O15178 (BRAC_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 109.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Brachyury protein Alternative name(s): Protein T | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 435 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Involved in the transcriptional regulation of genes required for mesoderm formation and differentiation. Binds to a palindromic site (called T site) and activates gene transcription when bound to such a site. |
| Subunit structure | Monomer By similarity. |
| Subcellular location | |
| Involvement in disease | Neural tube defects (NTD) [MIM:182940]: Congenital malformations of the central nervous system and adjacent structures related to defective neural tube closure during the first trimester of pregnancy. Failure of neural tube closure can occur at any level of the embryonic axis. Common NTD forms include anencephaly, myelomeningocele and spina bifida, which result from the failure of fusion in the cranial and spinal region of the neural tube. NTDs have a multifactorial etiology encompassing both genetic and environmental components. Chordoma (CHDM) [MIM:215400]: Rare, clinically malignant tumors derived from notochordal remnants. They occur along the length of the spinal axis, predominantly in the sphenooccipital, vertebral and sacrococcygeal regions. They are characterized by slow growth, local destruction of bone, extension into adjacent soft tissues and rarely, distant metastatic spread. |
| Sequence similarities | Contains 1 T-box DNA-binding domain. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O15178-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O15178-2) The sequence of this isoform differs from the canonical sequence as follows: 244-302: WGWLLPGTSTLCPPANPHPQFGGALSLPSTHSCDRYPTLRSHRSSPYPSPYAHRNNSPT → S | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 435 | 435 | Brachyury protein | PRO_0000184414 | |||||
Regions | |||||||||
| DNA binding | 51 – 219 | 169 | T-box | ||||||
Natural variations | |||||||||
| Alternative sequence | 244 – 302 | 59 | WGWLL…NNSPT → S in isoform 2. | VSP_044795 | |||||
| Natural variant | 177 | 1 | G → D. Ref.3 Corresponds to variant rs2305089 [ dbSNP | Ensembl ]. | VAR_021982 | |||||
| Natural variant | 356 | 1 | G → S. Corresponds to variant rs3127328 [ dbSNP | Ensembl ]. | VAR_024656 | |||||
| Natural variant | 358 | 1 | V → I. Corresponds to variant rs77703807 [ dbSNP | Ensembl ]. | VAR_063239 | |||||
| Natural variant | 367 | 1 | V → M. Corresponds to variant rs35292451 [ dbSNP | Ensembl ]. | VAR_032457 | |||||
| Natural variant | 369 | 1 | N → S. Corresponds to variant rs3816300 [ dbSNP | Ensembl ]. | VAR_020250 | |||||
| Natural variant | 402 | 1 | E → K. Corresponds to variant rs34517945 [ dbSNP | Ensembl ]. | VAR_032458 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The human homolog T of the mouse T(Brachyury) gene; gene structure, cDNA sequence, and assignment to chromosome 6q27." Edwards Y.H., Putt W., Lekoape K.M., Stott D., Fox M., Hopkinson D.A., Sowden J. Genome Res. 6:226-233(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "The DNA sequence and analysis of human chromosome 6." Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. Beck S.Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT ASP-177. Tissue: Lung. |
| [4] | "The human T locus and spina bifida risk." Jensen L.E., Barbaux S., Hoess K., Fraterman S., Whitehead A.S., Mitchell L.E. Hum. Genet. 115:475-482(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN SUSCEPTIBILITY TO NTD. |
| [5] | "T (brachyury) gene duplication confers major susceptibility to familial chordoma." Yang X.R., Ng D., Alcorta D.A., Liebsch N.J., Sheridan E., Li S., Goldstein A.M., Parry D.M., Kelley M.J. Nat. Genet. 41:1176-1178(2009) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN SUSCEPTIBILITY TO THE DEVELOPMENT OF CHORDOMA. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AJ001699 mRNA. Translation: CAA04938.1. AL627443 Genomic DNA. Translation: CAI14269.1. BC098425 mRNA. Translation: AAH98425.1. |
| IPI | IPI00005203. IPI00619896. |
| RefSeq | NP_001257413.1. NM_001270484.1. NP_003172.1. NM_003181.3. |
| UniGene | Hs.389457. Hs.742027. |
3D structure databases | |
| ProteinModelPortal | O15178. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000296946. |
PTM databases | |
| PhosphoSite | O15178. |
Proteomic databases | |
| PaxDb | O15178. |
| PRIDE | O15178. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000296946; ENSP00000296946; ENSG00000164458. ENST00000366871; ENSP00000355836; ENSG00000164458. |
| GeneID | 6862. |
| KEGG | hsa:6862. |
| UCSC | uc003qut.1. human. |
Organism-specific databases | |
| CTD | 6862. |
| GeneCards | GC06M166541. |
| HGNC | HGNC:11515. T. |
| HPA | HPA003322. |
| MIM | 182940. phenotype. 215400. phenotype. 601397. gene. |
| neXtProt | NX_O15178. |
| Orphanet | 3027. Caudal regression sequence. 823. Isolated spina bifida. |
| PharmGKB | PA36296. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG257463. |
| HOGENOM | HOG000063663. |
| HOVERGEN | HBG004599. |
| InParanoid | O15178. |
| KO | K10172. |
| OMA | QFFRGSP. |
| OrthoDB | EOG4FXR7S. |
| PhylomeDB | O15178. |
Gene expression databases | |
| ArrayExpress | O15178. |
| Bgee | O15178. |
| CleanEx | HS_T. |
| Genevestigator | O15178. |
| GermOnline | ENSG00000164458. Homo sapiens. |
Family and domain databases | |
| Gene3D | 2.60.40.820. 1 hit. |
| InterPro | IPR008967. p53-like_TF_DNA-bd. IPR002070. TF_Brachyury. IPR001699. TF_T-box. IPR018186. TF_T-box_CS. [Graphical view] |
| PANTHER | PTHR11267. PTHR11267. 1 hit. |
| Pfam | PF00907. T-box. 1 hit. [Graphical view] |
| PRINTS | PR00938. BRACHYURY. PR00937. TBOX. |
| SMART | SM00425. TBOX. 1 hit. [Graphical view] |
| SUPFAM | SSF49417. P53_like_DNA_bnd. 1 hit. |
| PROSITE | PS01283. TBOX_1. 1 hit. PS01264. TBOX_2. 1 hit. PS50252. TBOX_3. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 6862. |
| NextBio | 26779. |
| SOURCE | Search... |
Entry information
| Entry name | BRAC_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O15178 Secondary accession number(s): E7ERD6, Q4KMP4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 6 Human chromosome 6: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
