Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O15165

- LRAD4_HUMAN

UniProt

O15165 - LRAD4_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Low-density lipoprotein receptor class A domain-containing protein 4

Gene

LDLRAD4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Functions as a negative regulator of TGF-beta signaling and thereby probably plays a role in cell proliferation, differentiation, apoptosis, motility, extracellular matrix production and immunosuppression. In the canonical TGF-beta pathway, ZFYVE9/SARA recruits the intracellular signal transducer and transcriptional modulators SMAD2 and SMAD3 to the TGF-beta receptor. Phosphorylated by the receptor, SMAD2 and SMAD3 then form a heteromeric complex with SMAD4 that translocates to the nucleus to regulate transcription. Through interaction with SMAD2 and SMAD3, LDLRAD4 may compete with ZFYVE9 and SMAD4 and prevent propagation of the intracellular signal.1 Publication

GO - Molecular functioni

  1. R-SMAD binding Source: UniProtKB

GO - Biological processi

  1. negative regulation of cell migration Source: UniProtKB
  2. negative regulation of epithelial to mesenchymal transition Source: UniProtKB
  3. negative regulation of pathway-restricted SMAD protein phosphorylation Source: UniProtKB
  4. negative regulation of SMAD protein complex assembly Source: UniProtKB
  5. negative regulation of transforming growth factor beta receptor signaling pathway Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Signal transduction inhibitor

Names & Taxonomyi

Protein namesi
Recommended name:
Low-density lipoprotein receptor class A domain-containing protein 4
Gene namesi
Name:LDLRAD4
Synonyms:C18orf1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 18

Organism-specific databases

HGNCiHGNC:1224. LDLRAD4.

Subcellular locationi

Early endosome membrane 1 Publication; Single-pass membrane protein 1 Publication

GO - Cellular componenti

  1. early endosome membrane Source: UniProtKB
  2. endosome Source: UniProtKB-KW
  3. integral component of membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Endosome, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA25593.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 306306Low-density lipoprotein receptor class A domain-containing protein 4PRO_0000185444Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi19 ↔ 38PROSITE-ProRule annotation
Disulfide bondi32 ↔ 47PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond

Proteomic databases

PaxDbiO15165.
PRIDEiO15165.

PTM databases

PhosphoSiteiO15165.

Expressioni

Tissue specificityi

Expressed in lymphocytes.1 Publication

Gene expression databases

BgeeiO15165.
CleanExiHS_C18orf1.
ExpressionAtlasiO15165. baseline and differential.
GenevestigatoriO15165.

Interactioni

Subunit structurei

Interacts with PMEPA1. Interacts (via the SMAD interaction motif) with SMAD2 and SMAD3.1 Publication

Protein-protein interaction databases

BioGridi107209. 47 interactions.
IntActiO15165. 1 interaction.
STRINGi9606.ENSP00000354753.

Structurei

3D structure databases

ProteinModelPortaliO15165.
SMRiO15165. Positions 16-49.
ModBaseiSearch...
MobiDBiSearch...

Topological domain

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 6464LumenalSequence AnalysisAdd
BLAST
Topological domaini86 – 306221CytoplasmicSequence AnalysisAdd
BLAST

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei65 – 8521HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini16 – 4833LDL-receptor class APROSITE-ProRule annotationAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi180 – 1834WW-binding 1
Motifi208 – 2114SMAD interaction motif (SIM)
Motifi252 – 2554WW-binding 2

Domaini

The SMAD interaction motif is required for interaction with SMAD2 and SMAD3 and the negative regulation of TGF-beta signaling.1 Publication

Sequence similaritiesi

Belongs to the PMEPA1 family.Curated
Contains 1 LDL-receptor class A domain.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG27420.
GeneTreeiENSGT00390000000724.
HOGENOMiHOG000276535.
HOVERGENiHBG059833.
InParanoidiO15165.
OMAiPQEGCLW.
PhylomeDBiO15165.
TreeFamiTF331681.

Family and domain databases

Gene3Di4.10.400.10. 1 hit.
InterProiIPR023415. LDLR_class-A_CS.
IPR002172. LDrepeatLR_classA_rpt.
[Graphical view]
PfamiPF00057. Ldl_recept_a. 1 hit.
[Graphical view]
SMARTiSM00192. LDLa. 1 hit.
[Graphical view]
SUPFAMiSSF57424. SSF57424. 1 hit.
PROSITEiPS01209. LDLRA_1. 1 hit.
PS50068. LDLRA_2. 1 hit.
[Graphical view]

Sequences (8)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative splicing. Align

Isoform Alpha-1 (identifier: O15165-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPEAGFQATN AFTECKFTCT SGKCLYLGSL VCNQQNDCGD NSDEENCLLV
60 70 80 90 100
TEHPPPGIFN SELEFAQIII IVVVVTVMVV VIVCLLNHYK VSTRSFINRP
110 120 130 140 150
NQSRRREDGL PQEGCLWPSD SAAPRLGASE IMHAPRSRDR FTAPSFIQRD
160 170 180 190 200
RFSRFQPTYP YVQHEIDLPP TISLSDGEEP PPYQGPCTLQ LRDPEQQMEL
210 220 230 240 250
NRESVRAPPN RTIFDSDLID IAMYSGGPCP PSSNSGISAS TCSSNGRMEG
260 270 280 290 300
PPPTYSEVMG HHPGASFLHH QRSNAHRGSR LQFQQNNAES TIVPIKGKDR

KPGNLV
Length:306
Mass (Da):33,900
Last modified:January 1, 1998 - v1
Checksum:iF48EF66E329201BD
GO
Isoform Alpha-2 (identifier: O15165-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     113-130: Missing.

Show »
Length:288
Mass (Da):32,072
Checksum:iB7DEC603B9C5CA79
GO
Isoform Beta-1 (identifier: O15165-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: MPEAGFQATNAFTECKFTCTSGKCLYLGSLVCNQQNDCGDNSDEENCLLVTEHPPPGIFNS → MAA

Show »
Length:248
Mass (Da):27,600
Checksum:iB88763A5A86C970A
GO
Isoform Beta-2 (identifier: O15165-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: MPEAGFQATNAFTECKFTCTSGKCLYLGSLVCNQQNDCGDNSDEENCLLVTEHPPPGIFNS → MAA
     113-130: Missing.

Show »
Length:230
Mass (Da):25,772
Checksum:i4EA79478440BC7C0
GO
Isoform 5 (identifier: O15165-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-77: Missing.

Show »
Length:229
Mass (Da):25,560
Checksum:iD124C6E3503B031E
GO
Isoform 6 (identifier: O15165-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: MPEAGFQATN...EHPPPGIFNS → MSSDHLNNSTLKEAQFKDLFLKKA

Note: No experimental confirmation available.

Show »
Length:269
Mass (Da):30,075
Checksum:iBC8B8A807F64B908
GO
Isoform 7 (identifier: O15165-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: MPEAGFQATN...EHPPPGIFNS → MSSDHLNNSTLKEAQFKDLFLKKA
     113-130: Missing.

Note: No experimental confirmation available.

Show »
Length:251
Mass (Da):28,247
Checksum:iBD0751CEB806A1B7
GO
Isoform 8 (identifier: O15165-8) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-111: MPEAGFQATN...QSRRREDGLP → MRLDSHLECISST

Note: No experimental confirmation available.

Show »
Length:208
Mass (Da):23,053
Checksum:iC12FA9F28364B0C0
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti125 – 1251R → Q in AAH66971. (PubMed:15489334)Curated
Sequence conflicti135 – 1351P → T in AAH66971. (PubMed:15489334)Curated
Sequence conflicti194 – 1941P → T in AAH66971. (PubMed:15489334)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 111111MPEAG…EDGLP → MRLDSHLECISST in isoform 8. 1 PublicationVSP_054772Add
BLAST
Alternative sequencei1 – 7777Missing in isoform 5. 1 PublicationVSP_013901Add
BLAST
Alternative sequencei1 – 6161MPEAG…GIFNS → MSSDHLNNSTLKEAQFKDLF LKKA in isoform 6 and isoform 7. 2 PublicationsVSP_043253Add
BLAST
Alternative sequencei1 – 6161MPEAG…GIFNS → MAA in isoform Beta-1 and isoform Beta-2. 1 PublicationVSP_006439Add
BLAST
Alternative sequencei113 – 13018Missing in isoform Alpha-2, isoform Beta-2 and isoform 7. 3 PublicationsVSP_006440Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF009424 mRNA. Translation: AAC52023.1.
AF009425 mRNA. Translation: AAC52024.1.
AF009426 mRNA. Translation: AAC52025.1.
AF009427 mRNA. Translation: AAC52026.1.
AK055028 mRNA. Translation: BAG51451.1.
AP001010 Genomic DNA. No translation available.
AP002439 Genomic DNA. No translation available.
AP002505 Genomic DNA. No translation available.
AP005131 Genomic DNA. No translation available.
CH471113 Genomic DNA. Translation: EAX01514.1.
BC029958 mRNA. No translation available.
BC030199 mRNA. Translation: AAH30199.1.
BC066971 mRNA. Translation: AAH66971.1.
BX114947 mRNA. No translation available.
CCDSiCCDS32793.1. [O15165-1]
CCDS32794.1. [O15165-2]
CCDS32795.1. [O15165-6]
CCDS42415.1. [O15165-7]
CCDS62392.1. [O15165-5]
CCDS62393.1. [O15165-8]
RefSeqiNP_001003674.1. NM_001003674.3. [O15165-6]
NP_001003675.1. NM_001003675.3. [O15165-7]
NP_001263178.1. NM_001276249.1. [O15165-5]
NP_001263180.1. NM_001276251.1. [O15165-8]
NP_852146.1. NM_181481.4. [O15165-1]
NP_852147.1. NM_181482.4. [O15165-2]
XP_005258197.1. XM_005258140.1. [O15165-1]
XP_006722413.1. XM_006722350.1. [O15165-1]
XP_006722414.1. XM_006722351.1. [O15165-1]
XP_006722415.1. XM_006722352.1. [O15165-1]
XP_006722416.1. XM_006722353.1. [O15165-1]
XP_006722417.1. XM_006722354.1. [O15165-1]
XP_006722418.1. XM_006722355.1. [O15165-1]
UniGeneiHs.731853.
Hs.745141.

Genome annotation databases

EnsembliENST00000359446; ENSP00000352420; ENSG00000168675. [O15165-1]
ENST00000399848; ENSP00000382741; ENSG00000168675. [O15165-2]
ENST00000585931; ENSP00000466772; ENSG00000168675. [O15165-5]
ENST00000586765; ENSP00000474783; ENSG00000168675. [O15165-7]
ENST00000587757; ENSP00000466178; ENSG00000168675. [O15165-6]
ENST00000592991; ENSP00000466771; ENSG00000168675. [O15165-8]
GeneIDi753.
KEGGihsa:753.
UCSCiuc002ksb.3. human. [O15165-2]
uc002kse.3. human. [O15165-6]
uc002ksg.2. human. [O15165-1]
uc002ksh.1. human. [O15165-3]
uc002ksi.1. human. [O15165-4]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF009424 mRNA. Translation: AAC52023.1 .
AF009425 mRNA. Translation: AAC52024.1 .
AF009426 mRNA. Translation: AAC52025.1 .
AF009427 mRNA. Translation: AAC52026.1 .
AK055028 mRNA. Translation: BAG51451.1 .
AP001010 Genomic DNA. No translation available.
AP002439 Genomic DNA. No translation available.
AP002505 Genomic DNA. No translation available.
AP005131 Genomic DNA. No translation available.
CH471113 Genomic DNA. Translation: EAX01514.1 .
BC029958 mRNA. No translation available.
BC030199 mRNA. Translation: AAH30199.1 .
BC066971 mRNA. Translation: AAH66971.1 .
BX114947 mRNA. No translation available.
CCDSi CCDS32793.1. [O15165-1 ]
CCDS32794.1. [O15165-2 ]
CCDS32795.1. [O15165-6 ]
CCDS42415.1. [O15165-7 ]
CCDS62392.1. [O15165-5 ]
CCDS62393.1. [O15165-8 ]
RefSeqi NP_001003674.1. NM_001003674.3. [O15165-6 ]
NP_001003675.1. NM_001003675.3. [O15165-7 ]
NP_001263178.1. NM_001276249.1. [O15165-5 ]
NP_001263180.1. NM_001276251.1. [O15165-8 ]
NP_852146.1. NM_181481.4. [O15165-1 ]
NP_852147.1. NM_181482.4. [O15165-2 ]
XP_005258197.1. XM_005258140.1. [O15165-1 ]
XP_006722413.1. XM_006722350.1. [O15165-1 ]
XP_006722414.1. XM_006722351.1. [O15165-1 ]
XP_006722415.1. XM_006722352.1. [O15165-1 ]
XP_006722416.1. XM_006722353.1. [O15165-1 ]
XP_006722417.1. XM_006722354.1. [O15165-1 ]
XP_006722418.1. XM_006722355.1. [O15165-1 ]
UniGenei Hs.731853.
Hs.745141.

3D structure databases

ProteinModelPortali O15165.
SMRi O15165. Positions 16-49.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 107209. 47 interactions.
IntActi O15165. 1 interaction.
STRINGi 9606.ENSP00000354753.

PTM databases

PhosphoSitei O15165.

Proteomic databases

PaxDbi O15165.
PRIDEi O15165.

Protocols and materials databases

DNASUi 753.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000359446 ; ENSP00000352420 ; ENSG00000168675 . [O15165-1 ]
ENST00000399848 ; ENSP00000382741 ; ENSG00000168675 . [O15165-2 ]
ENST00000585931 ; ENSP00000466772 ; ENSG00000168675 . [O15165-5 ]
ENST00000586765 ; ENSP00000474783 ; ENSG00000168675 . [O15165-7 ]
ENST00000587757 ; ENSP00000466178 ; ENSG00000168675 . [O15165-6 ]
ENST00000592991 ; ENSP00000466771 ; ENSG00000168675 . [O15165-8 ]
GeneIDi 753.
KEGGi hsa:753.
UCSCi uc002ksb.3. human. [O15165-2 ]
uc002kse.3. human. [O15165-6 ]
uc002ksg.2. human. [O15165-1 ]
uc002ksh.1. human. [O15165-3 ]
uc002ksi.1. human. [O15165-4 ]

Organism-specific databases

CTDi 753.
GeneCardsi GC18P013217.
H-InvDB HIX0014349.
HGNCi HGNC:1224. LDLRAD4.
MIMi 606571. gene.
neXtProti NX_O15165.
PharmGKBi PA25593.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG27420.
GeneTreei ENSGT00390000000724.
HOGENOMi HOG000276535.
HOVERGENi HBG059833.
InParanoidi O15165.
OMAi PQEGCLW.
PhylomeDBi O15165.
TreeFami TF331681.

Miscellaneous databases

ChiTaRSi C18orf1. human.
GenomeRNAii 753.
NextBioi 3038.
PROi O15165.
SOURCEi Search...

Gene expression databases

Bgeei O15165.
CleanExi HS_C18orf1.
ExpressionAtlasi O15165. baseline and differential.
Genevestigatori O15165.

Family and domain databases

Gene3Di 4.10.400.10. 1 hit.
InterProi IPR023415. LDLR_class-A_CS.
IPR002172. LDrepeatLR_classA_rpt.
[Graphical view ]
Pfami PF00057. Ldl_recept_a. 1 hit.
[Graphical view ]
SMARTi SM00192. LDLa. 1 hit.
[Graphical view ]
SUPFAMi SSF57424. SSF57424. 1 hit.
PROSITEi PS01209. LDLRA_1. 1 hit.
PS50068. LDLRA_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Multiple transcriptional variants and RNA editing in C18orf1, a novel gene with LDLRA and transmembrane domains on 18p11.2."
    Yoshikawa T., Sanders A.R., Esterling L.E., Detera-Wadleigh S.D.
    Genomics 47:246-257(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ALPHA-1; ALPHA-2; BETA-1 AND BETA-2).
    Tissue: Brain.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6).
    Tissue: Brain.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS ALPHA-2; 5 AND 8).
    Tissue: Brain.
  6. Ebert L., Heil O., Hennig S., Neubert P., Partsch E., Peters M., Radelof U., Schneider D., Korn B.
    Submitted (DEC-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 6-251 (ISOFORM 7).
    Tissue: Testis.
  7. "Analysis of a t(18;21)(p11.1;p11.1) translocation in a family with schizophrenia."
    Meerabux J.M., Ohba H., Iwayama Y., Maekawa M., Detera-Wadleigh S.D., DeLisi L.E., Yoshikawa T.
    J. Hum. Genet. 54:386-391(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  8. Cited for: FUNCTION, INTERACTION WITH PMEPA1; SMAD2 AND SMAD3, SUBCELLULAR LOCATION, MOTIF.

Entry informationi

Entry nameiLRAD4_HUMAN
AccessioniPrimary (citable) accession number: O15165
Secondary accession number(s): B3KNT9
, E9PAY9, K7EN38, O15166, O15167, O15168, Q5U646, Q6NXP3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 24, 2001
Last sequence update: January 1, 1998
Last modified: October 29, 2014
This is version 122 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 18
    Human chromosome 18: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3