Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O15211

- RGL2_HUMAN

UniProt

O15211 - RGL2_HUMAN

Protein

Ral guanine nucleotide dissociation stimulator-like 2

Gene

RGL2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 130 (01 Oct 2014)
      Sequence version 1 (01 Jan 1998)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Probable guanine nucleotide exchange factor. Putative effector of Ras and/or Rap. Associates with the GTP-bound form of Rap 1A and H-Ras in vitro By similarity.By similarity

    GO - Molecular functioni

    1. guanyl-nucleotide exchange factor activity Source: UniProtKB-KW
    2. Ras guanyl-nucleotide exchange factor activity Source: UniProtKB

    GO - Biological processi

    1. positive regulation of Ras GTPase activity Source: GOC
    2. Ras protein signal transduction Source: UniProtKB
    3. regulation of small GTPase mediated signal transduction Source: InterPro
    4. small GTPase mediated signal transduction Source: InterPro

    Keywords - Molecular functioni

    Guanine-nucleotide releasing factor

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Ral guanine nucleotide dissociation stimulator-like 2
    Short name:
    RalGDS-like 2
    Alternative name(s):
    RalGDS-like factor
    Ras-associated protein RAB2L
    Gene namesi
    Name:RGL2
    Synonyms:RAB2L
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 6

    Organism-specific databases

    HGNCiHGNC:9769. RGL2.

    Subcellular locationi

    GO - Cellular componenti

    1. intracellular Source: InterPro

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA34120.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 777777Ral guanine nucleotide dissociation stimulator-like 2PRO_0000068888Add
    BLAST

    Proteomic databases

    MaxQBiO15211.
    PaxDbiO15211.
    PRIDEiO15211.

    PTM databases

    PhosphoSiteiO15211.

    Expressioni

    Gene expression databases

    ArrayExpressiO15211.
    BgeeiO15211.
    CleanExiHS_RGL2.
    GenevestigatoriO15211.

    Organism-specific databases

    HPAiHPA053444.

    Interactioni

    Subunit structurei

    Interacts with SAMD9.1 Publication

    Protein-protein interaction databases

    BioGridi111801. 14 interactions.
    IntActiO15211. 13 interactions.
    STRINGi9606.ENSP00000407088.

    Structurei

    3D structure databases

    ProteinModelPortaliO15211.
    SMRiO15211. Positions 53-514, 645-734.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini88 – 212125N-terminal Ras-GEFPROSITE-ProRule annotationAdd
    BLAST
    Domaini243 – 513271Ras-GEFPROSITE-ProRule annotationAdd
    BLAST
    Domaini648 – 73588Ras-associatingPROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 1 N-terminal Ras-GEF domain.PROSITE-ProRule annotation
    Contains 1 Ras-associating domain.PROSITE-ProRule annotation
    Contains 1 Ras-GEF domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiNOG298772.
    HOGENOMiHOG000231592.
    HOVERGENiHBG005864.
    InParanoidiO15211.
    KOiK17636.
    OMAiVFYAMDG.
    PhylomeDBiO15211.
    TreeFamiTF315204.

    Family and domain databases

    Gene3Di1.10.840.10. 1 hit.
    InterProiIPR000159. Ras-assoc.
    IPR000651. Ras-like_Gua-exchang_fac_N.
    IPR019804. Ras_G-nucl-exch_fac_CS.
    IPR023578. Ras_GEF_dom.
    IPR001895. RasGRF_CDC25.
    IPR029071. Ubiquitin-rel_dom.
    [Graphical view]
    PfamiPF00788. RA. 1 hit.
    PF00617. RasGEF. 1 hit.
    PF00618. RasGEF_N. 1 hit.
    [Graphical view]
    SMARTiSM00314. RA. 1 hit.
    SM00147. RasGEF. 1 hit.
    SM00229. RasGEFN. 1 hit.
    [Graphical view]
    SUPFAMiSSF48366. SSF48366. 1 hit.
    SSF54236. SSF54236. 1 hit.
    PROSITEiPS50200. RA. 1 hit.
    PS00720. RASGEF. 1 hit.
    PS50009. RASGEF_CAT. 1 hit.
    PS50212. RASGEF_NTER. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O15211-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MLPRPLRLLL DTSPPGGVVL SSFRSRDPEE GGGPGGLVVG GGQEEEEEEE    50
    EEAPVSVWDE EEDGAVFTVT SRQYRPLDPL VPMPPPRSSR RLRAGTLEAL 100
    VRHLLDTRTS GTDVSFMSAF LATHRAFTST PALLGLMADR LEALESHPTD 150
    ELERTTEVAI SVLSTWLASH PEDFGSEAKG QLDRLESFLL QTGYAAGKGV 200
    GGGSADLIRN LRSRVDPQAP DLPKPLALPG DPPADPTDVL VFLADHLAEQ 250
    LTLLDAELFL NLIPSQCLGG LWGHRDRPGH SHLCPSVRAT VTQFNKVAGA 300
    VVSSVLGATS TGEGPGEVTI RPLRPPQRAR LLEKWIRVAE ECRLLRNFSS 350
    VYAVVSALQS SPIHRLRAAW GEATRDSLRV FSSLCQIFSE EDNYSQSREL 400
    LVQEVKLQSP LEPHSKKAPR SGSRGGGVVP YLGTFLKDLV MLDAASKDEL 450
    ENGYINFDKR RKEFAVLSEL RRLQNECRGY NLQPDHDIQR WLQGLRPLTE 500
    AQSHRVSCEV EPPGSSDPPA PRVLRPTLVI SQWTEVLGSV GVPTPLVSCD 550
    RPSTGGDEAP TTPAPLLTRL AQHMKWPSVS SLDSALESSP SLHSPADPSH 600
    LSPPASSPRP SRGHRRSASC GSPLSGGAEE ASGGTGYGGE GSGPGASDCR 650
    IIRVQMELGE DGSVYKSILV TSQDKAPSVI SRVLKKNNRD SAVASEYELV 700
    QLLPGERELT IPASANVFYA MDGASHDFLL RQRRRSSTAT PGVTSGPSAS 750
    GTPPSEGGGG SFPRIKATGR KIARALF 777
    Length:777
    Mass (Da):83,549
    Last modified:January 1, 1998 - v1
    Checksum:i91AFBAB4D6CEE4A1
    GO
    Isoform 2 (identifier: O15211-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-82: Missing.
         462-462: K → KVSGVSGLDAGLPYPCSRKGRGKSQGSLSFGSCSLRAPSQ
         504-777: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:460
    Mass (Da):50,224
    Checksum:i131449D7441590D0
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti503 – 5031S → R in BAG57683. (PubMed:14702039)Curated
    Sequence conflicti720 – 7201A → P in BAA75926. (PubMed:8976381)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti598 – 5981P → L.
    Corresponds to variant rs34022110 [ dbSNP | Ensembl ].
    VAR_051903
    Natural varianti705 – 7051G → E.
    Corresponds to variant rs35273540 [ dbSNP | Ensembl ].
    VAR_051904

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 8282Missing in isoform 2. 1 PublicationVSP_055847Add
    BLAST
    Alternative sequencei462 – 4621K → KVSGVSGLDAGLPYPCSRKG RGKSQGSLSFGSCSLRAPSQ in isoform 2. 1 PublicationVSP_055848
    Alternative sequencei504 – 777274Missing in isoform 2. 1 PublicationVSP_055849Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    Z97184 Genomic DNA. Translation: CAB09992.1.
    AL050259 mRNA. Translation: CAB43361.1.
    AK294442 mRNA. Translation: BAG57683.1.
    AL662827 Genomic DNA. Translation: CAI17521.1.
    AL662820 Genomic DNA. Translation: CAI18118.1.
    BX000343 Genomic DNA. Translation: CAI41832.1.
    CR759817 Genomic DNA. Translation: CAQ08027.1.
    CR759786 Genomic DNA. Translation: CAQ08257.1.
    CH471081 Genomic DNA. Translation: EAX03709.1.
    BC032681 mRNA. Translation: AAH32681.1.
    D85757 mRNA. Translation: BAA75926.1.
    CCDSiCCDS4774.1.
    PIRiT08659.
    RefSeqiNP_001230667.1. NM_001243738.1.
    NP_004752.1. NM_004761.4.
    UniGeneiHs.509622.

    Genome annotation databases

    EnsembliENST00000383204; ENSP00000372691; ENSG00000206282. [O15211-1]
    ENST00000413136; ENSP00000407088; ENSG00000224841. [O15211-1]
    ENST00000416548; ENSP00000412152; ENSG00000228736. [O15211-1]
    ENST00000452084; ENSP00000390098; ENSG00000237825. [O15211-1]
    ENST00000497454; ENSP00000420211; ENSG00000237441. [O15211-1]
    GeneIDi5863.
    KEGGihsa:5863.
    UCSCiuc003odv.3. human.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    Z97184 Genomic DNA. Translation: CAB09992.1 .
    AL050259 mRNA. Translation: CAB43361.1 .
    AK294442 mRNA. Translation: BAG57683.1 .
    AL662827 Genomic DNA. Translation: CAI17521.1 .
    AL662820 Genomic DNA. Translation: CAI18118.1 .
    BX000343 Genomic DNA. Translation: CAI41832.1 .
    CR759817 Genomic DNA. Translation: CAQ08027.1 .
    CR759786 Genomic DNA. Translation: CAQ08257.1 .
    CH471081 Genomic DNA. Translation: EAX03709.1 .
    BC032681 mRNA. Translation: AAH32681.1 .
    D85757 mRNA. Translation: BAA75926.1 .
    CCDSi CCDS4774.1.
    PIRi T08659.
    RefSeqi NP_001230667.1. NM_001243738.1.
    NP_004752.1. NM_004761.4.
    UniGenei Hs.509622.

    3D structure databases

    ProteinModelPortali O15211.
    SMRi O15211. Positions 53-514, 645-734.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 111801. 14 interactions.
    IntActi O15211. 13 interactions.
    STRINGi 9606.ENSP00000407088.

    PTM databases

    PhosphoSitei O15211.

    Proteomic databases

    MaxQBi O15211.
    PaxDbi O15211.
    PRIDEi O15211.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000383204 ; ENSP00000372691 ; ENSG00000206282 . [O15211-1 ]
    ENST00000413136 ; ENSP00000407088 ; ENSG00000224841 . [O15211-1 ]
    ENST00000416548 ; ENSP00000412152 ; ENSG00000228736 . [O15211-1 ]
    ENST00000452084 ; ENSP00000390098 ; ENSG00000237825 . [O15211-1 ]
    ENST00000497454 ; ENSP00000420211 ; ENSG00000237441 . [O15211-1 ]
    GeneIDi 5863.
    KEGGi hsa:5863.
    UCSCi uc003odv.3. human.

    Organism-specific databases

    CTDi 5863.
    GeneCardsi GC06M033259.
    GC06Mj33181.
    GC06Mk33237.
    GC06Mm33429.
    GC06Mn33188.
    HGNCi HGNC:9769. RGL2.
    HPAi HPA053444.
    MIMi 602306. gene.
    neXtProti NX_O15211.
    PharmGKBi PA34120.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG298772.
    HOGENOMi HOG000231592.
    HOVERGENi HBG005864.
    InParanoidi O15211.
    KOi K17636.
    OMAi VFYAMDG.
    PhylomeDBi O15211.
    TreeFami TF315204.

    Miscellaneous databases

    GeneWikii RGL2.
    GenomeRNAii 5863.
    NextBioi 22770.
    PROi O15211.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O15211.
    Bgeei O15211.
    CleanExi HS_RGL2.
    Genevestigatori O15211.

    Family and domain databases

    Gene3Di 1.10.840.10. 1 hit.
    InterProi IPR000159. Ras-assoc.
    IPR000651. Ras-like_Gua-exchang_fac_N.
    IPR019804. Ras_G-nucl-exch_fac_CS.
    IPR023578. Ras_GEF_dom.
    IPR001895. RasGRF_CDC25.
    IPR029071. Ubiquitin-rel_dom.
    [Graphical view ]
    Pfami PF00788. RA. 1 hit.
    PF00617. RasGEF. 1 hit.
    PF00618. RasGEF_N. 1 hit.
    [Graphical view ]
    SMARTi SM00314. RA. 1 hit.
    SM00147. RasGEF. 1 hit.
    SM00229. RasGEFN. 1 hit.
    [Graphical view ]
    SUPFAMi SSF48366. SSF48366. 1 hit.
    SSF54236. SSF54236. 1 hit.
    PROSITEi PS50200. RA. 1 hit.
    PS00720. RASGEF. 1 hit.
    PS50009. RASGEF_CAT. 1 hit.
    PS50212. RASGEF_NTER. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "TAPASIN, DAXX, RGL2, HKE2 and four new genes (BING 1, 3 to 5) form a dense cluster at the centromeric end of the MHC."
      Herberg J.A., Beck S., Trowsdale J.
      J. Mol. Biol. 277:839-857(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Amygdala.
    4. "The DNA sequence and analysis of human chromosome 6."
      Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
      , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
      Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Testis.
    7. "Isolation and mapping of RAB2L, a human cDNA that encodes a protein homologous to RalGDS."
      Isomura M., Okui K., Fujiwara T., Shin S., Nakamura Y.
      Cytogenet. Cell Genet. 74:263-265(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 656-777 (ISOFORM 1).
    8. "A probability-based approach for high-throughput protein phosphorylation analysis and site localization."
      Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P.
      Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    9. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    10. "Functional characterization of SAMD9, a protein deficient in normophosphatemic familial tumoral calcinosis."
      Hershkovitz D., Gross Y., Nahum S., Yehezkel S., Sarig O., Uitto J., Sprecher E.
      J. Invest. Dermatol. 131:662-669(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH SAMD9.

    Entry informationi

    Entry nameiRGL2_HUMAN
    AccessioniPrimary (citable) accession number: O15211
    Secondary accession number(s): B4DG72, Q5STK0, Q9Y3F3
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 30, 2000
    Last sequence update: January 1, 1998
    Last modified: October 1, 2014
    This is version 130 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 6
      Human chromosome 6: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3