Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

O15165 (LRAD4_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified March 19, 2014. Version 117. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Low-density lipoprotein receptor class A domain-containing protein 4
Gene names
Name:LDLRAD4
Synonyms:C18orf1
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length306 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Subcellular location

Cell membrane; Single-pass membrane protein Potential.

Tissue specificity

Expressed in lymphocytes. Ref.7

Sequence similarities

Belongs to the PMEPA1 family.

Contains 1 LDL-receptor class A domain.

Ontologies

Keywords
   Cellular componentCell membrane
Membrane
   Coding sequence diversityAlternative splicing
   DomainTransmembrane
Transmembrane helix
   PTMDisulfide bond
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Cellular_componentintegral component of membrane

Non-traceable author statement Ref.1. Source: UniProtKB

plasma membrane

Inferred from electronic annotation. Source: UniProtKB-SubCell

Complete GO annotation...

Alternative products

This entry describes 7 isoforms produced by alternative splicing. [Align] [Select]
Isoform Alpha-1 (identifier: O15165-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform Alpha-2 (identifier: O15165-2)

The sequence of this isoform differs from the canonical sequence as follows:
     113-130: Missing.
Isoform Beta-1 (identifier: O15165-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: MPEAGFQATNAFTECKFTCTSGKCLYLGSLVCNQQNDCGDNSDEENCLLVTEHPPPGIFNS → MAA
Isoform Beta-2 (identifier: O15165-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: MPEAGFQATNAFTECKFTCTSGKCLYLGSLVCNQQNDCGDNSDEENCLLVTEHPPPGIFNS → MAA
     113-130: Missing.
Isoform 5 (identifier: O15165-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1-77: Missing.
Isoform 6 (identifier: O15165-6)

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: MPEAGFQATN...EHPPPGIFNS → MSSDHLNNSTLKEAQFKDLFLKKA
Note: No experimental confirmation available.
Isoform 7 (identifier: O15165-7)

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: MPEAGFQATN...EHPPPGIFNS → MSSDHLNNSTLKEAQFKDLFLKKA
     113-130: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 306306Low-density lipoprotein receptor class A domain-containing protein 4
PRO_0000185444

Regions

Topological domain1 – 6464Extracellular Potential
Transmembrane65 – 8521Helical; Potential
Topological domain86 – 306221Cytoplasmic Potential
Domain16 – 4833LDL-receptor class A

Amino acid modifications

Disulfide bond19 ↔ 38 By similarity
Disulfide bond32 ↔ 47 By similarity

Natural variations

Alternative sequence1 – 7777Missing in isoform 5.
VSP_013901
Alternative sequence1 – 6161MPEAG…GIFNS → MSSDHLNNSTLKEAQFKDLF LKKA in isoform 6 and isoform 7.
VSP_043253
Alternative sequence1 – 6161MPEAG…GIFNS → MAA in isoform Beta-1 and isoform Beta-2.
VSP_006439
Alternative sequence113 – 13018Missing in isoform Alpha-2, isoform Beta-2 and isoform 7.
VSP_006440

Experimental info

Sequence conflict1251R → Q in AAH66971. Ref.5
Sequence conflict1351P → T in AAH66971. Ref.5
Sequence conflict1941P → T in AAH66971. Ref.5

Sequences

Sequence LengthMass (Da)Tools
Isoform Alpha-1 [UniParc].

Last modified January 1, 1998. Version 1.
Checksum: F48EF66E329201BD

FASTA30633,900
        10         20         30         40         50         60 
MPEAGFQATN AFTECKFTCT SGKCLYLGSL VCNQQNDCGD NSDEENCLLV TEHPPPGIFN 

        70         80         90        100        110        120 
SELEFAQIII IVVVVTVMVV VIVCLLNHYK VSTRSFINRP NQSRRREDGL PQEGCLWPSD 

       130        140        150        160        170        180 
SAAPRLGASE IMHAPRSRDR FTAPSFIQRD RFSRFQPTYP YVQHEIDLPP TISLSDGEEP 

       190        200        210        220        230        240 
PPYQGPCTLQ LRDPEQQMEL NRESVRAPPN RTIFDSDLID IAMYSGGPCP PSSNSGISAS 

       250        260        270        280        290        300 
TCSSNGRMEG PPPTYSEVMG HHPGASFLHH QRSNAHRGSR LQFQQNNAES TIVPIKGKDR 


KPGNLV 

« Hide

Isoform Alpha-2 [UniParc].

Checksum: B7DEC603B9C5CA79
Show »

FASTA28832,072
Isoform Beta-1 [UniParc].

Checksum: B88763A5A86C970A
Show »

FASTA24827,600
Isoform Beta-2 [UniParc].

Checksum: 4EA79478440BC7C0
Show »

FASTA23025,772
Isoform 5 [UniParc].

Checksum: D124C6E3503B031E
Show »

FASTA22925,560
Isoform 6 [UniParc].

Checksum: BC8B8A807F64B908
Show »

FASTA26930,075
Isoform 7 [UniParc].

Checksum: BD0751CEB806A1B7
Show »

FASTA25128,247

References

« Hide 'large scale' references
[1]"Multiple transcriptional variants and RNA editing in C18orf1, a novel gene with LDLRA and transmembrane domains on 18p11.2."
Yoshikawa T., Sanders A.R., Esterling L.E., Detera-Wadleigh S.D.
Genomics 47:246-257(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ALPHA-1; ALPHA-2; BETA-1 AND BETA-2).
Tissue: Brain.
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6).
Tissue: Brain.
[3]"DNA sequence and analysis of human chromosome 18."
Nusbaum C., Zody M.C., Borowsky M.L., Kamal M., Kodira C.D., Taylor T.D., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Abouelleil A., Allen N.R., Anderson S., Bloom T., Bugalter B., Butler J. expand/collapse author list , Cook A., DeCaprio D., Engels R., Garber M., Gnirke A., Hafez N., Hall J.L., Norman C.H., Itoh T., Jaffe D.B., Kuroki Y., Lehoczky J., Lui A., Macdonald P., Mauceli E., Mikkelsen T.S., Naylor J.W., Nicol R., Nguyen C., Noguchi H., O'Leary S.B., Piqani B., Smith C.L., Talamas J.A., Topham K., Totoki Y., Toyoda A., Wain H.M., Young S.K., Zeng Q., Zimmer A.R., Fujiyama A., Hattori M., Birren B.W., Sakaki Y., Lander E.S.
Nature 437:551-555(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS ALPHA-2 AND 5).
Tissue: Brain.
[6]Ebert L., Heil O., Hennig S., Neubert P., Partsch E., Peters M., Radelof U., Schneider D., Korn B.
Submitted (DEC-2002) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 6-251 (ISOFORM 7).
Tissue: Testis.
[7]"Analysis of a t(18;21)(p11.1;p11.1) translocation in a family with schizophrenia."
Meerabux J.M., Ohba H., Iwayama Y., Maekawa M., Detera-Wadleigh S.D., DeLisi L.E., Yoshikawa T.
J. Hum. Genet. 54:386-391(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF009424 mRNA. Translation: AAC52023.1.
AF009425 mRNA. Translation: AAC52024.1.
AF009426 mRNA. Translation: AAC52025.1.
AF009427 mRNA. Translation: AAC52026.1.
AK055028 mRNA. Translation: BAG51451.1.
AP001010 Genomic DNA. No translation available.
AP002439 Genomic DNA. No translation available.
AP002505 Genomic DNA. No translation available.
AP005131 Genomic DNA. No translation available.
CH471113 Genomic DNA. Translation: EAX01514.1.
BC030199 mRNA. Translation: AAH30199.1.
BC066971 mRNA. Translation: AAH66971.1.
BX114947 mRNA. No translation available.
RefSeqNP_001003674.1. NM_001003674.3.
NP_001003675.1. NM_001003675.3.
NP_001263178.1. NM_001276249.1.
NP_001263180.1. NM_001276251.1.
NP_852146.1. NM_181481.4.
NP_852147.1. NM_181482.4.
XP_005258197.1. XM_005258140.1.
UniGeneHs.731853.
Hs.745141.

3D structure databases

ProteinModelPortalO15165.
SMRO15165. Positions 16-49.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid107209. 1 interaction.
STRING9606.ENSP00000354753.

PTM databases

PhosphoSiteO15165.

Proteomic databases

PaxDbO15165.
PRIDEO15165.

Protocols and materials databases

DNASU753.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000359446; ENSP00000352420; ENSG00000168675. [O15165-1]
ENST00000361205; ENSP00000354753; ENSG00000168675. [O15165-1]
ENST00000399848; ENSP00000382741; ENSG00000168675. [O15165-2]
ENST00000585931; ENSP00000466772; ENSG00000168675. [O15165-5]
ENST00000586765; ENSP00000474783; ENSG00000168675. [O15165-7]
ENST00000587757; ENSP00000466178; ENSG00000168675. [O15165-6]
GeneID753.
KEGGhsa:753.
UCSCuc002ksb.3. human. [O15165-2]
uc002kse.3. human. [O15165-6]
uc002ksg.2. human. [O15165-1]
uc002ksh.1. human. [O15165-3]
uc002ksi.1. human. [O15165-4]

Organism-specific databases

CTD753.
GeneCardsGC18P013217.
H-InvDBHIX0014349.
HGNCHGNC:1224. LDLRAD4.
MIM606571. gene.
neXtProtNX_O15165.
PharmGKBPA25593.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG27420.
HOGENOMHOG000276535.
HOVERGENHBG059833.
InParanoidO15165.
OMAPQEGCLW.
PhylomeDBO15165.
TreeFamTF331681.

Gene expression databases

ArrayExpressO15165.
BgeeO15165.
CleanExHS_C18orf1.
GenevestigatorO15165.

Family and domain databases

Gene3D4.10.400.10. 1 hit.
InterProIPR023415. LDLR_class-A_CS.
IPR002172. LDrepeatLR_classA_rpt.
[Graphical view]
PfamPF00057. Ldl_recept_a. 1 hit.
[Graphical view]
SMARTSM00192. LDLa. 1 hit.
[Graphical view]
SUPFAMSSF57424. SSF57424. 1 hit.
PROSITEPS01209. LDLRA_1. 1 hit.
PS50068. LDLRA_2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSC18orf1. human.
GenomeRNAi753.
NextBio3038.
PROO15165.
SOURCESearch...

Entry information

Entry nameLRAD4_HUMAN
AccessionPrimary (citable) accession number: O15165
Secondary accession number(s): B3KNT9 expand/collapse secondary AC list , E9PAY9, O15166, O15167, O15168, Q5U646, Q6NXP3
Entry history
Integrated into UniProtKB/Swiss-Prot: January 24, 2001
Last sequence update: January 1, 1998
Last modified: March 19, 2014
This is version 117 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 18

Human chromosome 18: entries, gene names and cross-references to MIM