Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Brachyury protein

Gene

T

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Involved in the transcriptional regulation of genes required for mesoderm formation and differentiation. Binds to a palindromic site (called T site) and activates gene transcription when bound to such a site.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi51 – 219T-boxPROSITE-ProRule annotationAdd BLAST169

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionActivator, Developmental protein, DNA-binding
Biological processTranscription, Transcription regulation

Enzyme and pathway databases

SIGNORiO15178.

Names & Taxonomyi

Protein namesi
Recommended name:
Brachyury protein
Alternative name(s):
Protein T
Gene namesi
Name:T
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

EuPathDBiHostDB:ENSG00000164458.9.
HGNCiHGNC:11515. T.
MIMi601397. gene.
neXtProtiNX_O15178.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Involvement in diseasei

Neural tube defects (NTD)1 Publication
Disease susceptibility is associated with variations affecting the gene represented in this entry.
Disease descriptionCongenital malformations of the central nervous system and adjacent structures related to defective neural tube closure during the first trimester of pregnancy. Failure of neural tube closure can occur at any level of the embryonic axis. Common NTD forms include anencephaly, myelomeningocele and spina bifida, which result from the failure of fusion in the cranial and spinal region of the neural tube. NTDs have a multifactorial etiology encompassing both genetic and environmental components.
See also OMIM:182940
Chordoma (CHDM)1 Publication
Disease susceptibility is associated with variations affecting the gene represented in this entry. Susceptibility to development of chordomas is due to a T gene duplication.
Disease descriptionRare, clinically malignant tumors derived from notochordal remnants. They occur along the length of the spinal axis, predominantly in the sphenooccipital, vertebral and sacrococcygeal regions. They are characterized by slow growth, local destruction of bone, extension into adjacent soft tissues and rarely, distant metastatic spread.
See also OMIM:215400
Sacral agenesis with vertebral anomalies (SAVA)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA disorder characterized by abnormalities of the spine, including sacral agenesis, abnormal ossification of all vertebral bodies, and a persistent notochordal canal during development.
See also OMIM:615709
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_071251171H → R in SAVA; reduced DNA binding activity; increased cell growth; altered expression of genes involved in ossification and notochord maintenance. 1 PublicationCorresponds to variant dbSNP:rs587777303Ensembl.1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNETi6862.
MalaCardsiT.
MIMi182940. phenotype.
215400. phenotype.
615709. phenotype.
OpenTargetsiENSG00000164458.
Orphaneti268392. Cervical spina bifida aperta.
268762. Cervical spina bifida cystica.
268397. Cervicothoracic spina bifida aperta.
268766. Cervicothoracic spina bifida cystica.
178. Chordoma.
268388. Lumbosacral spina bifida aperta.
268758. Lumbosacral spina bifida cystica.
397927. Sacral agenesis-abnormal ossification of the vertebral bodies-persistent notochordal canal syndrome.
268384. Thoracolumbosacral spina bifida aperta.
268752. Thoracolumbosacral spina bifida cystica.
268377. Total spina bifida aperta.
268748. Total spina bifida cystica.
268740. Upper thoracic spina bifida aperta.
268770. Upper thoracic spina bifida cystica.
PharmGKBiPA36296.

Polymorphism and mutation databases

BioMutaiT.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001844141 – 435Brachyury proteinAdd BLAST435

Proteomic databases

PaxDbiO15178.
PeptideAtlasiO15178.
PRIDEiO15178.

PTM databases

iPTMnetiO15178.
PhosphoSitePlusiO15178.

Expressioni

Tissue specificityi

Detected in testis, but not in other, normal tissues. Detected in lung tumors (at protein level).1 Publication

Gene expression databases

BgeeiENSG00000164458.
CleanExiHS_T.
ExpressionAtlasiO15178. baseline and differential.
GenevisibleiO15178. HS.

Organism-specific databases

HPAiHPA003322.

Interactioni

Subunit structurei

Monomer.By similarity

GO - Molecular functioni

Protein-protein interaction databases

ELMiO15178.
IntActiO15178. 1 interactor.
STRINGi9606.ENSP00000296946.

Structurei

Secondary structure

1435
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi43 – 48Combined sources6
Helixi49 – 57Combined sources9
Beta strandi61 – 63Combined sources3
Beta strandi65 – 67Combined sources3
Beta strandi76 – 82Combined sources7
Beta strandi86 – 97Combined sources12
Beta strandi103 – 105Combined sources3
Beta strandi108 – 110Combined sources3
Beta strandi130 – 132Combined sources3
Helixi133 – 138Combined sources6
Beta strandi147 – 151Combined sources5
Beta strandi154 – 159Combined sources6
Beta strandi165 – 174Combined sources10
Beta strandi176 – 179Combined sources4
Beta strandi182 – 186Combined sources5
Helixi188 – 190Combined sources3
Beta strandi192 – 197Combined sources6
Helixi201 – 210Combined sources10
Helixi212 – 214Combined sources3
Helixi215 – 223Combined sources9

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
6F58X-ray2.25A/B40-224[»]
6F59X-ray2.15A/B41-224[»]
ProteinModelPortaliO15178.
SMRiO15178.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Phylogenomic databases

eggNOGiKOG3585. Eukaryota.
ENOG410XSTS. LUCA.
GeneTreeiENSGT00900000140847.
HOGENOMiHOG000063663.
HOVERGENiHBG004599.
InParanoidiO15178.
KOiK10172.
OMAiAPSCVYI.
OrthoDBiEOG091G05OC.
PhylomeDBiO15178.
TreeFamiTF106341.

Family and domain databases

CDDicd00182. TBOX. 1 hit.
Gene3Di2.60.40.820. 1 hit.
InterProiView protein in InterPro
IPR008967. p53-like_TF_DNA-bd.
IPR036960. T-box_sf.
IPR002070. TF_Brachyury.
IPR001699. TF_T-box.
IPR018186. TF_T-box_CS.
PANTHERiPTHR11267. PTHR11267. 1 hit.
PfamiView protein in Pfam
PF00907. T-box. 1 hit.
PRINTSiPR00938. BRACHYURY.
PR00937. TBOX.
SMARTiView protein in SMART
SM00425. TBOX. 1 hit.
SUPFAMiSSF49417. SSF49417. 1 hit.
PROSITEiView protein in PROSITE
PS01283. TBOX_1. 1 hit.
PS01264. TBOX_2. 1 hit.
PS50252. TBOX_3. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O15178-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSSPGTESAG KSLQYRVDHL LSAVENELQA GSEKGDPTER ELRVGLEESE
60 70 80 90 100
LWLRFKELTN EMIVTKNGRR MFPVLKVNVS GLDPNAMYSF LLDFVAADNH
110 120 130 140 150
RWKYVNGEWV PGGKPEPQAP SCVYIHPDSP NFGAHWMKAP VSFSKVKLTN
160 170 180 190 200
KLNGGGQIML NSLHKYEPRI HIVRVGGPQR MITSHCFPET QFIAVTAYQN
210 220 230 240 250
EEITALKIKY NPFAKAFLDA KERSDHKEMM EEPGDSQQPG YSQWGWLLPG
260 270 280 290 300
TSTLCPPANP HPQFGGALSL PSTHSCDRYP TLRSHRSSPY PSPYAHRNNS
310 320 330 340 350
PTYSDNSPAC LSMLQSHDNW SSLGMPAHPS MLPVSHNASP PTSSSQYPSL
360 370 380 390 400
WSVSNGAVTP GSQAAAVSNG LGAQFFRGSP AHYTPLTHPV SAPSSSGSPL
410 420 430
YEGAAAATDI VDSQYDAAAQ GRLIASWTPV SPPSM
Length:435
Mass (Da):47,443
Last modified:January 1, 1998 - v1
Checksum:i9D470088C8602631
GO
Isoform 2 (identifier: O15178-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     244-302: WGWLLPGTSTLCPPANPHPQFGGALSLPSTHSCDRYPTLRSHRSSPYPSPYAHRNNSPT → S

Note: No experimental confirmation available.
Show »
Length:377
Mass (Da):41,078
Checksum:i28A89725810C9002
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_071251171H → R in SAVA; reduced DNA binding activity; increased cell growth; altered expression of genes involved in ossification and notochord maintenance. 1 PublicationCorresponds to variant dbSNP:rs587777303Ensembl.1
Natural variantiVAR_021982177G → D1 PublicationCorresponds to variant dbSNP:rs2305089Ensembl.1
Natural variantiVAR_024656356G → S. Corresponds to variant dbSNP:rs3127328Ensembl.1
Natural variantiVAR_063239358V → I. Corresponds to variant dbSNP:rs77703807Ensembl.1
Natural variantiVAR_032457367V → M. Corresponds to variant dbSNP:rs35292451Ensembl.1
Natural variantiVAR_020250369N → S. Corresponds to variant dbSNP:rs3816300Ensembl.1
Natural variantiVAR_032458402E → K. Corresponds to variant dbSNP:rs34517945Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_044795244 – 302WGWLL…NNSPT → S in isoform 2. 1 PublicationAdd BLAST59

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ001699 mRNA. Translation: CAA04938.1.
AL627443 Genomic DNA. No translation available.
BC098425 mRNA. Translation: AAH98425.1.
CCDSiCCDS5290.1. [O15178-1]
CCDS59045.1. [O15178-2]
RefSeqiNP_001257413.1. NM_001270484.1. [O15178-2]
NP_003172.1. NM_003181.3. [O15178-1]
UniGeneiHs.389457.
Hs.742027.

Genome annotation databases

EnsembliENST00000296946; ENSP00000296946; ENSG00000164458. [O15178-1]
ENST00000366871; ENSP00000355836; ENSG00000164458. [O15178-2]
GeneIDi6862.
KEGGihsa:6862.
UCSCiuc003quu.4. human. [O15178-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiBRAC_HUMAN
AccessioniPrimary (citable) accession number: O15178
Secondary accession number(s): E7ERD6, Q4KMP4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: January 1, 1998
Last modified: March 28, 2018
This is version 152 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome