Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ral guanine nucleotide dissociation stimulator-like 2

Gene

RGL2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

Probable guanine nucleotide exchange factor. Putative effector of Ras and/or Rap. Associates with the GTP-bound form of Rap 1A and H-Ras in vitro (By similarity).By similarity

GO - Molecular functioni

  1. Ras guanyl-nucleotide exchange factor activity Source: UniProtKB

GO - Biological processi

  1. positive regulation of GTPase activity Source: GOC
  2. Ras protein signal transduction Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Guanine-nucleotide releasing factor

Names & Taxonomyi

Protein namesi
Recommended name:
Ral guanine nucleotide dissociation stimulator-like 2
Short name:
RalGDS-like 2
Alternative name(s):
RalGDS-like factor
Ras-associated protein RAB2L
Gene namesi
Name:RGL2
Synonyms:RAB2L
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componentsi: Chromosome 6, Unplaced

Organism-specific databases

HGNCiHGNC:9769. RGL2.

Subcellular locationi

GO - Cellular componenti

  1. intracellular Source: InterPro
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA34120.

Polymorphism and mutation databases

BioMutaiRGL2.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 777777Ral guanine nucleotide dissociation stimulator-like 2PRO_0000068888Add
BLAST

Proteomic databases

MaxQBiO15211.
PaxDbiO15211.
PRIDEiO15211.

PTM databases

PhosphoSiteiO15211.

Expressioni

Gene expression databases

BgeeiO15211.
CleanExiHS_RGL2.
ExpressionAtlasiO15211. baseline and differential.
GenevestigatoriO15211.

Organism-specific databases

HPAiHPA053444.

Interactioni

Subunit structurei

Interacts with SAMD9.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
NOTCH2NLQ7Z3S93EBI-712355,EBI-945833

Protein-protein interaction databases

BioGridi111801. 15 interactions.
IntActiO15211. 14 interactions.
STRINGi9606.ENSP00000407088.

Structurei

3D structure databases

ProteinModelPortaliO15211.
SMRiO15211. Positions 53-514, 645-734.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini88 – 212125N-terminal Ras-GEFPROSITE-ProRule annotationAdd
BLAST
Domaini243 – 513271Ras-GEFPROSITE-ProRule annotationAdd
BLAST
Domaini648 – 73588Ras-associatingPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 N-terminal Ras-GEF domain.PROSITE-ProRule annotation
Contains 1 Ras-associating domain.PROSITE-ProRule annotation
Contains 1 Ras-GEF domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiNOG298772.
GeneTreeiENSGT00780000121844.
HOGENOMiHOG000231592.
HOVERGENiHBG005864.
InParanoidiO15211.
KOiK17636.
OMAiVFYAMDG.
PhylomeDBiO15211.
TreeFamiTF315204.

Family and domain databases

Gene3Di1.10.840.10. 1 hit.
InterProiIPR000159. Ras-assoc.
IPR000651. Ras-like_Gua-exchang_fac_N.
IPR019804. Ras_G-nucl-exch_fac_CS.
IPR023578. Ras_GEF_dom.
IPR001895. RASGEF_cat_dom.
IPR030749. RGL2.
IPR029071. Ubiquitin-rel_dom.
[Graphical view]
PANTHERiPTHR23113:SF159. PTHR23113:SF159. 1 hit.
PfamiPF00788. RA. 1 hit.
PF00617. RasGEF. 1 hit.
PF00618. RasGEF_N. 1 hit.
[Graphical view]
SMARTiSM00314. RA. 1 hit.
SM00147. RasGEF. 1 hit.
SM00229. RasGEFN. 1 hit.
[Graphical view]
SUPFAMiSSF48366. SSF48366. 1 hit.
SSF54236. SSF54236. 1 hit.
PROSITEiPS50200. RA. 1 hit.
PS00720. RASGEF. 1 hit.
PS50009. RASGEF_CAT. 1 hit.
PS50212. RASGEF_NTER. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O15211-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLPRPLRLLL DTSPPGGVVL SSFRSRDPEE GGGPGGLVVG GGQEEEEEEE
60 70 80 90 100
EEAPVSVWDE EEDGAVFTVT SRQYRPLDPL VPMPPPRSSR RLRAGTLEAL
110 120 130 140 150
VRHLLDTRTS GTDVSFMSAF LATHRAFTST PALLGLMADR LEALESHPTD
160 170 180 190 200
ELERTTEVAI SVLSTWLASH PEDFGSEAKG QLDRLESFLL QTGYAAGKGV
210 220 230 240 250
GGGSADLIRN LRSRVDPQAP DLPKPLALPG DPPADPTDVL VFLADHLAEQ
260 270 280 290 300
LTLLDAELFL NLIPSQCLGG LWGHRDRPGH SHLCPSVRAT VTQFNKVAGA
310 320 330 340 350
VVSSVLGATS TGEGPGEVTI RPLRPPQRAR LLEKWIRVAE ECRLLRNFSS
360 370 380 390 400
VYAVVSALQS SPIHRLRAAW GEATRDSLRV FSSLCQIFSE EDNYSQSREL
410 420 430 440 450
LVQEVKLQSP LEPHSKKAPR SGSRGGGVVP YLGTFLKDLV MLDAASKDEL
460 470 480 490 500
ENGYINFDKR RKEFAVLSEL RRLQNECRGY NLQPDHDIQR WLQGLRPLTE
510 520 530 540 550
AQSHRVSCEV EPPGSSDPPA PRVLRPTLVI SQWTEVLGSV GVPTPLVSCD
560 570 580 590 600
RPSTGGDEAP TTPAPLLTRL AQHMKWPSVS SLDSALESSP SLHSPADPSH
610 620 630 640 650
LSPPASSPRP SRGHRRSASC GSPLSGGAEE ASGGTGYGGE GSGPGASDCR
660 670 680 690 700
IIRVQMELGE DGSVYKSILV TSQDKAPSVI SRVLKKNNRD SAVASEYELV
710 720 730 740 750
QLLPGERELT IPASANVFYA MDGASHDFLL RQRRRSSTAT PGVTSGPSAS
760 770
GTPPSEGGGG SFPRIKATGR KIARALF
Length:777
Mass (Da):83,549
Last modified:January 1, 1998 - v1
Checksum:i91AFBAB4D6CEE4A1
GO
Isoform 2 (identifier: O15211-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-82: Missing.
     462-462: K → KVSGVSGLDAGLPYPCSRKGRGKSQGSLSFGSCSLRAPSQ
     504-777: Missing.

Note: No experimental confirmation available.

Show »
Length:460
Mass (Da):50,224
Checksum:i131449D7441590D0
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti503 – 5031S → R in BAG57683 (PubMed:14702039).Curated
Sequence conflicti720 – 7201A → P in BAA75926 (PubMed:8976381).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti598 – 5981P → L.
Corresponds to variant rs34022110 [ dbSNP | Ensembl ].
VAR_051903
Natural varianti705 – 7051G → E.
Corresponds to variant rs35273540 [ dbSNP | Ensembl ].
VAR_051904

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 8282Missing in isoform 2. 1 PublicationVSP_055847Add
BLAST
Alternative sequencei462 – 4621K → KVSGVSGLDAGLPYPCSRKG RGKSQGSLSFGSCSLRAPSQ in isoform 2. 1 PublicationVSP_055848
Alternative sequencei504 – 777274Missing in isoform 2. 1 PublicationVSP_055849Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z97184 Genomic DNA. Translation: CAB09992.1.
AL050259 mRNA. Translation: CAB43361.1.
AK294442 mRNA. Translation: BAG57683.1.
AL662827 Genomic DNA. Translation: CAI17521.1.
AL662820 Genomic DNA. Translation: CAI18118.1.
BX000343 Genomic DNA. Translation: CAI41832.1.
CR759817 Genomic DNA. Translation: CAQ08027.1.
CR759786 Genomic DNA. Translation: CAQ08257.1.
CH471081 Genomic DNA. Translation: EAX03709.1.
BC032681 mRNA. Translation: AAH32681.1.
D85757 mRNA. Translation: BAA75926.1.
CCDSiCCDS4774.1. [O15211-1]
PIRiT08659.
RefSeqiNP_001230667.1. NM_001243738.1.
NP_004752.1. NM_004761.4. [O15211-1]
UniGeneiHs.509622.

Genome annotation databases

EnsembliENST00000383204; ENSP00000372691; ENSG00000206282. [O15211-1]
ENST00000413136; ENSP00000407088; ENSG00000224841. [O15211-1]
ENST00000416548; ENSP00000412152; ENSG00000228736. [O15211-1]
ENST00000452084; ENSP00000390098; ENSG00000237825. [O15211-1]
ENST00000497454; ENSP00000420211; ENSG00000237441. [O15211-1]
GeneIDi5863.
KEGGihsa:5863.
UCSCiuc003odv.3. human. [O15211-1]
uc011drb.2. human.

Polymorphism and mutation databases

BioMutaiRGL2.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z97184 Genomic DNA. Translation: CAB09992.1.
AL050259 mRNA. Translation: CAB43361.1.
AK294442 mRNA. Translation: BAG57683.1.
AL662827 Genomic DNA. Translation: CAI17521.1.
AL662820 Genomic DNA. Translation: CAI18118.1.
BX000343 Genomic DNA. Translation: CAI41832.1.
CR759817 Genomic DNA. Translation: CAQ08027.1.
CR759786 Genomic DNA. Translation: CAQ08257.1.
CH471081 Genomic DNA. Translation: EAX03709.1.
BC032681 mRNA. Translation: AAH32681.1.
D85757 mRNA. Translation: BAA75926.1.
CCDSiCCDS4774.1. [O15211-1]
PIRiT08659.
RefSeqiNP_001230667.1. NM_001243738.1.
NP_004752.1. NM_004761.4. [O15211-1]
UniGeneiHs.509622.

3D structure databases

ProteinModelPortaliO15211.
SMRiO15211. Positions 53-514, 645-734.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111801. 15 interactions.
IntActiO15211. 14 interactions.
STRINGi9606.ENSP00000407088.

PTM databases

PhosphoSiteiO15211.

Polymorphism and mutation databases

BioMutaiRGL2.

Proteomic databases

MaxQBiO15211.
PaxDbiO15211.
PRIDEiO15211.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000383204; ENSP00000372691; ENSG00000206282. [O15211-1]
ENST00000413136; ENSP00000407088; ENSG00000224841. [O15211-1]
ENST00000416548; ENSP00000412152; ENSG00000228736. [O15211-1]
ENST00000452084; ENSP00000390098; ENSG00000237825. [O15211-1]
ENST00000497454; ENSP00000420211; ENSG00000237441. [O15211-1]
GeneIDi5863.
KEGGihsa:5863.
UCSCiuc003odv.3. human. [O15211-1]
uc011drb.2. human.

Organism-specific databases

CTDi5863.
GeneCardsiGC06M033259.
GC06Mj33181.
GC06Mk33237.
GC06Mm33429.
GC06Mn33188.
HGNCiHGNC:9769. RGL2.
HPAiHPA053444.
MIMi602306. gene.
neXtProtiNX_O15211.
PharmGKBiPA34120.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG298772.
GeneTreeiENSGT00780000121844.
HOGENOMiHOG000231592.
HOVERGENiHBG005864.
InParanoidiO15211.
KOiK17636.
OMAiVFYAMDG.
PhylomeDBiO15211.
TreeFamiTF315204.

Miscellaneous databases

ChiTaRSiRGL2. human.
GeneWikiiRGL2.
GenomeRNAii5863.
NextBioi22770.
PROiO15211.
SOURCEiSearch...

Gene expression databases

BgeeiO15211.
CleanExiHS_RGL2.
ExpressionAtlasiO15211. baseline and differential.
GenevestigatoriO15211.

Family and domain databases

Gene3Di1.10.840.10. 1 hit.
InterProiIPR000159. Ras-assoc.
IPR000651. Ras-like_Gua-exchang_fac_N.
IPR019804. Ras_G-nucl-exch_fac_CS.
IPR023578. Ras_GEF_dom.
IPR001895. RASGEF_cat_dom.
IPR030749. RGL2.
IPR029071. Ubiquitin-rel_dom.
[Graphical view]
PANTHERiPTHR23113:SF159. PTHR23113:SF159. 1 hit.
PfamiPF00788. RA. 1 hit.
PF00617. RasGEF. 1 hit.
PF00618. RasGEF_N. 1 hit.
[Graphical view]
SMARTiSM00314. RA. 1 hit.
SM00147. RasGEF. 1 hit.
SM00229. RasGEFN. 1 hit.
[Graphical view]
SUPFAMiSSF48366. SSF48366. 1 hit.
SSF54236. SSF54236. 1 hit.
PROSITEiPS50200. RA. 1 hit.
PS00720. RASGEF. 1 hit.
PS50009. RASGEF_CAT. 1 hit.
PS50212. RASGEF_NTER. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "TAPASIN, DAXX, RGL2, HKE2 and four new genes (BING 1, 3 to 5) form a dense cluster at the centromeric end of the MHC."
    Herberg J.A., Beck S., Trowsdale J.
    J. Mol. Biol. 277:839-857(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Amygdala.
  4. "The DNA sequence and analysis of human chromosome 6."
    Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
    Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Testis.
  7. "Isolation and mapping of RAB2L, a human cDNA that encodes a protein homologous to RalGDS."
    Isomura M., Okui K., Fujiwara T., Shin S., Nakamura Y.
    Cytogenet. Cell Genet. 74:263-265(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 656-777 (ISOFORM 1).
  8. "A probability-based approach for high-throughput protein phosphorylation analysis and site localization."
    Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P.
    Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  10. "Functional characterization of SAMD9, a protein deficient in normophosphatemic familial tumoral calcinosis."
    Hershkovitz D., Gross Y., Nahum S., Yehezkel S., Sarig O., Uitto J., Sprecher E.
    J. Invest. Dermatol. 131:662-669(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH SAMD9.
  11. "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome."
    Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.
    J. Proteomics 96:253-262(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.

Entry informationi

Entry nameiRGL2_HUMAN
AccessioniPrimary (citable) accession number: O15211
Secondary accession number(s): B4DG72, Q5STK0, Q9Y3F3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: January 1, 1998
Last modified: April 29, 2015
This is version 136 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.