O15265 (ATX7_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 126.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Ataxin-7 Alternative name(s): Spinocerebellar ataxia type 7 protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 892 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Acts as component of the STAGA transcription coactivator-HAT complex. Mediates the interaction of STAGA complex with the CRX and is involved in CRX-dependent gene activation. Necessary for microtubule cytoskeleton stabilization. Ref.14 |
| Subunit structure | Component of the STAGA transcription coactivator-HAT complex, at least composed of SUPT3H, GCN5L2, TAF5L, TAF6L, SUPT7L, TADA3L, TAD1L, TAF10, TAF12, TRRAP, TAF9 and ATXN7. The STAGA core complex is associated with a subcomplex required for histone deubiquitination composed of ATXN7L3, ENY2 and USP22. Interacts with SORBS1, PSMC1 and CRX. Interacts with TRRAP, GCN5L2 and TAF10. Interacts with alpha tubulin. Ref.7 Ref.8 Ref.9 Ref.10 Ref.12 Ref.14 |
| Subcellular location | Isoform a: Nucleus. Nucleus › nucleolus. Nucleus matrix. Cytoplasm › cytoskeleton. Note: In addition to a diffuse distribution throughout the nucleus, it is associated with the nuclear matrix and the nucleolus. It is able to shuttle between the nucleus and cytoplasm. Ref.6 Ref.11 Ref.14 |
| Tissue specificity | Isoform a and isoform b are expressed in CNS, but isoform a is expressed predominantly in the peripherical tissues. Isoform b is also highly expressed in the frontal lobe, skeletal muscle and spinal cord and is expressed at a lower level in the lung, lymphoblast and intestine. |
| Post-translational modification | Proteolytically cleaved. The cleavage may be involved in SCA7 degeneration: the isoform fragments may exert distinct toxic influences that could contribute to selective neurodegeneration. Sumoylation decreases the aggregation propensity and cellular toxicity of forms with an expanded poly-Gln region but has no effect on subcellular location or interaction with components of the STAGA complex. Ref.13 |
| Polymorphism | The poly-Gln region of ATXN7 is highly polymorphic (4 to 18 repeats) in the normal population and is expanded to about 38-130 repeats in SCA7 patients. Intermediate alleles with 28 to 35 repeats are prone to further expansion. |
| Involvement in disease | Spinocerebellar ataxia 7 (SCA7) [MIM:164500]: Spinocerebellar ataxia is a clinically and genetically heterogeneous group of cerebellar disorders. Patients show progressive incoordination of gait and often poor coordination of hands, speech and eye movements, due to degeneration of the cerebellum with variable involvement of the brainstem and spinal cord. SCA7 belongs to the autosomal dominant cerebellar ataxias type II (ADCA II) which are characterized by cerebellar ataxia with retinal degeneration and pigmentary macular dystrophy. |
| Sequence similarities | Belongs to the ataxin-7 family. Contains 1 SCA7 domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| AGRN | O00468 | 2 | EBI-708350,EBI-947482 | |
| CEP72 | Q9P209 | 2 | EBI-708350,EBI-739498 | |
| LTBP4 | Q8N2S1 | 2 | EBI-708350,EBI-947718 | |
| MATN2 | O00339 | 2 | EBI-708350,EBI-949020 | |
| MEGF6 | O75095 | 2 | EBI-708350,EBI-947597 | |
| MEGF8 | Q7Z7M0 | 2 | EBI-708350,EBI-947617 | |
| NOC2L | Q9Y3T9 | 2 | EBI-708350,EBI-751547 | |
| NUP62 | P37198 | 2 | EBI-708350,EBI-347978 | |
| SIAH1 | Q8IUQ4 | 2 | EBI-708350,EBI-747107 | |
| TAF10 | Q12962 | 6 | EBI-708350,EBI-708376 | |
| TRRAP | Q9Y4A5 | 6 | EBI-708350,EBI-399128 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform a (identifier: O15265-1) Also known as: Ataxin-7a; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform b (identifier: O15265-2) Also known as: Ataxin-7b; SCA7b; The sequence of this isoform differs from the canonical sequence as follows: 888-892: PKARP → DISSPCLRTGISATSPQSPDLKSKGTSLTAENSTGRNNADTFEDKLHLHSALWTPRCL | ||||||
| Isoform 3 (identifier: O15265-3) The sequence of this isoform differs from the canonical sequence as follows: 1-166: MSERAADDVR...VKPQAFQSHY → MEGSKTPLQSSPSAQELKAPL | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||
Molecule processing | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 892 | 892 | Ataxin-7 | PRO_0000064759 | |||||||||||||||
Regions | |||||||||||||||||||
| Domain | 334 – 401 | 68 | SCA7 | ||||||||||||||||
| Compositional bias | 16 – 20 | 5 | Poly-Ala | ||||||||||||||||
| Compositional bias | 23 – 28 | 6 | Poly-Ala | ||||||||||||||||
| Compositional bias | 30 – 49 | 20 | Gln-rich | ||||||||||||||||
| Compositional bias | 30 – 39 | 10 | Poly-Gln | ||||||||||||||||
| Compositional bias | 40 – 65 | 26 | Pro-rich | ||||||||||||||||
| Compositional bias | 40 – 45 | 6 | Poly-Pro | ||||||||||||||||
| Compositional bias | 51 – 55 | 5 | Poly-Pro | ||||||||||||||||
| Compositional bias | 171 – 219 | 49 | Ser-rich | ||||||||||||||||
| Compositional bias | 171 – 174 | 4 | Poly-Ser | ||||||||||||||||
| Compositional bias | 213 – 219 | 7 | Poly-Ser | ||||||||||||||||
| Compositional bias | 402 – 486 | 85 | Pro-rich | ||||||||||||||||
| Compositional bias | 640 – 851 | 212 | Ser-rich | ||||||||||||||||
| Compositional bias | 647 – 654 | 8 | Poly-Ser | ||||||||||||||||
| Compositional bias | 717 – 730 | 14 | Poly-Ser | ||||||||||||||||
| Compositional bias | 840 – 845 | 6 | Poly-Ser | ||||||||||||||||
Amino acid modifications | |||||||||||||||||||
| Cross-link | 257 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) Ref.13 | |||||||||||||||||
Natural variations | |||||||||||||||||||
| Alternative sequence | 1 – 166 | 166 | MSERA…FQSHY → MEGSKTPLQSSPSAQELKAP L in isoform 3. | VSP_044456 | |||||||||||||||
| Alternative sequence | 888 – 892 | 5 | PKARP → DISSPCLRTGISATSPQSPD LKSKGTSLTAENSTGRNNAD TFEDKLHLHSALWTPRCL in isoform b. | VSP_007695 | |||||||||||||||
| Natural variant | 264 | 1 | K → R. Ref.2 Ref.3 Corresponds to variant rs1053338 [ dbSNP | Ensembl ]. | VAR_011823 | |||||||||||||||
| Natural variant | 573 | 1 | I → V. Corresponds to variant rs3733124 [ dbSNP | Ensembl ]. | VAR_053779 | |||||||||||||||
| Natural variant | 663 | 1 | P → S. Corresponds to variant rs1053340 [ dbSNP | Ensembl ]. | VAR_011824 | |||||||||||||||
| Natural variant | 862 | 1 | V → M. Ref.2 Ref.3 Corresponds to variant rs3774729 [ dbSNP | Ensembl ]. | VAR_020143 | |||||||||||||||
Experimental info | |||||||||||||||||||
| Mutagenesis | 257 | 1 | K → R: Almost completely abolishes sumoylation. Ref.13 | ||||||||||||||||
| Mutagenesis | 858 | 1 | K → R: No effect on sumoylation. Ref.13 | ||||||||||||||||
| Sequence conflict | 105 | 1 | P → H in AAC19162. Ref.2 | ||||||||||||||||
| Sequence conflict | 129 | 1 | C → S in AAC19162. Ref.2 | ||||||||||||||||
| Sequence conflict | 888 – 892 | 5 | PKARP → VGNGL in AAC39765. Ref.2 | ||||||||||||||||
| Sequence conflict | 888 – 892 | 5 | PKARP → VGNGL in AAC19163. Ref.2 | ||||||||||||||||
Secondary structure | |||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||
| Turn | 343 – 345 | 3 | |||||||||||||||||
| Turn | 352 – 354 | 3 | |||||||||||||||||
| Helix | 369 – 374 | 6 | |||||||||||||||||
| Beta strand | 378 – 380 | 3 | |||||||||||||||||
| Helix | 382 – 393 | 12 | |||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning of the SCA7 gene reveals a highly unstable CAG repeat expansion." David G., Abbas N., Stevanin G., Duerr A., Yvert G., Cancel G., Weber C., Imbert G., Saudou F., Antoniou E., Drabkin H., Gemmill R., Giunti P., Benomar A., Wood N., Ruberg M., Agid Y., Mandel J.-L., Brice A. Nat. Genet. 17:65-70(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A), INVOLVEMENT IN SCA7. Tissue: Lymphoblast. |
| [2] | "Molecular genetic analysis of autosomal dominant cerebellar ataxia with retinal degeneration (ADCA type II) caused by CAG triplet repeat expansion." Del-Favero J., Krols L., Michalik A., Theuns J., Loefgren A., Goossens D., Wehnert A., Van den Bossche D., Van Zand K., Backhovens H., van Regenmorter N., Martin J.-J., Van Broeckhoven C. Hum. Mol. Genet. 7:177-186(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A), NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-131, POLYMORPHISM, VARIANTS ARG-264 AND MET-862. Tissue: Colon. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), VARIANTS ARG-264 AND MET-862. Tissue: Trachea. |
| [4] | "The DNA sequence, annotation and analysis of human chromosome 3." Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J. Gibbs R.A.Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "A novel central nervous system-enriched spinocerebellar ataxia type 7 gene product." Einum D.D., Clark A.M., Townsend J.J., Ptacek L.J., Fu Y.H. Arch. Neurol. 60:97-103(2003) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE SPLICING (ISOFORMS A AND B). Tissue: Testis. |
| [6] | "Nuclear localization of the spinocerebellar ataxia type 7 protein, ataxin-7." Kaytor M.D., Duvick L.A., Skinner P.J., Koob M.D., Ranum L.P., Orr H.T. Hum. Mol. Genet. 8:1657-1664(1999) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [7] | "Ataxin-7 interacts with a Cbl-associated protein that it recruits into neuronal intranuclear inclusions." Lebre A.-S., Jamot L., Takahashi J., Spassky N., Leprince C., Ravise N., Zander C., Fujigasaki H., Kussel-Andermann P., Duyckaerts C., Camonis J.H., Brice A. Hum. Mol. Genet. 10:1201-1213(2001) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SORBS1. |
| [8] | "Association of ataxin-7 with the proteasome subunit S4 of the 19S regulatory complex." Matilla A., Gorbea C., Einum D.D., Townsend J., Michalik A., van Broeckhoven C., Jensen C.C., Murphy K.J., Ptacek L.J., Fu Y.H. Hum. Mol. Genet. 10:2821-2831(2001) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH PSMC1. |
| [9] | "Ataxin-7 is a subunit of GCN5 histone acetyltransferase-containing complexes." Helmlinger D., Hardy S., Sasorith S., Klein F., Robert F., Weber C., Miguet L., Potier N., Van-Dorsselaer A., Wurtz J.M., Mandel J.L., Tora L., Devys D. Hum. Mol. Genet. 13:1257-1265(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH TRRAP; GCN5L2 AND TAF10. |
| [10] | "Polyglutamine-expanded ataxin-7 inhibits STAGA histone acetyltransferase activity to produce retinal degeneration." Palhan V.B., Chen S., Peng G.H., Tjernberg A., Gamper A.M., Fan Y., Chait B.T., La Spada A.R., Roeder R.G. Proc. Natl. Acad. Sci. U.S.A. 102:8472-8477(2005) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION IN THE STAGA COMPLEX. |
| [11] | "Ataxin-7 can export from the nucleus via a conserved exportin-dependent signal." Taylor J., Grote S.K., Xia J., Vandelft M., Graczyk J., Ellerby L.M., La Spada A.R., Truant R. J. Biol. Chem. 281:2730-2739(2006) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [12] | "A TFTC/STAGA module mediates histone H2A and H2B deubiquitination, coactivates nuclear receptors, and counteracts heterochromatin silencing." Zhao Y., Lang G., Ito S., Bonnet J., Metzger E., Sawatsubashi S., Suzuki E., Le Guezennec X., Stunnenberg H.G., Krasnov A., Georgieva S.G., Schuele R., Takeyama K., Kato S., Tora L., Devys D. Mol. Cell 29:92-101(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION IN STAGA COMPLEX. |
| [13] | "SUMOylation attenuates the aggregation propensity and cellular toxicity of the polyglutamine expanded ataxin-7." Janer A., Werner A., Takahashi-Fujigasaki J., Daret A., Fujigasaki H., Takada K., Duyckaerts C., Brice A., Dejean A., Sittler A. Hum. Mol. Genet. 19:181-195(2010) [PubMed] [Europe PMC] [Abstract] Cited for: SUMOYLATION AT LYS-257, MUTAGENESIS OF LYS-257 AND LYS-858. |
| [14] | "Ataxin-7 associates with microtubules and stabilizes the cytoskeletal network." Nakamura Y., Tagawa K., Oka T., Sasabe T., Ito H., Shiwaku H., La Spada A.R., Okazawa H. Hum. Mol. Genet. 21:1099-1110(2012) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH ALPHA TUBULIN, SUBCELLULAR LOCATION. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AJ000517 mRNA. Translation: CAA04154.1. AF032102 Genomic DNA. Translation: AAC19162.1. AF032103 mRNA. Translation: AAC19163.1. AF032105 mRNA. Translation: AAC39765.1. AK304062 mRNA. Translation: BAG64969.1. AC012557 Genomic DNA. No translation available. AC104162 Genomic DNA. No translation available. AA398030 mRNA. No translation available. | ||||||||||||
| IPI | IPI00005743. IPI00332082. | ||||||||||||
| PIR | T09193. | ||||||||||||
| RefSeq | NP_000324.1. NM_000333.3. NP_001121621.2. NM_001128149.2. NP_001170858.1. NM_001177387.1. | ||||||||||||
| UniGene | Hs.476595. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | O15265. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | O15265. 57 interactions. | ||||||||||||
| MINT | MINT-2862470. | ||||||||||||
| STRING | 9606.ENSP00000381590. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | O15265. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | O15265. | ||||||||||||
| PRIDE | O15265. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 6314. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000295900; ENSP00000295900; ENSG00000163635. ENST00000398590; ENSP00000381590; ENSG00000163635. ENST00000484332; ENSP00000428277; ENSG00000163635. ENST00000487717; ENSP00000420234; ENSG00000163635. ENST00000538065; ENSP00000439585; ENSG00000163635. | ||||||||||||
| GeneID | 6314. | ||||||||||||
| KEGG | hsa:6314. | ||||||||||||
| UCSC | uc003dlv.3. human. uc021wzy.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 6314. | ||||||||||||
| GeneCards | GC03P063825. | ||||||||||||
| HGNC | HGNC:10560. ATXN7. | ||||||||||||
| HPA | HPA034989. | ||||||||||||
| MIM | 164500. phenotype. 607640. gene. | ||||||||||||
| neXtProt | NX_O15265. | ||||||||||||
| Orphanet | 94147. Spinocerebellar ataxia type 7. | ||||||||||||
| PharmGKB | PA34973. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG270433. | ||||||||||||
| HOGENOM | HOG000252910. | ||||||||||||
| HOVERGEN | HBG004320. | ||||||||||||
| KO | K11318. | ||||||||||||
| OMA | RKNSSPL. | ||||||||||||
| OrthoDB | EOG4DV5KV. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | O15265. | ||||||||||||
| Bgee | O15265. | ||||||||||||
| CleanEx | HS_ATXN7. | ||||||||||||
| Genevestigator | O15265. | ||||||||||||
| GermOnline | ENSG00000163635. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR013243. SCA7_dom. IPR015880. Znf_C2H2-like. [Graphical view] | ||||||||||||
| Pfam | PF08313. SCA7. 1 hit. [Graphical view] | ||||||||||||
| SMART | SM00355. ZnF_C2H2. 1 hit. [Graphical view] | ||||||||||||
| PROSITE | PS51505. SCA7. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| ChiTaRS | ATXN7. human. | ||||||||||||
| EvolutionaryTrace | O15265. | ||||||||||||
| GenomeRNAi | 6314. | ||||||||||||
| NextBio | 24505. | ||||||||||||
| PMAP-CutDB | O15265. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | ATX7_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O15265 Secondary accession number(s): B4E207 Q9Y6P8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
