Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O15165

- LRAD4_HUMAN

UniProt

O15165 - LRAD4_HUMAN

Protein

Low-density lipoprotein receptor class A domain-containing protein 4

Gene

LDLRAD4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 121 (01 Oct 2014)
      Sequence version 1 (01 Jan 1998)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Functions as a negative regulator of TGF-beta signaling and thereby probably plays a role in cell proliferation, differentiation, apoptosis, motility, extracellular matrix production and immunosuppression. In the canonical TGF-beta pathway, ZFYVE9/SARA recruits the intracellular signal transducer and transcriptional modulators SMAD2 and SMAD3 to the TGF-beta receptor. Phosphorylated by the receptor, SMAD2 and SMAD3 then form a heteromeric complex with SMAD4 that translocates to the nucleus to regulate transcription. Through interaction with SMAD2 and SMAD3, LDLRAD4 may compete with ZFYVE9 and SMAD4 and prevent propagation of the intracellular signal.1 Publication

    Keywords - Molecular functioni

    Signal transduction inhibitor

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Low-density lipoprotein receptor class A domain-containing protein 4
    Gene namesi
    Name:LDLRAD4
    Synonyms:C18orf1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 18

    Organism-specific databases

    HGNCiHGNC:1224. LDLRAD4.

    Subcellular locationi

    Early endosome membrane 1 Publication; Single-pass membrane protein 1 Publication

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB
    2. plasma membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Endosome, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA25593.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 306306Low-density lipoprotein receptor class A domain-containing protein 4PRO_0000185444Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi19 ↔ 38PROSITE-ProRule annotation
    Disulfide bondi32 ↔ 47PROSITE-ProRule annotation

    Keywords - PTMi

    Disulfide bond

    Proteomic databases

    PaxDbiO15165.
    PRIDEiO15165.

    PTM databases

    PhosphoSiteiO15165.

    Expressioni

    Tissue specificityi

    Expressed in lymphocytes.1 Publication

    Gene expression databases

    ArrayExpressiO15165.
    BgeeiO15165.
    CleanExiHS_C18orf1.
    GenevestigatoriO15165.

    Interactioni

    Subunit structurei

    Interacts with PMEPA1. Interacts (via the SMAD interaction motif) with SMAD2 and SMAD3.1 Publication

    Protein-protein interaction databases

    BioGridi107209. 1 interaction.
    STRINGi9606.ENSP00000354753.

    Structurei

    3D structure databases

    ProteinModelPortaliO15165.
    SMRiO15165. Positions 16-49.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 6464LumenalSequence AnalysisAdd
    BLAST
    Topological domaini86 – 306221CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei65 – 8521HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini16 – 4833LDL-receptor class APROSITE-ProRule annotationAdd
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi180 – 1834WW-binding 1
    Motifi208 – 2114SMAD interaction motif (SIM)
    Motifi252 – 2554WW-binding 2

    Domaini

    The SMAD interaction motif is required for interaction with SMAD2 and SMAD3 and the negative regulation of TGF-beta signaling.1 Publication

    Sequence similaritiesi

    Belongs to the PMEPA1 family.Curated
    Contains 1 LDL-receptor class A domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG27420.
    HOGENOMiHOG000276535.
    HOVERGENiHBG059833.
    InParanoidiO15165.
    OMAiPQEGCLW.
    PhylomeDBiO15165.
    TreeFamiTF331681.

    Family and domain databases

    Gene3Di4.10.400.10. 1 hit.
    InterProiIPR023415. LDLR_class-A_CS.
    IPR002172. LDrepeatLR_classA_rpt.
    [Graphical view]
    PfamiPF00057. Ldl_recept_a. 1 hit.
    [Graphical view]
    SMARTiSM00192. LDLa. 1 hit.
    [Graphical view]
    SUPFAMiSSF57424. SSF57424. 1 hit.
    PROSITEiPS01209. LDLRA_1. 1 hit.
    PS50068. LDLRA_2. 1 hit.
    [Graphical view]

    Sequences (8)i

    Sequence statusi: Complete.

    This entry describes 8 isoformsi produced by alternative splicing. Align

    Isoform Alpha-1 (identifier: O15165-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MPEAGFQATN AFTECKFTCT SGKCLYLGSL VCNQQNDCGD NSDEENCLLV    50
    TEHPPPGIFN SELEFAQIII IVVVVTVMVV VIVCLLNHYK VSTRSFINRP 100
    NQSRRREDGL PQEGCLWPSD SAAPRLGASE IMHAPRSRDR FTAPSFIQRD 150
    RFSRFQPTYP YVQHEIDLPP TISLSDGEEP PPYQGPCTLQ LRDPEQQMEL 200
    NRESVRAPPN RTIFDSDLID IAMYSGGPCP PSSNSGISAS TCSSNGRMEG 250
    PPPTYSEVMG HHPGASFLHH QRSNAHRGSR LQFQQNNAES TIVPIKGKDR 300
    KPGNLV 306
    Length:306
    Mass (Da):33,900
    Last modified:January 1, 1998 - v1
    Checksum:iF48EF66E329201BD
    GO
    Isoform Alpha-2 (identifier: O15165-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         113-130: Missing.

    Show »
    Length:288
    Mass (Da):32,072
    Checksum:iB7DEC603B9C5CA79
    GO
    Isoform Beta-1 (identifier: O15165-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-61: MPEAGFQATNAFTECKFTCTSGKCLYLGSLVCNQQNDCGDNSDEENCLLVTEHPPPGIFNS → MAA

    Show »
    Length:248
    Mass (Da):27,600
    Checksum:iB88763A5A86C970A
    GO
    Isoform Beta-2 (identifier: O15165-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-61: MPEAGFQATNAFTECKFTCTSGKCLYLGSLVCNQQNDCGDNSDEENCLLVTEHPPPGIFNS → MAA
         113-130: Missing.

    Show »
    Length:230
    Mass (Da):25,772
    Checksum:i4EA79478440BC7C0
    GO
    Isoform 5 (identifier: O15165-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-77: Missing.

    Show »
    Length:229
    Mass (Da):25,560
    Checksum:iD124C6E3503B031E
    GO
    Isoform 6 (identifier: O15165-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-61: MPEAGFQATN...EHPPPGIFNS → MSSDHLNNSTLKEAQFKDLFLKKA

    Note: No experimental confirmation available.

    Show »
    Length:269
    Mass (Da):30,075
    Checksum:iBC8B8A807F64B908
    GO
    Isoform 7 (identifier: O15165-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-61: MPEAGFQATN...EHPPPGIFNS → MSSDHLNNSTLKEAQFKDLFLKKA
         113-130: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:251
    Mass (Da):28,247
    Checksum:iBD0751CEB806A1B7
    GO
    Isoform 8 (identifier: O15165-8) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-111: MPEAGFQATN...QSRRREDGLP → MRLDSHLECISST

    Note: No experimental confirmation available.

    Show »
    Length:208
    Mass (Da):23,053
    Checksum:iC12FA9F28364B0C0
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti125 – 1251R → Q in AAH66971. (PubMed:15489334)Curated
    Sequence conflicti135 – 1351P → T in AAH66971. (PubMed:15489334)Curated
    Sequence conflicti194 – 1941P → T in AAH66971. (PubMed:15489334)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 111111MPEAG…EDGLP → MRLDSHLECISST in isoform 8. 1 PublicationVSP_054772Add
    BLAST
    Alternative sequencei1 – 7777Missing in isoform 5. 1 PublicationVSP_013901Add
    BLAST
    Alternative sequencei1 – 6161MPEAG…GIFNS → MSSDHLNNSTLKEAQFKDLF LKKA in isoform 6 and isoform 7. 2 PublicationsVSP_043253Add
    BLAST
    Alternative sequencei1 – 6161MPEAG…GIFNS → MAA in isoform Beta-1 and isoform Beta-2. 1 PublicationVSP_006439Add
    BLAST
    Alternative sequencei113 – 13018Missing in isoform Alpha-2, isoform Beta-2 and isoform 7. 3 PublicationsVSP_006440Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF009424 mRNA. Translation: AAC52023.1.
    AF009425 mRNA. Translation: AAC52024.1.
    AF009426 mRNA. Translation: AAC52025.1.
    AF009427 mRNA. Translation: AAC52026.1.
    AK055028 mRNA. Translation: BAG51451.1.
    AP001010 Genomic DNA. No translation available.
    AP002439 Genomic DNA. No translation available.
    AP002505 Genomic DNA. No translation available.
    AP005131 Genomic DNA. No translation available.
    CH471113 Genomic DNA. Translation: EAX01514.1.
    BC029958 mRNA. No translation available.
    BC030199 mRNA. Translation: AAH30199.1.
    BC066971 mRNA. Translation: AAH66971.1.
    BX114947 mRNA. No translation available.
    CCDSiCCDS32793.1. [O15165-1]
    CCDS32794.1. [O15165-2]
    CCDS32795.1. [O15165-6]
    CCDS42415.1. [O15165-7]
    CCDS62392.1. [O15165-5]
    CCDS62393.1. [O15165-8]
    RefSeqiNP_001003674.1. NM_001003674.3. [O15165-6]
    NP_001003675.1. NM_001003675.3. [O15165-7]
    NP_001263178.1. NM_001276249.1. [O15165-5]
    NP_001263180.1. NM_001276251.1. [O15165-8]
    NP_852146.1. NM_181481.4. [O15165-1]
    NP_852147.1. NM_181482.4. [O15165-2]
    XP_005258197.1. XM_005258140.1. [O15165-1]
    XP_006722413.1. XM_006722350.1. [O15165-1]
    XP_006722414.1. XM_006722351.1. [O15165-1]
    XP_006722415.1. XM_006722352.1. [O15165-1]
    XP_006722416.1. XM_006722353.1. [O15165-1]
    XP_006722417.1. XM_006722354.1. [O15165-1]
    XP_006722418.1. XM_006722355.1. [O15165-1]
    UniGeneiHs.731853.
    Hs.745141.

    Genome annotation databases

    EnsembliENST00000359446; ENSP00000352420; ENSG00000168675. [O15165-1]
    ENST00000399848; ENSP00000382741; ENSG00000168675. [O15165-2]
    ENST00000585931; ENSP00000466772; ENSG00000168675. [O15165-5]
    ENST00000586765; ENSP00000474783; ENSG00000168675. [O15165-7]
    ENST00000587757; ENSP00000466178; ENSG00000168675. [O15165-6]
    ENST00000592991; ENSP00000466771; ENSG00000168675. [O15165-8]
    GeneIDi753.
    KEGGihsa:753.
    UCSCiuc002ksb.3. human. [O15165-2]
    uc002kse.3. human. [O15165-6]
    uc002ksg.2. human. [O15165-1]
    uc002ksh.1. human. [O15165-3]
    uc002ksi.1. human. [O15165-4]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF009424 mRNA. Translation: AAC52023.1 .
    AF009425 mRNA. Translation: AAC52024.1 .
    AF009426 mRNA. Translation: AAC52025.1 .
    AF009427 mRNA. Translation: AAC52026.1 .
    AK055028 mRNA. Translation: BAG51451.1 .
    AP001010 Genomic DNA. No translation available.
    AP002439 Genomic DNA. No translation available.
    AP002505 Genomic DNA. No translation available.
    AP005131 Genomic DNA. No translation available.
    CH471113 Genomic DNA. Translation: EAX01514.1 .
    BC029958 mRNA. No translation available.
    BC030199 mRNA. Translation: AAH30199.1 .
    BC066971 mRNA. Translation: AAH66971.1 .
    BX114947 mRNA. No translation available.
    CCDSi CCDS32793.1. [O15165-1 ]
    CCDS32794.1. [O15165-2 ]
    CCDS32795.1. [O15165-6 ]
    CCDS42415.1. [O15165-7 ]
    CCDS62392.1. [O15165-5 ]
    CCDS62393.1. [O15165-8 ]
    RefSeqi NP_001003674.1. NM_001003674.3. [O15165-6 ]
    NP_001003675.1. NM_001003675.3. [O15165-7 ]
    NP_001263178.1. NM_001276249.1. [O15165-5 ]
    NP_001263180.1. NM_001276251.1. [O15165-8 ]
    NP_852146.1. NM_181481.4. [O15165-1 ]
    NP_852147.1. NM_181482.4. [O15165-2 ]
    XP_005258197.1. XM_005258140.1. [O15165-1 ]
    XP_006722413.1. XM_006722350.1. [O15165-1 ]
    XP_006722414.1. XM_006722351.1. [O15165-1 ]
    XP_006722415.1. XM_006722352.1. [O15165-1 ]
    XP_006722416.1. XM_006722353.1. [O15165-1 ]
    XP_006722417.1. XM_006722354.1. [O15165-1 ]
    XP_006722418.1. XM_006722355.1. [O15165-1 ]
    UniGenei Hs.731853.
    Hs.745141.

    3D structure databases

    ProteinModelPortali O15165.
    SMRi O15165. Positions 16-49.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 107209. 1 interaction.
    STRINGi 9606.ENSP00000354753.

    PTM databases

    PhosphoSitei O15165.

    Proteomic databases

    PaxDbi O15165.
    PRIDEi O15165.

    Protocols and materials databases

    DNASUi 753.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000359446 ; ENSP00000352420 ; ENSG00000168675 . [O15165-1 ]
    ENST00000399848 ; ENSP00000382741 ; ENSG00000168675 . [O15165-2 ]
    ENST00000585931 ; ENSP00000466772 ; ENSG00000168675 . [O15165-5 ]
    ENST00000586765 ; ENSP00000474783 ; ENSG00000168675 . [O15165-7 ]
    ENST00000587757 ; ENSP00000466178 ; ENSG00000168675 . [O15165-6 ]
    ENST00000592991 ; ENSP00000466771 ; ENSG00000168675 . [O15165-8 ]
    GeneIDi 753.
    KEGGi hsa:753.
    UCSCi uc002ksb.3. human. [O15165-2 ]
    uc002kse.3. human. [O15165-6 ]
    uc002ksg.2. human. [O15165-1 ]
    uc002ksh.1. human. [O15165-3 ]
    uc002ksi.1. human. [O15165-4 ]

    Organism-specific databases

    CTDi 753.
    GeneCardsi GC18P013217.
    H-InvDB HIX0014349.
    HGNCi HGNC:1224. LDLRAD4.
    MIMi 606571. gene.
    neXtProti NX_O15165.
    PharmGKBi PA25593.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG27420.
    HOGENOMi HOG000276535.
    HOVERGENi HBG059833.
    InParanoidi O15165.
    OMAi PQEGCLW.
    PhylomeDBi O15165.
    TreeFami TF331681.

    Miscellaneous databases

    ChiTaRSi C18orf1. human.
    GenomeRNAii 753.
    NextBioi 3038.
    PROi O15165.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O15165.
    Bgeei O15165.
    CleanExi HS_C18orf1.
    Genevestigatori O15165.

    Family and domain databases

    Gene3Di 4.10.400.10. 1 hit.
    InterProi IPR023415. LDLR_class-A_CS.
    IPR002172. LDrepeatLR_classA_rpt.
    [Graphical view ]
    Pfami PF00057. Ldl_recept_a. 1 hit.
    [Graphical view ]
    SMARTi SM00192. LDLa. 1 hit.
    [Graphical view ]
    SUPFAMi SSF57424. SSF57424. 1 hit.
    PROSITEi PS01209. LDLRA_1. 1 hit.
    PS50068. LDLRA_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Multiple transcriptional variants and RNA editing in C18orf1, a novel gene with LDLRA and transmembrane domains on 18p11.2."
      Yoshikawa T., Sanders A.R., Esterling L.E., Detera-Wadleigh S.D.
      Genomics 47:246-257(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ALPHA-1; ALPHA-2; BETA-1 AND BETA-2).
      Tissue: Brain.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6).
      Tissue: Brain.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS ALPHA-2; 5 AND 8).
      Tissue: Brain.
    6. Ebert L., Heil O., Hennig S., Neubert P., Partsch E., Peters M., Radelof U., Schneider D., Korn B.
      Submitted (DEC-2002) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 6-251 (ISOFORM 7).
      Tissue: Testis.
    7. "Analysis of a t(18;21)(p11.1;p11.1) translocation in a family with schizophrenia."
      Meerabux J.M., Ohba H., Iwayama Y., Maekawa M., Detera-Wadleigh S.D., DeLisi L.E., Yoshikawa T.
      J. Hum. Genet. 54:386-391(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY.
    8. Cited for: FUNCTION, INTERACTION WITH PMEPA1; SMAD2 AND SMAD3, SUBCELLULAR LOCATION, MOTIF.

    Entry informationi

    Entry nameiLRAD4_HUMAN
    AccessioniPrimary (citable) accession number: O15165
    Secondary accession number(s): B3KNT9
    , E9PAY9, K7EN38, O15166, O15167, O15168, Q5U646, Q6NXP3
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 24, 2001
    Last sequence update: January 1, 1998
    Last modified: October 1, 2014
    This is version 121 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 18
      Human chromosome 18: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3