Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ral guanine nucleotide dissociation stimulator-like 2

Gene

RGL2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Probable guanine nucleotide exchange factor. Putative effector of Ras and/or Rap. Associates with the GTP-bound form of Rap 1A and H-Ras in vitro (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Guanine-nucleotide releasing factor

Enzyme and pathway databases

BioCyciZFISH:ENSG00000056687-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Ral guanine nucleotide dissociation stimulator-like 2
Short name:
RalGDS-like 2
Alternative name(s):
RalGDS-like factor
Ras-associated protein RAB2L
Gene namesi
Name:RGL2
Synonyms:RAB2L
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:9769. RGL2.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

DisGeNETi5863.
OpenTargetsiENSG00000206282.
ENSG00000224841.
ENSG00000228736.
ENSG00000237441.
ENSG00000237825.
PharmGKBiPA34120.

Polymorphism and mutation databases

BioMutaiRGL2.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000688881 – 777Ral guanine nucleotide dissociation stimulator-like 2Add BLAST777

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei13PhosphoserineCombined sources1
Modified residuei409PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiO15211.
MaxQBiO15211.
PaxDbiO15211.
PeptideAtlasiO15211.
PRIDEiO15211.

PTM databases

iPTMnetiO15211.
PhosphoSitePlusiO15211.

Expressioni

Gene expression databases

BgeeiENSG00000237441.
CleanExiHS_RGL2.
ExpressionAtlasiO15211. baseline and differential.
GenevisibleiO15211. HS.

Organism-specific databases

HPAiHPA053444.

Interactioni

Subunit structurei

Interacts with SAMD9.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
NOTCH2NLQ7Z3S93EBI-712355,EBI-945833

Protein-protein interaction databases

BioGridi111801. 14 interactors.
IntActiO15211. 18 interactors.
STRINGi9606.ENSP00000420211.

Structurei

3D structure databases

ProteinModelPortaliO15211.
SMRiO15211.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini88 – 212N-terminal Ras-GEFPROSITE-ProRule annotationAdd BLAST125
Domaini243 – 513Ras-GEFPROSITE-ProRule annotationAdd BLAST271
Domaini648 – 735Ras-associatingPROSITE-ProRule annotationAdd BLAST88

Sequence similaritiesi

Contains 1 N-terminal Ras-GEF domain.PROSITE-ProRule annotation
Contains 1 Ras-associating domain.PROSITE-ProRule annotation
Contains 1 Ras-GEF domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiENOG410ITRE. Eukaryota.
ENOG4110VI4. LUCA.
GeneTreeiENSGT00860000133700.
HOGENOMiHOG000231592.
HOVERGENiHBG005864.
InParanoidiO15211.
KOiK17636.
OMAiNLVPSQC.
OrthoDBiEOG091G0761.
PhylomeDBiO15211.
TreeFamiTF315204.

Family and domain databases

CDDicd00155. RasGEF. 1 hit.
cd06224. REM. 1 hit.
Gene3Di1.10.840.10. 1 hit.
InterProiIPR000159. RA_dom.
IPR000651. Ras-like_Gua-exchang_fac_N.
IPR019804. Ras_G-nucl-exch_fac_CS.
IPR023578. Ras_GEF_dom.
IPR001895. RASGEF_cat_dom.
IPR029071. Ubiquitin-rel_dom.
[Graphical view]
PfamiPF00788. RA. 1 hit.
PF00617. RasGEF. 1 hit.
PF00618. RasGEF_N. 1 hit.
[Graphical view]
SMARTiSM00314. RA. 1 hit.
SM00147. RasGEF. 1 hit.
SM00229. RasGEFN. 1 hit.
[Graphical view]
SUPFAMiSSF48366. SSF48366. 1 hit.
SSF54236. SSF54236. 1 hit.
PROSITEiPS50200. RA. 1 hit.
PS00720. RASGEF. 1 hit.
PS50009. RASGEF_CAT. 1 hit.
PS50212. RASGEF_NTER. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O15211-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLPRPLRLLL DTSPPGGVVL SSFRSRDPEE GGGPGGLVVG GGQEEEEEEE
60 70 80 90 100
EEAPVSVWDE EEDGAVFTVT SRQYRPLDPL VPMPPPRSSR RLRAGTLEAL
110 120 130 140 150
VRHLLDTRTS GTDVSFMSAF LATHRAFTST PALLGLMADR LEALESHPTD
160 170 180 190 200
ELERTTEVAI SVLSTWLASH PEDFGSEAKG QLDRLESFLL QTGYAAGKGV
210 220 230 240 250
GGGSADLIRN LRSRVDPQAP DLPKPLALPG DPPADPTDVL VFLADHLAEQ
260 270 280 290 300
LTLLDAELFL NLIPSQCLGG LWGHRDRPGH SHLCPSVRAT VTQFNKVAGA
310 320 330 340 350
VVSSVLGATS TGEGPGEVTI RPLRPPQRAR LLEKWIRVAE ECRLLRNFSS
360 370 380 390 400
VYAVVSALQS SPIHRLRAAW GEATRDSLRV FSSLCQIFSE EDNYSQSREL
410 420 430 440 450
LVQEVKLQSP LEPHSKKAPR SGSRGGGVVP YLGTFLKDLV MLDAASKDEL
460 470 480 490 500
ENGYINFDKR RKEFAVLSEL RRLQNECRGY NLQPDHDIQR WLQGLRPLTE
510 520 530 540 550
AQSHRVSCEV EPPGSSDPPA PRVLRPTLVI SQWTEVLGSV GVPTPLVSCD
560 570 580 590 600
RPSTGGDEAP TTPAPLLTRL AQHMKWPSVS SLDSALESSP SLHSPADPSH
610 620 630 640 650
LSPPASSPRP SRGHRRSASC GSPLSGGAEE ASGGTGYGGE GSGPGASDCR
660 670 680 690 700
IIRVQMELGE DGSVYKSILV TSQDKAPSVI SRVLKKNNRD SAVASEYELV
710 720 730 740 750
QLLPGERELT IPASANVFYA MDGASHDFLL RQRRRSSTAT PGVTSGPSAS
760 770
GTPPSEGGGG SFPRIKATGR KIARALF
Length:777
Mass (Da):83,549
Last modified:January 1, 1998 - v1
Checksum:i91AFBAB4D6CEE4A1
GO
Isoform 2 (identifier: O15211-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-82: Missing.
     462-462: K → KVSGVSGLDAGLPYPCSRKGRGKSQGSLSFGSCSLRAPSQ
     504-777: Missing.

Note: No experimental confirmation available.
Show »
Length:460
Mass (Da):50,224
Checksum:i131449D7441590D0
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti503S → R in BAG57683 (PubMed:14702039).Curated1
Sequence conflicti720A → P in BAA75926 (PubMed:8976381).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_051903598P → L.Corresponds to variant rs34022110dbSNPEnsembl.1
Natural variantiVAR_051904705G → E.Corresponds to variant rs35273540dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0558471 – 82Missing in isoform 2. 1 PublicationAdd BLAST82
Alternative sequenceiVSP_055848462K → KVSGVSGLDAGLPYPCSRKG RGKSQGSLSFGSCSLRAPSQ in isoform 2. 1 Publication1
Alternative sequenceiVSP_055849504 – 777Missing in isoform 2. 1 PublicationAdd BLAST274

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z97184 Genomic DNA. Translation: CAB09992.1.
AL050259 mRNA. Translation: CAB43361.1.
AK294442 mRNA. Translation: BAG57683.1.
AL662827 Genomic DNA. Translation: CAI17521.1.
AL662820 Genomic DNA. Translation: CAI18118.1.
BX000343 Genomic DNA. Translation: CAI41832.1.
CR759817 Genomic DNA. Translation: CAQ08027.1.
CR759786 Genomic DNA. Translation: CAQ08257.1.
CH471081 Genomic DNA. Translation: EAX03709.1.
BC032681 mRNA. Translation: AAH32681.1.
D85757 mRNA. Translation: BAA75926.1.
CCDSiCCDS4774.1. [O15211-1]
PIRiT08659.
RefSeqiNP_001230667.1. NM_001243738.1.
NP_004752.1. NM_004761.4. [O15211-1]
UniGeneiHs.509622.

Genome annotation databases

EnsembliENST00000383204; ENSP00000372691; ENSG00000206282. [O15211-1]
ENST00000413136; ENSP00000407088; ENSG00000224841. [O15211-1]
ENST00000416548; ENSP00000412152; ENSG00000228736. [O15211-1]
ENST00000452084; ENSP00000390098; ENSG00000237825. [O15211-1]
ENST00000497454; ENSP00000420211; ENSG00000237441. [O15211-1]
GeneIDi5863.
KEGGihsa:5863.
UCSCiuc003odv.4. human. [O15211-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z97184 Genomic DNA. Translation: CAB09992.1.
AL050259 mRNA. Translation: CAB43361.1.
AK294442 mRNA. Translation: BAG57683.1.
AL662827 Genomic DNA. Translation: CAI17521.1.
AL662820 Genomic DNA. Translation: CAI18118.1.
BX000343 Genomic DNA. Translation: CAI41832.1.
CR759817 Genomic DNA. Translation: CAQ08027.1.
CR759786 Genomic DNA. Translation: CAQ08257.1.
CH471081 Genomic DNA. Translation: EAX03709.1.
BC032681 mRNA. Translation: AAH32681.1.
D85757 mRNA. Translation: BAA75926.1.
CCDSiCCDS4774.1. [O15211-1]
PIRiT08659.
RefSeqiNP_001230667.1. NM_001243738.1.
NP_004752.1. NM_004761.4. [O15211-1]
UniGeneiHs.509622.

3D structure databases

ProteinModelPortaliO15211.
SMRiO15211.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111801. 14 interactors.
IntActiO15211. 18 interactors.
STRINGi9606.ENSP00000420211.

PTM databases

iPTMnetiO15211.
PhosphoSitePlusiO15211.

Polymorphism and mutation databases

BioMutaiRGL2.

Proteomic databases

EPDiO15211.
MaxQBiO15211.
PaxDbiO15211.
PeptideAtlasiO15211.
PRIDEiO15211.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000383204; ENSP00000372691; ENSG00000206282. [O15211-1]
ENST00000413136; ENSP00000407088; ENSG00000224841. [O15211-1]
ENST00000416548; ENSP00000412152; ENSG00000228736. [O15211-1]
ENST00000452084; ENSP00000390098; ENSG00000237825. [O15211-1]
ENST00000497454; ENSP00000420211; ENSG00000237441. [O15211-1]
GeneIDi5863.
KEGGihsa:5863.
UCSCiuc003odv.4. human. [O15211-1]

Organism-specific databases

CTDi5863.
DisGeNETi5863.
GeneCardsiRGL2.
HGNCiHGNC:9769. RGL2.
HPAiHPA053444.
MIMi602306. gene.
neXtProtiNX_O15211.
OpenTargetsiENSG00000206282.
ENSG00000224841.
ENSG00000228736.
ENSG00000237441.
ENSG00000237825.
PharmGKBiPA34120.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410ITRE. Eukaryota.
ENOG4110VI4. LUCA.
GeneTreeiENSGT00860000133700.
HOGENOMiHOG000231592.
HOVERGENiHBG005864.
InParanoidiO15211.
KOiK17636.
OMAiNLVPSQC.
OrthoDBiEOG091G0761.
PhylomeDBiO15211.
TreeFamiTF315204.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000056687-MONOMER.

Miscellaneous databases

ChiTaRSiRGL2. human.
GeneWikiiRGL2.
GenomeRNAii5863.
PROiO15211.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000237441.
CleanExiHS_RGL2.
ExpressionAtlasiO15211. baseline and differential.
GenevisibleiO15211. HS.

Family and domain databases

CDDicd00155. RasGEF. 1 hit.
cd06224. REM. 1 hit.
Gene3Di1.10.840.10. 1 hit.
InterProiIPR000159. RA_dom.
IPR000651. Ras-like_Gua-exchang_fac_N.
IPR019804. Ras_G-nucl-exch_fac_CS.
IPR023578. Ras_GEF_dom.
IPR001895. RASGEF_cat_dom.
IPR029071. Ubiquitin-rel_dom.
[Graphical view]
PfamiPF00788. RA. 1 hit.
PF00617. RasGEF. 1 hit.
PF00618. RasGEF_N. 1 hit.
[Graphical view]
SMARTiSM00314. RA. 1 hit.
SM00147. RasGEF. 1 hit.
SM00229. RasGEFN. 1 hit.
[Graphical view]
SUPFAMiSSF48366. SSF48366. 1 hit.
SSF54236. SSF54236. 1 hit.
PROSITEiPS50200. RA. 1 hit.
PS00720. RASGEF. 1 hit.
PS50009. RASGEF_CAT. 1 hit.
PS50212. RASGEF_NTER. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiRGL2_HUMAN
AccessioniPrimary (citable) accession number: O15211
Secondary accession number(s): B4DG72, Q5STK0, Q9Y3F3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: January 1, 1998
Last modified: November 30, 2016
This is version 149 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.