IPR003593. ATPase_AAA+_core. IPR013632. DNA_recomb/repair_Rad51_C. IPR016467. DNA_recomb/repair_RecA-like. IPR020588. DNA_recomb_RecA/RadB_ATP-bd. [Graphical view] |
| Pfam | PF08423. Rad51. 1 hit. [Graphical view] |
| PIRSF | PIRSF005856. Rad51. 1 hit. |
| SMART | SM00382. AAA. 1 hit. [Graphical view] |
| PROSITE | PS50162. RECA_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 22908. |
| SOURCE | Search... |
Entry information
| Entry name | RA51B_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O15315 Secondary accession number(s): O60914 Q9UPL5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 14 Human chromosome 14: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


