O15165 (LRAD4_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 110.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Low-density lipoprotein receptor class A domain-containing protein 4 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 306 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Subcellular location | Cell membrane; Single-pass membrane protein Potential. |
| Tissue specificity | Expressed in lymphocytes. Ref.7 |
| Sequence similarities | Belongs to the PMEPA1 family. Contains 1 LDL-receptor class A domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Transmembrane Transmembrane helix |
| PTM | Disulfide bond |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | integral to membrane Non-traceable author statement Ref.1. Source: UniProtKB plasma membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 7 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform Alpha-1 (identifier: O15165-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Alpha-2 (identifier: O15165-2) The sequence of this isoform differs from the canonical sequence as follows: 113-130: Missing. | ||||||
| Isoform Beta-1 (identifier: O15165-3) The sequence of this isoform differs from the canonical sequence as follows: 1-61: MPEAGFQATNAFTECKFTCTSGKCLYLGSLVCNQQNDCGDNSDEENCLLVTEHPPPGIFNS → MAA | ||||||
| Isoform Beta-2 (identifier: O15165-4) The sequence of this isoform differs from the canonical sequence as follows: 1-61: MPEAGFQATNAFTECKFTCTSGKCLYLGSLVCNQQNDCGDNSDEENCLLVTEHPPPGIFNS → MAA 113-130: Missing. | ||||||
| Isoform 5 (identifier: O15165-5) The sequence of this isoform differs from the canonical sequence as follows: 1-77: Missing. | ||||||
| Isoform 6 (identifier: O15165-6) The sequence of this isoform differs from the canonical sequence as follows: 1-61: MPEAGFQATN...EHPPPGIFNS → MSSDHLNNSTLKEAQFKDLFLKKA | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 7 (identifier: O15165-7) The sequence of this isoform differs from the canonical sequence as follows: 1-61: MPEAGFQATN...EHPPPGIFNS → MSSDHLNNSTLKEAQFKDLFLKKA 113-130: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 306 | 306 | Low-density lipoprotein receptor class A domain-containing protein 4 | PRO_0000185444 | |||||||
Regions | |||||||||||
| Topological domain | 1 – 64 | 64 | Extracellular Potential | ||||||||
| Transmembrane | 65 – 85 | 21 | Helical; Potential | ||||||||
| Topological domain | 86 – 306 | 221 | Cytoplasmic Potential | ||||||||
| Domain | 16 – 48 | 33 | LDL-receptor class A | ||||||||
Amino acid modifications | |||||||||||
| Disulfide bond | 19 ↔ 38 | By similarity | |||||||||
| Disulfide bond | 32 ↔ 47 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 77 | 77 | Missing in isoform 5. | VSP_013901 | |||||||
| Alternative sequence | 1 – 61 | 61 | MPEAG…GIFNS → MSSDHLNNSTLKEAQFKDLF LKKA in isoform 6 and isoform 7. | VSP_043253 | |||||||
| Alternative sequence | 1 – 61 | 61 | MPEAG…GIFNS → MAA in isoform Beta-1 and isoform Beta-2. | VSP_006439 | |||||||
| Alternative sequence | 113 – 130 | 18 | Missing in isoform Alpha-2, isoform Beta-2 and isoform 7. | VSP_006440 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 125 | 1 | R → Q in AAH66971. Ref.5 | ||||||||
| Sequence conflict | 135 | 1 | P → T in AAH66971. Ref.5 | ||||||||
| Sequence conflict | 194 | 1 | P → T in AAH66971. Ref.5 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Multiple transcriptional variants and RNA editing in C18orf1, a novel gene with LDLRA and transmembrane domains on 18p11.2." Yoshikawa T., Sanders A.R., Esterling L.E., Detera-Wadleigh S.D. Genomics 47:246-257(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ALPHA-1; ALPHA-2; BETA-1 AND BETA-2). Tissue: Brain. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6). Tissue: Brain. |
| [3] | "DNA sequence and analysis of human chromosome 18." Nusbaum C., Zody M.C., Borowsky M.L., Kamal M., Kodira C.D., Taylor T.D., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Abouelleil A., Allen N.R., Anderson S., Bloom T., Bugalter B., Butler J. Lander E.S.Nature 437:551-555(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS ALPHA-2 AND 5). Tissue: Brain. |
| [6] | Ebert L., Heil O., Hennig S., Neubert P., Partsch E., Peters M., Radelof U., Schneider D., Korn B. Submitted (DEC-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 6-251 (ISOFORM 7). Tissue: Testis. |
| [7] | "Analysis of a t(18;21)(p11.1;p11.1) translocation in a family with schizophrenia." Meerabux J.M., Ohba H., Iwayama Y., Maekawa M., Detera-Wadleigh S.D., DeLisi L.E., Yoshikawa T. J. Hum. Genet. 54:386-391(2009) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF009424 mRNA. Translation: AAC52023.1. AF009425 mRNA. Translation: AAC52024.1. AF009426 mRNA. Translation: AAC52025.1. AF009427 mRNA. Translation: AAC52026.1. AK055028 mRNA. Translation: BAG51451.1. AP001010 Genomic DNA. No translation available. AP002439 Genomic DNA. No translation available. AP002505 Genomic DNA. No translation available. AP005131 Genomic DNA. No translation available. CH471113 Genomic DNA. Translation: EAX01514.1. BC030199 mRNA. Translation: AAH30199.1. BC066971 mRNA. Translation: AAH66971.1. BX114947 mRNA. No translation available. |
| IPI | IPI00218243. IPI00218244. IPI00220323. IPI00413630. IPI00455979. IPI00455980. IPI01017886. |
| RefSeq | NP_001003674.1. NM_001003674.3. NP_001003675.1. NM_001003675.3. NP_001263178.1. NM_001276249.1. NP_001263180.1. NM_001276251.1. NP_852147.1. NM_181482.4. |
| UniGene | Hs.731853. |
3D structure databases | |
| ProteinModelPortal | O15165. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000354753. |
PTM databases | |
| PhosphoSite | O15165. |
Proteomic databases | |
| PaxDb | O15165. |
| PRIDE | O15165. |
Protocols and materials databases | |
| DNASU | 753. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000359446; ENSP00000352420; ENSG00000168675. ENST00000361205; ENSP00000354753; ENSG00000168675. ENST00000361303; ENSP00000354559; ENSG00000168675. ENST00000399847; ENSP00000382740; ENSG00000168675. ENST00000399848; ENSP00000382741; ENSG00000168675. ENST00000435606; ENSP00000405918; ENSG00000168675. ENST00000585931; ENSP00000466772; ENSG00000168675. ENST00000587757; ENSP00000466178; ENSG00000168675. |
| GeneID | 753. |
| KEGG | hsa:753. |
| UCSC | uc002ksa.2. human. uc002ksb.2. human. uc002kse.2. human. uc002ksf.2. human. uc002ksh.1. human. uc002ksi.1. human. |
Organism-specific databases | |
| CTD | 753. |
| GeneCards | GC18P013218. |
| H-InvDB | HIX0014349. |
| HGNC | HGNC:1224. LDLRAD4. |
| MIM | 606571. gene. |
| neXtProt | NX_O15165. |
| PharmGKB | PA25593. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG27420. |
| HOGENOM | HOG000276535. |
| HOVERGEN | HBG059833. |
| InParanoid | O15165. |
| OMA | SEVMGHH. |
| OrthoDB | EOG4WM4VT. |
| PhylomeDB | O15165. |
Gene expression databases | |
| ArrayExpress | O15165. |
| Bgee | O15165. |
| CleanEx | HS_C18orf1. |
| Genevestigator | O15165. |
| GermOnline | ENSG00000168675. Homo sapiens. |
Family and domain databases | |
| Gene3D | 4.10.400.10. 1 hit. |
| InterPro | IPR023415. LDLR_class-A_CS. IPR002172. LDrepeatLR_classA_rpt. [Graphical view] |
| Pfam | PF00057. Ldl_recept_a. 1 hit. [Graphical view] |
| SMART | SM00192. LDLa. 1 hit. [Graphical view] |
| SUPFAM | SSF57424. LDL_rcpt_classA_cys-rich. 1 hit. |
| PROSITE | PS01209. LDLRA_1. 1 hit. PS50068. LDLRA_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | C18orf1. human. |
| GenomeRNAi | 753. |
| NextBio | 3038. |
| SOURCE | Search... |
Entry information
| Entry name | LRAD4_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O15165 Secondary accession number(s): B3KNT9 Q6NXP3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 18 Human chromosome 18: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
