SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O15211

- RGL2_HUMAN

UniProt

O15211 - RGL2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Ral guanine nucleotide dissociation stimulator-like 2
Gene
RGL2, RAB2L
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5 - Experimental evidence at protein leveli

Functioni

Probable guanine nucleotide exchange factor. Putative effector of Ras and/or Rap. Associates with the GTP-bound form of Rap 1A and H-Ras in vitro By similarity.

GO - Molecular functioni

  1. Ras guanyl-nucleotide exchange factor activity Source: UniProtKB

GO - Biological processi

  1. Ras protein signal transduction Source: UniProtKB
  2. regulation of Ras GTPase activity Source: GOC
Complete GO annotation...

Keywords - Molecular functioni

Guanine-nucleotide releasing factor

Names & Taxonomyi

Protein namesi
Recommended name:
Ral guanine nucleotide dissociation stimulator-like 2
Short name:
RalGDS-like 2
Alternative name(s):
RalGDS-like factor
Ras-associated protein RAB2L
Gene namesi
Name:RGL2
Synonyms:RAB2L
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 6

Organism-specific databases

HGNCiHGNC:9769. RGL2.

Subcellular locationi

GO - Cellular componenti

  1. intracellular Source: InterPro
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA34120.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 777777Ral guanine nucleotide dissociation stimulator-like 2
PRO_0000068888Add
BLAST

Proteomic databases

MaxQBiO15211.
PaxDbiO15211.
PRIDEiO15211.

PTM databases

PhosphoSiteiO15211.

Expressioni

Gene expression databases

ArrayExpressiO15211.
BgeeiO15211.
CleanExiHS_RGL2.
GenevestigatoriO15211.

Organism-specific databases

HPAiHPA053444.

Interactioni

Subunit structurei

Interacts with SAMD9.1 Publication

Protein-protein interaction databases

BioGridi111801. 14 interactions.
IntActiO15211. 13 interactions.
STRINGi9606.ENSP00000407088.

Structurei

3D structure databases

ProteinModelPortaliO15211.
SMRiO15211. Positions 53-514, 645-734.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini88 – 212125N-terminal Ras-GEF
Add
BLAST
Domaini243 – 513271Ras-GEF
Add
BLAST
Domaini648 – 73588Ras-associating
Add
BLAST

Sequence similaritiesi

Contains 1 Ras-GEF domain.

Phylogenomic databases

eggNOGiNOG298772.
HOGENOMiHOG000231592.
HOVERGENiHBG005864.
InParanoidiO15211.
KOiK17636.
OMAiVFYAMDG.
PhylomeDBiO15211.
TreeFamiTF315204.

Family and domain databases

Gene3Di1.10.840.10. 1 hit.
InterProiIPR000159. Ras-assoc.
IPR000651. Ras-like_Gua-exchang_fac_N.
IPR019804. Ras_G-nucl-exch_fac_CS.
IPR023578. Ras_GEF_dom.
IPR001895. RasGRF_CDC25.
IPR029071. Ubiquitin-rel_dom.
[Graphical view]
PfamiPF00788. RA. 1 hit.
PF00617. RasGEF. 1 hit.
PF00618. RasGEF_N. 1 hit.
[Graphical view]
SMARTiSM00314. RA. 1 hit.
SM00147. RasGEF. 1 hit.
SM00229. RasGEFN. 1 hit.
[Graphical view]
SUPFAMiSSF48366. SSF48366. 1 hit.
SSF54236. SSF54236. 1 hit.
PROSITEiPS50200. RA. 1 hit.
PS00720. RASGEF. 1 hit.
PS50009. RASGEF_CAT. 1 hit.
PS50212. RASGEF_NTER. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O15211-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MLPRPLRLLL DTSPPGGVVL SSFRSRDPEE GGGPGGLVVG GGQEEEEEEE    50
EEAPVSVWDE EEDGAVFTVT SRQYRPLDPL VPMPPPRSSR RLRAGTLEAL 100
VRHLLDTRTS GTDVSFMSAF LATHRAFTST PALLGLMADR LEALESHPTD 150
ELERTTEVAI SVLSTWLASH PEDFGSEAKG QLDRLESFLL QTGYAAGKGV 200
GGGSADLIRN LRSRVDPQAP DLPKPLALPG DPPADPTDVL VFLADHLAEQ 250
LTLLDAELFL NLIPSQCLGG LWGHRDRPGH SHLCPSVRAT VTQFNKVAGA 300
VVSSVLGATS TGEGPGEVTI RPLRPPQRAR LLEKWIRVAE ECRLLRNFSS 350
VYAVVSALQS SPIHRLRAAW GEATRDSLRV FSSLCQIFSE EDNYSQSREL 400
LVQEVKLQSP LEPHSKKAPR SGSRGGGVVP YLGTFLKDLV MLDAASKDEL 450
ENGYINFDKR RKEFAVLSEL RRLQNECRGY NLQPDHDIQR WLQGLRPLTE 500
AQSHRVSCEV EPPGSSDPPA PRVLRPTLVI SQWTEVLGSV GVPTPLVSCD 550
RPSTGGDEAP TTPAPLLTRL AQHMKWPSVS SLDSALESSP SLHSPADPSH 600
LSPPASSPRP SRGHRRSASC GSPLSGGAEE ASGGTGYGGE GSGPGASDCR 650
IIRVQMELGE DGSVYKSILV TSQDKAPSVI SRVLKKNNRD SAVASEYELV 700
QLLPGERELT IPASANVFYA MDGASHDFLL RQRRRSSTAT PGVTSGPSAS 750
GTPPSEGGGG SFPRIKATGR KIARALF 777
Length:777
Mass (Da):83,549
Last modified:January 1, 1998 - v1
Checksum:i91AFBAB4D6CEE4A1
GO
Isoform 2 (identifier: O15211-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-82: Missing.
     462-462: K → KVSGVSGLDAGLPYPCSRKGRGKSQGSLSFGSCSLRAPSQ
     504-777: Missing.

Note: No experimental confirmation available.

Show »
Length:460
Mass (Da):50,224
Checksum:i131449D7441590D0
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti598 – 5981P → L.
Corresponds to variant rs34022110 [ dbSNP | Ensembl ].
VAR_051903
Natural varianti705 – 7051G → E.
Corresponds to variant rs35273540 [ dbSNP | Ensembl ].
VAR_051904

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 8282Missing in isoform 2.
VSP_055847Add
BLAST
Alternative sequencei462 – 4621K → KVSGVSGLDAGLPYPCSRKG RGKSQGSLSFGSCSLRAPSQ in isoform 2.
VSP_055848
Alternative sequencei504 – 777274Missing in isoform 2.
VSP_055849Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti503 – 5031S → R in BAG57683. 1 Publication
Sequence conflicti720 – 7201A → P in BAA75926. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
Z97184 Genomic DNA. Translation: CAB09992.1.
AL050259 mRNA. Translation: CAB43361.1.
AK294442 mRNA. Translation: BAG57683.1.
AL662827 Genomic DNA. Translation: CAI17521.1.
AL662820 Genomic DNA. Translation: CAI18118.1.
BX000343 Genomic DNA. Translation: CAI41832.1.
CR759817 Genomic DNA. Translation: CAQ08027.1.
CR759786 Genomic DNA. Translation: CAQ08257.1.
CH471081 Genomic DNA. Translation: EAX03709.1.
BC032681 mRNA. Translation: AAH32681.1.
D85757 mRNA. Translation: BAA75926.1.
CCDSiCCDS4774.1.
PIRiT08659.
RefSeqiNP_001230667.1. NM_001243738.1.
NP_004752.1. NM_004761.4.
UniGeneiHs.509622.

Genome annotation databases

EnsembliENST00000383204; ENSP00000372691; ENSG00000206282.
ENST00000413136; ENSP00000407088; ENSG00000224841.
ENST00000416548; ENSP00000412152; ENSG00000228736.
ENST00000444031; ENSP00000403070; ENSG00000237441.
ENST00000452084; ENSP00000390098; ENSG00000237825.
ENST00000497454; ENSP00000420211; ENSG00000237441.
GeneIDi5863.
KEGGihsa:5863.
UCSCiuc003odv.3. human.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
Z97184 Genomic DNA. Translation: CAB09992.1 .
AL050259 mRNA. Translation: CAB43361.1 .
AK294442 mRNA. Translation: BAG57683.1 .
AL662827 Genomic DNA. Translation: CAI17521.1 .
AL662820 Genomic DNA. Translation: CAI18118.1 .
BX000343 Genomic DNA. Translation: CAI41832.1 .
CR759817 Genomic DNA. Translation: CAQ08027.1 .
CR759786 Genomic DNA. Translation: CAQ08257.1 .
CH471081 Genomic DNA. Translation: EAX03709.1 .
BC032681 mRNA. Translation: AAH32681.1 .
D85757 mRNA. Translation: BAA75926.1 .
CCDSi CCDS4774.1.
PIRi T08659.
RefSeqi NP_001230667.1. NM_001243738.1.
NP_004752.1. NM_004761.4.
UniGenei Hs.509622.

3D structure databases

ProteinModelPortali O15211.
SMRi O15211. Positions 53-514, 645-734.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 111801. 14 interactions.
IntActi O15211. 13 interactions.
STRINGi 9606.ENSP00000407088.

PTM databases

PhosphoSitei O15211.

Proteomic databases

MaxQBi O15211.
PaxDbi O15211.
PRIDEi O15211.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000383204 ; ENSP00000372691 ; ENSG00000206282 .
ENST00000413136 ; ENSP00000407088 ; ENSG00000224841 .
ENST00000416548 ; ENSP00000412152 ; ENSG00000228736 .
ENST00000444031 ; ENSP00000403070 ; ENSG00000237441 .
ENST00000452084 ; ENSP00000390098 ; ENSG00000237825 .
ENST00000497454 ; ENSP00000420211 ; ENSG00000237441 .
GeneIDi 5863.
KEGGi hsa:5863.
UCSCi uc003odv.3. human.

Organism-specific databases

CTDi 5863.
GeneCardsi GC06M033259.
GC06Mj33181.
GC06Mk33237.
GC06Mm33429.
GC06Mn33188.
HGNCi HGNC:9769. RGL2.
HPAi HPA053444.
MIMi 602306. gene.
neXtProti NX_O15211.
PharmGKBi PA34120.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG298772.
HOGENOMi HOG000231592.
HOVERGENi HBG005864.
InParanoidi O15211.
KOi K17636.
OMAi VFYAMDG.
PhylomeDBi O15211.
TreeFami TF315204.

Miscellaneous databases

GeneWikii RGL2.
GenomeRNAii 5863.
NextBioi 22770.
PROi O15211.
SOURCEi Search...

Gene expression databases

ArrayExpressi O15211.
Bgeei O15211.
CleanExi HS_RGL2.
Genevestigatori O15211.

Family and domain databases

Gene3Di 1.10.840.10. 1 hit.
InterProi IPR000159. Ras-assoc.
IPR000651. Ras-like_Gua-exchang_fac_N.
IPR019804. Ras_G-nucl-exch_fac_CS.
IPR023578. Ras_GEF_dom.
IPR001895. RasGRF_CDC25.
IPR029071. Ubiquitin-rel_dom.
[Graphical view ]
Pfami PF00788. RA. 1 hit.
PF00617. RasGEF. 1 hit.
PF00618. RasGEF_N. 1 hit.
[Graphical view ]
SMARTi SM00314. RA. 1 hit.
SM00147. RasGEF. 1 hit.
SM00229. RasGEFN. 1 hit.
[Graphical view ]
SUPFAMi SSF48366. SSF48366. 1 hit.
SSF54236. SSF54236. 1 hit.
PROSITEi PS50200. RA. 1 hit.
PS00720. RASGEF. 1 hit.
PS50009. RASGEF_CAT. 1 hit.
PS50212. RASGEF_NTER. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "TAPASIN, DAXX, RGL2, HKE2 and four new genes (BING 1, 3 to 5) form a dense cluster at the centromeric end of the MHC."
    Herberg J.A., Beck S., Trowsdale J.
    J. Mol. Biol. 277:839-857(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Amygdala.
  4. "The DNA sequence and analysis of human chromosome 6."
    Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
    Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Testis.
  7. "Isolation and mapping of RAB2L, a human cDNA that encodes a protein homologous to RalGDS."
    Isomura M., Okui K., Fujiwara T., Shin S., Nakamura Y.
    Cytogenet. Cell Genet. 74:263-265(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 656-777 (ISOFORM 1).
  8. "A probability-based approach for high-throughput protein phosphorylation analysis and site localization."
    Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P.
    Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  10. "Functional characterization of SAMD9, a protein deficient in normophosphatemic familial tumoral calcinosis."
    Hershkovitz D., Gross Y., Nahum S., Yehezkel S., Sarig O., Uitto J., Sprecher E.
    J. Invest. Dermatol. 131:662-669(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH SAMD9.

Entry informationi

Entry nameiRGL2_HUMAN
AccessioniPrimary (citable) accession number: O15211
Secondary accession number(s): B4DG72, Q5STK0, Q9Y3F3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: January 1, 1998
Last modified: September 3, 2014
This is version 129 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi