Reviewed,
UniProtKB/Swiss-Prot O15165 (CR001_HUMAN)
Last modified
November 24, 2009.
Version 81.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Uncharacterized protein C18orf1 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Complete proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 306 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Subcellular location | Cell membrane; Single-pass membrane protein Potential. |
| Sequence similarities | Belongs to the PMEPA1 family. Contains 1 LDL-receptor class A domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Transmembrane |
| PTM | Disulfide bond |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Cellular component | integral to membrane Ref.1 Non-traceable author statement. Source: UniProtKB plasma membraneInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform Alpha-1 (identifier: O15165-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Alpha-2 (identifier: O15165-2) The sequence of this isoform differs from the canonical sequence as follows: 113-130: Missing. | ||||||
| Isoform Beta-1 (identifier: O15165-3) The sequence of this isoform differs from the canonical sequence as follows: 1-61: MPEAGFQATNAFTECKFTCTSGKCLYLGSLVCNQQNDCGDNSDEENCLLVTEHPPPGIFNS → MAA | ||||||
| Isoform Beta-2 (identifier: O15165-4) The sequence of this isoform differs from the canonical sequence as follows: 1-61: MPEAGFQATNAFTECKFTCTSGKCLYLGSLVCNQQNDCGDNSDEENCLLVTEHPPPGIFNS → MAA 113-130: Missing. | ||||||
| Isoform 5 (identifier: O15165-5) The sequence of this isoform differs from the canonical sequence as follows: 1-77: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 306 | 306 | Uncharacterized protein C18orf1 | PRO_0000185444 | |||||||
Regions | |||||||||||
| Topological domain | 1 – 64 | 64 | Extracellular Potential | ||||||||
| Transmembrane | 65 – 85 | 21 | Potential | ||||||||
| Topological domain | 86 – 306 | 221 | Cytoplasmic Potential | ||||||||
| Domain | 16 – 48 | 33 | LDL-receptor class A | ||||||||
Amino acid modifications | |||||||||||
| Disulfide bond | 19 ↔ 38 | By similarity | |||||||||
| Disulfide bond | 32 ↔ 47 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 77 | 77 | Missing in isoform 5. | VSP_013901 | |||||||
| Alternative sequence | 1 – 61 | 61 | MPEAG…GIFNS → MAA in isoform Beta-1 and isoform Beta-2. | VSP_006439 | |||||||
| Alternative sequence | 113 – 130 | 18 | Missing in isoform Alpha-2 and isoform Beta-2. | VSP_006440 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 125 | 1 | R → Q in AAH66971. Ref.3 | ||||||||
| Sequence conflict | 135 | 1 | P → T in AAH66971. Ref.3 | ||||||||
| Sequence conflict | 194 | 1 | P → T in AAH66971. Ref.3 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Multiple transcriptional variants and RNA editing in C18orf1, a novel gene with LDLRA and transmembrane domains on 18p11.2." Yoshikawa T., Sanders A.R., Esterling L.E., Detera-Wadleigh S.D. Genomics 47:246-257(1998) [PubMed: 9479497] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ALPHA-1; ALPHA-2; BETA-1 AND BETA-2). Tissue: Brain. |
| [2] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS ALPHA-2 AND 5). Tissue: Brain. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AF009424 mRNA. Translation: AAC52023.1. AF009425 mRNA. Translation: AAC52024.1. AF009426 mRNA. Translation: AAC52025.1. AF009427 mRNA. Translation: AAC52026.1. CH471113 Genomic DNA. Translation: EAX01514.1. BC030199 mRNA. Translation: AAH30199.1. BC066971 mRNA. Translation: AAH66971.1. | |
| IPI | IPI00218243. IPI00218244. IPI00220323. IPI00413630. IPI00455979. |
| RefSeq | NP_001003674.1. NP_001003675.1. NP_004329.1. NP_852146.1. NP_852147.1. NP_852148.1. |
| UniGene | Hs.149363 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | O15165. |
Proteomic databases | |
| PRIDE | O15165. |
Genome annotation databases | |
| Ensembl | ENST00000361205; ENSP00000354753; ENSG00000168675; Homo sapiens. [Genome view] |
| GeneID | 753. |
| KEGG | hsa:753. |
| NMPDR | fig|9606.3.peg.14818. |
| UCSC | uc002ksa.1. human. uc002kse.1. human. uc002ksf.1. human. |
Organism-specific databases | |
| CTD | 753. |
| GeneCards | GC18P013208. |
| HGNC | HGNC:1224. C18orf1. |
| MIM | 606571. gene. |
| PharmGKB | PA25593. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOGENOM | O15165. |
| HOVERGEN | O15165. |
| OMA | ICLLNHY |
| OrthoDB | EOG9258CX |
Gene expression databases | |
| ArrayExpress | O15165. |
| Bgee | O15165. |
| CleanEx | HS_C18orf1. |
| Genevestigator | O15165. |
| GermOnline | ENSG00000168675. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR002172. LDL_rcpt_classA_cys-rich_rpt. [Graphical view] |
| Gene3D | G3DSA:4.10.400.10. LDL_rcpt_classA_cys-rich. 1 hit. |
| Pfam | PF00057. Ldl_recept_a. 1 hit. [Graphical view] |
| SMART | SM00192. LDLa. 1 hit. [Graphical view] |
| PROSITE | PS01209. LDLRA_1. 1 hit. PS50068. LDLRA_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 3038. |
| SOURCE | Search... |
Entry information
| Entry name | CR001_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O15165 Secondary accession number(s): O15166 Q6NXP3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 18 Human chromosome 18: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


