Reviewed,
UniProtKB/Swiss-Prot O15265 (ATX7_HUMAN)
Last modified
January 19, 2010.
Version 94.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Ataxin-7 Alternative name(s): Spinocerebellar ataxia type 7 protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 892 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Involved in neurodegeneration. Acts as component of the STAGA transcription coactivator-HAT complex. Mediates the interaction of STAGA complex with the CRX and is involved in CRX-dependent gene activation. |
| Subunit structure | Component of the STAGA transcription coactivator-HAT complex, at least composed of SUPT3H, GCN5L2, TAF5L, TAF6L, SUPT7L, TADA3L, TAD1L, TAF10, TAF12, TRRAP, TAF9 and ATXN7. The STAGA core complex is associated with a subcomplex required for histone deubiquitinylation composed of ATXN7L3, ENY2 and USP22. Interacts with SORBS1, PSMC1 and CRX. Interacts with TRRAP, GCN5L2 and TAF10. Ref.5 Ref.6 Ref.7 |
| Subcellular location | Isoform a: Nucleus. Nucleus › nucleolus. Nucleus matrix. Note: In addition to a diffuse distribution throughout the nucleus, it is associated with the nuclear matrix and the nucleolus. Ref.4 |
| Tissue specificity | Isoform a and isoform b are expressed in CNS, but isoform a is expressed predominantly in the peripherical tissues. Isoform b is also highly expressed in the frontal lobe, skeletal muscle and spinal cord and is expressed at a lower level in the lung, lymphoblast and intestine. |
| Post-translational modification | Proteolytically cleaved. The cleavage may be involved in SCA7 degeneration: the isoform fragments may exert distinct toxic influences that could contribute to selective neurodegeneration. |
| Polymorphism | The poly-Gln region of ATXN7 is highly polymorphic (4 to 18 repeats) in the normal population and is expanded to about 38-130 repeats in SCA7 patients. Intermediate alleles with 28 to 35 repeats are prone to further expansion. |
| Involvement in disease | Defects in ATXN7 are the cause of spinocerebellar ataxia type 7 (SCA7) [MIM:164500]; also known as olivopontocerebellar atrophy III (OPCA III or OPCA3) or olivopontocerebellar atrophy with retinal degeneration. Spinocerebellar ataxia is a clinically and genetically heterogeneous group of cerebellar disorders. Patients show progressive incoordination of gait and often poor coordination of hands, speech and eye movements, due to degeneration of the cerebellum with variable involvement of the brainstem and spinal cord. SCA7 belongs to the autosomal dominant cerebellar ataxias type II (ADCA II) which are characterized by cerebellar ataxia with retinal degeneration and pigmentary macular dystrophy. Ref.1 |
| Sequence similarities | Belongs to the ataxin-7 family. Contains 1 SCA7 domain. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform a (identifier: O15265-1) Also known as: Ataxin-7a; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: In addition to a diffuse distribution throughout the nucleus, it is associated with the nuclear matrix and the nucleolus. Ref.4 Nuclear. | ||||||
| Isoform b (identifier: O15265-2) Also known as: Ataxin-7b; SCA7b; The sequence of this isoform differs from the canonical sequence as follows: 888-892: PKARP → DISSPCLRTGISATSPQSPDLKSKGTSLTAENSTGRNNADTFEDKLHLHSALWTPRCL | ||||||
| Note: Cytoplasmic. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 892 | 892 | Ataxin-7 | PRO_0000064759 | |||||
Regions | |||||||||
| Domain | 317 – 397 | 81 | SCA7 | ||||||
| Compositional bias | 16 – 20 | 5 | Poly-Ala | ||||||
| Compositional bias | 23 – 28 | 6 | Poly-Ala | ||||||
| Compositional bias | 30 – 49 | 20 | Gln-rich | ||||||
| Compositional bias | 30 – 39 | 10 | Poly-Gln | ||||||
| Compositional bias | 40 – 65 | 26 | Pro-rich | ||||||
| Compositional bias | 40 – 45 | 6 | Poly-Pro | ||||||
| Compositional bias | 51 – 55 | 5 | Poly-Pro | ||||||
| Compositional bias | 171 – 219 | 49 | Ser-rich | ||||||
| Compositional bias | 171 – 174 | 4 | Poly-Ser | ||||||
| Compositional bias | 213 – 219 | 7 | Poly-Ser | ||||||
| Compositional bias | 402 – 486 | 85 | Pro-rich | ||||||
| Compositional bias | 640 – 851 | 212 | Ser-rich | ||||||
| Compositional bias | 647 – 654 | 8 | Poly-Ser | ||||||
| Compositional bias | 717 – 730 | 14 | Poly-Ser | ||||||
| Compositional bias | 840 – 845 | 6 | Poly-Ser | ||||||
Amino acid modifications | |||||||||
| Modified residue | 840 | 1 | Phosphoserine Ref.8 | ||||||
| Modified residue | 849 | 1 | Phosphoserine Ref.8 | ||||||
| Modified residue | 854 | 1 | Phosphothreonine Ref.8 | ||||||
Natural variations | |||||||||
| Alternative sequence | 888 – 892 | 5 | PKARP → DISSPCLRTGISATSPQSPD LKSKGTSLTAENSTGRNNAD TFEDKLHLHSALWTPRCL in isoform b. | VSP_007695 | |||||
| Natural variant | 264 | 1 | K → R: dbSNP rs1053338. Ref.2 | VAR_011823 | |||||
| Natural variant | 573 | 1 | I → V: dbSNP rs3733124. | VAR_053779 | |||||
| Natural variant | 663 | 1 | P → S: dbSNP rs1053340. | VAR_011824 | |||||
| Natural variant | 862 | 1 | V → M: dbSNP rs3774729. Ref.2 | VAR_020143 | |||||
Experimental info | |||||||||
| Sequence conflict | 105 | 1 | P → H in AAC19162. Ref.2 | ||||||
| Sequence conflict | 129 | 1 | C → S in AAC19162. Ref.2 | ||||||
| Sequence conflict | 888 – 892 | 5 | PKARP → VGNGL in AAC39765. Ref.2 | ||||||
| Sequence conflict | 888 – 892 | 5 | PKARP → VGNGL in AAC19163. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning of the SCA7 gene reveals a highly unstable CAG repeat expansion." David G., Abbas N., Stevanin G., Duerr A., Yvert G., Cancel G., Weber C., Imbert G., Saudou F., Antoniou E., Drabkin H., Gemmill R., Giunti P., Benomar A., Wood N., Ruberg M., Agid Y., Mandel J.-L., Brice A. Nat. Genet. 17:65-70(1997) [PubMed: 9288099] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A), INVOLVEMENT IN SCA7. Tissue: Lymphoblast. |
| [2] | "Molecular genetic analysis of autosomal dominant cerebellar ataxia with retinal degeneration (ADCA type II) caused by CAG triplet repeat expansion." Del-Favero J., Krols L., Michalik A., Theuns J., Loefgren A., Goossens D., Wehnert A., Van den Bossche D., Van Zand K., Backhovens H., van Regenmorter N., Martin J.-J., Van Broeckhoven C. Hum. Mol. Genet. 7:177-186(1998) [PubMed: 9425224] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A), NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-131, POLYMORPHISM, VARIANTS ARG-264 AND MET-862. Tissue: Colon. |
| [3] | "A novel central nervous system-enriched spinocerebellar ataxia type 7 gene product." Einum D.D., Clark A.M., Townsend J.J., Ptacek L.J., Fu Y.H. Arch. Neurol. 60:97-103(2003) [PubMed: 12533095] [Abstract] Cited for: ALTERNATIVE SPLICING (ISOFORMS A AND B). Tissue: Testis. |
| [4] | "Nuclear localization of the spinocerebellar ataxia type 7 protein, ataxin-7." Kaytor M.D., Duvick L.A., Skinner P.J., Koob M.D., Ranum L.P., Orr H.T. Hum. Mol. Genet. 8:1657-1664(1999) [PubMed: 10441328] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [5] | "Ataxin-7 interacts with a Cbl-associated protein that it recruits into neuronal intranuclear inclusions." Lebre A.-S., Jamot L., Takahashi J., Spassky N., Leprince C., Ravise N., Zander C., Fujigasaki H., Kussel-Andermann P., Duyckaerts C., Camonis J.H., Brice A. Hum. Mol. Genet. 10:1201-1213(2001) [PubMed: 11371513] [Abstract] Cited for: INTERACTION WITH SORBS1. |
| [6] | "Association of ataxin-7 with the proteasome subunit S4 of the 19S regulatory complex." Matilla A., Gorbea C., Einum D.D., Townsend J., Michalik A., van Broeckhoven C., Jensen C.C., Murphy K.J., Ptacek L.J., Fu Y.H. Hum. Mol. Genet. 10:2821-2831(2001) [PubMed: 11734547] [Abstract] Cited for: INTERACTION WITH PSMC1. |
| [7] | "Ataxin-7 is a subunit of GCN5 histone acetyltransferase-containing complexes." Helmlinger D., Hardy S., Sasorith S., Klein F., Robert F., Weber C., Miguet L., Potier N., Van-Dorsselaer A., Wurtz J.M., Mandel J.L., Tora L., Devys D. Hum. Mol. Genet. 13:1257-1265(2004) [PubMed: 15115762] [Abstract] Cited for: INTERACTION WITH TRRAP; GCN5L2 AND TAF10. |
| [8] | "Large-scale characterization of HeLa cell nuclear phosphoproteins." Beausoleil S.A., Jedrychowski M., Schwartz D., Elias J.E., Villen J., Li J., Cohn M.A., Cantley L.C., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 101:12130-12135(2004) [PubMed: 15302935] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-840; SER-849 AND THR-854, MASS SPECTROMETRY. Tissue: Epithelium. |
| [9] | "Polyglutamine-expanded ataxin-7 inhibits STAGA histone acetyltransferase activity to produce retinal degeneration." Palhan V.B., Chen S., Peng G.H., Tjernberg A., Gamper A.M., Fan Y., Chait B.T., La Spada A.R., Roeder R.G. Proc. Natl. Acad. Sci. U.S.A. 102:8472-8477(2005) [PubMed: 15932940] [Abstract] Cited for: IDENTIFICATION IN THE STAGA COMPLEX. |
| [10] | "A TFTC/STAGA module mediates histone H2A and H2B deubiquitination, coactivates nuclear receptors, and counteracts heterochromatin silencing." Zhao Y., Lang G., Ito S., Bonnet J., Metzger E., Sawatsubashi S., Suzuki E., Le Guezennec X., Stunnenberg H.G., Krasnov A., Georgieva S.G., Schuele R., Takeyama K., Kato S., Tora L., Devys D. Mol. Cell 29:92-101(2008) [PubMed: 18206972] [Abstract] Cited for: IDENTIFICATION IN STAGA COMPLEX. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AJ000517 mRNA. Translation: CAA04154.1. AF032102 Genomic DNA. Translation: AAC19162.1. AF032103 mRNA. Translation: AAC19163.1. AF032105 mRNA. Translation: AAC39765.1. AA398030 mRNA. No translation available. |
| IPI | IPI00005743. IPI00332082. |
| PIR | T09193. |
| RefSeq | NP_000324.1. NP_001121621.1. |
| UniGene | Hs.476595 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | O15265. 8 interactions. |
| STRING | O15265. |
PTM databases | |
| PhosphoSite | O15265. |
Proteomic databases | |
| PRIDE | O15265. |
Genome annotation databases | |
| Ensembl | ENST00000295900; ENSP00000295900; ENSG00000163635; Homo sapiens. [Genome view] ENST00000487717; ENSP00000420234; ENSG00000163635; Homo sapiens. [Genome view] |
| GeneID | 6314. |
| KEGG | hsa:6314. |
| UCSC | uc003dlv.2. human. uc010hnv.1. human. |
Organism-specific databases | |
| CTD | 6314. |
| GeneCards | GC03P063825. |
| H-InvDB | HIX0030703. |
| HGNC | HGNC:10560. ATXN7. |
| MIM | 164500. phenotype. 607640. gene. |
| Orphanet | 94147. Ataxia, spinocerebellar, autosomal dominant, type 7. |
| PharmGKB | PA34973. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG19056. |
| HOVERGEN | O15265. |
| OMA | HSMESFR. |
| OrthoDB | EOG944P5D. |
Gene expression databases | |
| ArrayExpress | O15265. |
| Bgee | O15265. |
| CleanEx | HS_ATXN7. |
| Genevestigator | O15265. |
| GermOnline | ENSG00000163635. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR013243. SCA7. IPR015880. Znf_C2H2-like. [Graphical view] |
| Pfam | PF08313. SCA7. 1 hit. [Graphical view] |
| SMART | SM00355. ZnF_C2H2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 24505. |
| PMAP-CutDB | O15265. |
| SOURCE | Search... |
Entry information
| Entry name | ATX7_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O15265 Secondary accession number(s): O75328, O75329, Q9Y6P8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


