Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

DNA-directed RNA polymerases I and III subunit RPAC1

Gene

POLR1C

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively. RPAC1 is part of the Pol core element with the central large cleft and probably a clamp element that moves to open and close the cleft (By similarity).By similarity1 Publication

GO - Molecular functioni

  • DNA binding Source: InterPro
  • DNA-directed RNA polymerase activity Source: ProtInc

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Transcription

Enzyme and pathway databases

BioCyciZFISH:HS10309-MONOMER.
ReactomeiR-HSA-1834949. Cytosolic sensors of pathogen-associated DNA.
R-HSA-427413. NoRC negatively regulates rRNA expression.
R-HSA-5250924. B-WICH complex positively regulates rRNA expression.
R-HSA-73762. RNA Polymerase I Transcription Initiation.
R-HSA-73772. RNA Polymerase I Promoter Escape.
R-HSA-73777. RNA Polymerase I Chain Elongation.
R-HSA-73780. RNA Polymerase III Chain Elongation.
R-HSA-73863. RNA Polymerase I Transcription Termination.
R-HSA-73980. RNA Polymerase III Transcription Termination.
R-HSA-749476. RNA Polymerase III Abortive And Retractive Initiation.
R-HSA-76061. RNA Polymerase III Transcription Initiation From Type 1 Promoter.
R-HSA-76066. RNA Polymerase III Transcription Initiation From Type 2 Promoter.
R-HSA-76071. RNA Polymerase III Transcription Initiation From Type 3 Promoter.

Names & Taxonomyi

Protein namesi
Recommended name:
DNA-directed RNA polymerases I and III subunit RPAC1
Short name:
DNA-directed RNA polymerase I subunit C
Short name:
RNA polymerases I and III subunit AC1
Alternative name(s):
AC40
DNA-directed RNA polymerases I and III 40 kDa polypeptide
Short name:
RPA40
RPA39
RPC40
Gene namesi
Name:POLR1C
Synonyms:POLR1E
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:20194. POLR1C.

Subcellular locationi

GO - Cellular componenti

  • cytosol Source: Reactome
  • DNA-directed RNA polymerase I complex Source: ProtInc
  • DNA-directed RNA polymerase III complex Source: MGI
  • nucleoplasm Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

DNA-directed RNA polymerase, Nucleus

Pathology & Biotechi

Involvement in diseasei

Treacher Collins syndrome 3 (TCS3)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of Treacher Collins syndrome, a disorder of craniofacial development. Treacher Collins syndrome is characterized by a combination of bilateral downward slanting of the palpebral fissures, colobomas of the lower eyelids with a paucity of eyelashes medial to the defect, hypoplasia of the facial bones, cleft palate, malformation of the external ears, atresia of the external auditory canals, and bilateral conductive hearing loss.
See also OMIM:248390
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_064899279R → Q in TCS3; no effect on localization to the nucleus; no effect on association with RNA polymerase I and RNA polymerase III complexes. 2 PublicationsCorresponds to variant rs191582628dbSNPEnsembl.1
Natural variantiVAR_064900279R → W in TCS3. 1 PublicationCorresponds to variant rs141156009dbSNPEnsembl.1
Leukodystrophy, hypomyelinating, 11 (HLD11)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal recessive neurologic disorder characterized by brain hypomyelination, delayed psychomotor development, intellectual disability, tremor and other neurologic symptoms. Some patients may additionally manifest non-neurologic features, particularly dental abnormalities and hypogonadotropic hypogonadism.
See also OMIM:616494
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_07465526T → I in HLD11. 1 PublicationCorresponds to variant rs796052126dbSNPEnsembl.1
Natural variantiVAR_07465632N → I in HLD11; decreased localization to the nucleus and retained in the cytoplasm; loss of association with RNA polymerase III-transcribed genes; decreased association with RNA polymerase III complex; probably prevents RNA polymerase III complex assembly and activity. 1 PublicationCorresponds to variant rs796052124dbSNPEnsembl.1
Natural variantiVAR_07465765M → V in HLD11. 1 PublicationCorresponds to variant rs141471029dbSNPEnsembl.1
Natural variantiVAR_07465874N → S in HLD11; decreased localization to the nucleus and retained in the cytoplasm; loss of association with RNA polymerase III-transcribed genes; decreased association with RNA polymerase III complex; probably prevents RNA polymerase III complex assembly and activity. 1 PublicationCorresponds to variant rs371802902dbSNPEnsembl.1
Natural variantiVAR_07465994V → A in HLD11. 1 Publication1
Natural variantiVAR_074660109R → H in HLD11. 1 PublicationCorresponds to variant rs796052127dbSNPEnsembl.1
Natural variantiVAR_074661132G → D in HLD11. 1 PublicationCorresponds to variant rs201320592dbSNPEnsembl.1
Natural variantiVAR_074662146C → R in HLD11. 1 PublicationCorresponds to variant rs796052125dbSNPEnsembl.1
Natural variantiVAR_074663191R → Q in HLD11. 1 PublicationCorresponds to variant rs373046018dbSNPEnsembl.1
Natural variantiVAR_074664262I → T in HLD11. 1 PublicationCorresponds to variant rs751006626dbSNPEnsembl.1
Natural variantiVAR_074665295Missing in HLD11. 1 Publication1
Natural variantiVAR_074666324E → K in HLD11. 1 Publication1

Keywords - Diseasei

Disease mutation, Leukodystrophy

Organism-specific databases

DisGeNETi9533.
MalaCardsiPOLR1C.
MIMi248390. phenotype.
616494. phenotype.
OpenTargetsiENSG00000171453.
Orphaneti861. Treacher-Collins syndrome.
PharmGKBiPA134882004.

Polymorphism and mutation databases

BioMutaiPOLR1C.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources1 Publication
ChainiPRO_00001327392 – 346DNA-directed RNA polymerases I and III subunit RPAC1Add BLAST345

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1 Publication1
Modified residuei4PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiO15160.
MaxQBiO15160.
PaxDbiO15160.
PeptideAtlasiO15160.
PRIDEiO15160.

2D gel databases

REPRODUCTION-2DPAGEIPI00217386.
SWISS-2DPAGEO15160.

PTM databases

iPTMnetiO15160.
PhosphoSitePlusiO15160.

Expressioni

Gene expression databases

BgeeiENSG00000171453.
CleanExiHS_POLR1C.
HS_POLR1E.
ExpressionAtlasiO15160. baseline and differential.
GenevisibleiO15160. HS.

Organism-specific databases

HPAiHPA031010.

Interactioni

Subunit structurei

Component of the RNA polymerase I (Pol I) and RNA polymerase III (Pol III) complexes consisting of at least 13 and 17 subunits, respectively.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
ATRIPQ8WXE13EBI-1055079,EBI-747353
BIRC7Q96CA55EBI-1055079,EBI-517623
CCDC36Q8IYA83EBI-1055079,EBI-8638439
FAM208BQ5VWN6-23EBI-1055079,EBI-10172380
IKZF3Q9UKT97EBI-1055079,EBI-747204
KCTD1Q719H95EBI-1055079,EBI-9027502
KRT19P087273EBI-1055079,EBI-742756
LZTS2Q9BRK43EBI-1055079,EBI-741037
MBIPQ9NS73-53EBI-1055079,EBI-10182361
MKRN3Q130644EBI-1055079,EBI-2340269
NME1P155317EBI-1055079,EBI-741141
POLR1DQ9Y2S011EBI-1055079,EBI-359498
POLR2JP524358EBI-1055079,EBI-394753
PPP2R3CQ969Q65EBI-1055079,EBI-2561661
RIMBP3Q9UFD95EBI-1055079,EBI-10182375
SAXO1Q8IYX73EBI-1055079,EBI-3957636
SMN2Q166375EBI-1055079,EBI-395421
SPERTQ8NA61-24EBI-1055079,EBI-11524851
TCF4P158843EBI-1055079,EBI-533224
TFIP11Q9UBB94EBI-1055079,EBI-1105213
TNFAIP1Q138296EBI-1055079,EBI-2505861
TRIM27P143735EBI-1055079,EBI-719493
TSC22D4Q9Y3Q85EBI-1055079,EBI-739485

Protein-protein interaction databases

BioGridi114909. 103 interactors.
DIPiDIP-27587N.
IntActiO15160. 75 interactors.
MINTiMINT-1137932.
STRINGi9606.ENSP00000361465.

Structurei

3D structure databases

ProteinModelPortaliO15160.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG1521. Eukaryota.
COG0202. LUCA.
GeneTreeiENSGT00550000075060.
HOGENOMiHOG000230845.
HOVERGENiHBG017743.
InParanoidiO15160.
KOiK03027.
OMAiGKCQRFL.
OrthoDBiEOG091G03FZ.
PhylomeDBiO15160.
TreeFamiTF103034.

Family and domain databases

CDDicd07032. RNAP_I_II_AC40. 1 hit.
Gene3Di2.170.120.12. 1 hit.
InterProiIPR001514. DNA-dir_RNA_pol_30-40kDasu_CS.
IPR011262. DNA-dir_RNA_pol_insert.
IPR011263. DNA-dir_RNA_pol_RpoA/D/Rpb3.
IPR009025. RBP11-like_dimer.
IPR033901. RNAPI/II_AC40.
[Graphical view]
PfamiPF01000. RNA_pol_A_bac. 1 hit.
PF01193. RNA_pol_L. 1 hit.
[Graphical view]
SMARTiSM00662. RPOLD. 1 hit.
[Graphical view]
SUPFAMiSSF55257. SSF55257. 2 hits.
SSF56553. SSF56553. 1 hit.
PROSITEiPS00446. RNA_POL_D_30KD. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O15160-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAASQAVEEM RSRVVLGEFG VRNVHTTDFP GNYSGYDDAW DQDRFEKNFR
60 70 80 90 100
VDVVHMDENS LEFDMVGIDA AIANAFRRIL LAEVPTMAVE KVLVYNNTSI
110 120 130 140 150
VQDEILAHRL GLIPIHADPR LFEYRNQGDE EGTEIDTLQF RLQVRCTRNP
160 170 180 190 200
HAAKDSSDPN ELYVNHKVYT RHMTWIPLGN QADLFPEGTI RPVHDDILIA
210 220 230 240 250
QLRPGQEIDL LMHCVKGIGK DHAKFSPVAT ASYRLLPDIT LLEPVEGEAA
260 270 280 290 300
EELSRCFSPG VIEVQEVQGK KVARVANPRL DTFSREIFRN EKLKKVVRLA
310 320 330 340
RVRDHYIFSV ESTGVLPPDV LVSEAIKVLM GKCRRFLDEL DAVQMD
Length:346
Mass (Da):39,250
Last modified:January 1, 1998 - v1
Checksum:iB7D558BC8F33D92E
GO
Isoform 2 (identifier: O15160-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     308-346: FSVESTGVLPPDVLVSEAIKVLMGKCRRFLDELDAVQMD → CKKDLLAAVAHTCNPSTLGGQGEWITGSRERDHPG

Note: No experimental confirmation available.
Show »
Length:342
Mass (Da):38,647
Checksum:i9E2785123BB74D8B
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_07465526T → I in HLD11. 1 PublicationCorresponds to variant rs796052126dbSNPEnsembl.1
Natural variantiVAR_07465632N → I in HLD11; decreased localization to the nucleus and retained in the cytoplasm; loss of association with RNA polymerase III-transcribed genes; decreased association with RNA polymerase III complex; probably prevents RNA polymerase III complex assembly and activity. 1 PublicationCorresponds to variant rs796052124dbSNPEnsembl.1
Natural variantiVAR_07465765M → V in HLD11. 1 PublicationCorresponds to variant rs141471029dbSNPEnsembl.1
Natural variantiVAR_07465874N → S in HLD11; decreased localization to the nucleus and retained in the cytoplasm; loss of association with RNA polymerase III-transcribed genes; decreased association with RNA polymerase III complex; probably prevents RNA polymerase III complex assembly and activity. 1 PublicationCorresponds to variant rs371802902dbSNPEnsembl.1
Natural variantiVAR_07465994V → A in HLD11. 1 Publication1
Natural variantiVAR_074660109R → H in HLD11. 1 PublicationCorresponds to variant rs796052127dbSNPEnsembl.1
Natural variantiVAR_074661132G → D in HLD11. 1 PublicationCorresponds to variant rs201320592dbSNPEnsembl.1
Natural variantiVAR_074662146C → R in HLD11. 1 PublicationCorresponds to variant rs796052125dbSNPEnsembl.1
Natural variantiVAR_074663191R → Q in HLD11. 1 PublicationCorresponds to variant rs373046018dbSNPEnsembl.1
Natural variantiVAR_074664262I → T in HLD11. 1 PublicationCorresponds to variant rs751006626dbSNPEnsembl.1
Natural variantiVAR_064899279R → Q in TCS3; no effect on localization to the nucleus; no effect on association with RNA polymerase I and RNA polymerase III complexes. 2 PublicationsCorresponds to variant rs191582628dbSNPEnsembl.1
Natural variantiVAR_064900279R → W in TCS3. 1 PublicationCorresponds to variant rs141156009dbSNPEnsembl.1
Natural variantiVAR_074665295Missing in HLD11. 1 Publication1
Natural variantiVAR_074666324E → K in HLD11. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_005913308 – 346FSVES…AVQMD → CKKDLLAAVAHTCNPSTLGG QGEWITGSRERDHPG in isoform 2. 1 PublicationAdd BLAST39

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF008442 mRNA. Translation: AAC14354.1.
AF047441 mRNA. Translation: AAC39892.1.
AL355802 Genomic DNA. Translation: CAI42629.1.
BC008863 mRNA. Translation: AAH08863.1.
CCDSiCCDS4901.1. [O15160-1]
RefSeqiNP_001305805.1. NM_001318876.1. [O15160-2]
NP_976035.1. NM_203290.3. [O15160-1]
UniGeneiHs.743509.

Genome annotation databases

EnsembliENST00000304004; ENSP00000307212; ENSG00000171453. [O15160-2]
ENST00000372389; ENSP00000361465; ENSG00000171453. [O15160-1]
GeneIDi9533.
KEGGihsa:9533.
UCSCiuc003ovn.4. human. [O15160-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF008442 mRNA. Translation: AAC14354.1.
AF047441 mRNA. Translation: AAC39892.1.
AL355802 Genomic DNA. Translation: CAI42629.1.
BC008863 mRNA. Translation: AAH08863.1.
CCDSiCCDS4901.1. [O15160-1]
RefSeqiNP_001305805.1. NM_001318876.1. [O15160-2]
NP_976035.1. NM_203290.3. [O15160-1]
UniGeneiHs.743509.

3D structure databases

ProteinModelPortaliO15160.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114909. 103 interactors.
DIPiDIP-27587N.
IntActiO15160. 75 interactors.
MINTiMINT-1137932.
STRINGi9606.ENSP00000361465.

PTM databases

iPTMnetiO15160.
PhosphoSitePlusiO15160.

Polymorphism and mutation databases

BioMutaiPOLR1C.

2D gel databases

REPRODUCTION-2DPAGEIPI00217386.
SWISS-2DPAGEO15160.

Proteomic databases

EPDiO15160.
MaxQBiO15160.
PaxDbiO15160.
PeptideAtlasiO15160.
PRIDEiO15160.

Protocols and materials databases

DNASUi9533.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000304004; ENSP00000307212; ENSG00000171453. [O15160-2]
ENST00000372389; ENSP00000361465; ENSG00000171453. [O15160-1]
GeneIDi9533.
KEGGihsa:9533.
UCSCiuc003ovn.4. human. [O15160-1]

Organism-specific databases

CTDi9533.
DisGeNETi9533.
GeneCardsiPOLR1C.
GeneReviewsiPOLR1C.
H-InvDBHIX0005907.
HGNCiHGNC:20194. POLR1C.
HPAiHPA031010.
MalaCardsiPOLR1C.
MIMi248390. phenotype.
610060. gene.
616494. phenotype.
neXtProtiNX_O15160.
OpenTargetsiENSG00000171453.
Orphaneti861. Treacher-Collins syndrome.
PharmGKBiPA134882004.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1521. Eukaryota.
COG0202. LUCA.
GeneTreeiENSGT00550000075060.
HOGENOMiHOG000230845.
HOVERGENiHBG017743.
InParanoidiO15160.
KOiK03027.
OMAiGKCQRFL.
OrthoDBiEOG091G03FZ.
PhylomeDBiO15160.
TreeFamiTF103034.

Enzyme and pathway databases

BioCyciZFISH:HS10309-MONOMER.
ReactomeiR-HSA-1834949. Cytosolic sensors of pathogen-associated DNA.
R-HSA-427413. NoRC negatively regulates rRNA expression.
R-HSA-5250924. B-WICH complex positively regulates rRNA expression.
R-HSA-73762. RNA Polymerase I Transcription Initiation.
R-HSA-73772. RNA Polymerase I Promoter Escape.
R-HSA-73777. RNA Polymerase I Chain Elongation.
R-HSA-73780. RNA Polymerase III Chain Elongation.
R-HSA-73863. RNA Polymerase I Transcription Termination.
R-HSA-73980. RNA Polymerase III Transcription Termination.
R-HSA-749476. RNA Polymerase III Abortive And Retractive Initiation.
R-HSA-76061. RNA Polymerase III Transcription Initiation From Type 1 Promoter.
R-HSA-76066. RNA Polymerase III Transcription Initiation From Type 2 Promoter.
R-HSA-76071. RNA Polymerase III Transcription Initiation From Type 3 Promoter.

Miscellaneous databases

GeneWikiiPOLR1C.
GenomeRNAii9533.
PROiO15160.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000171453.
CleanExiHS_POLR1C.
HS_POLR1E.
ExpressionAtlasiO15160. baseline and differential.
GenevisibleiO15160. HS.

Family and domain databases

CDDicd07032. RNAP_I_II_AC40. 1 hit.
Gene3Di2.170.120.12. 1 hit.
InterProiIPR001514. DNA-dir_RNA_pol_30-40kDasu_CS.
IPR011262. DNA-dir_RNA_pol_insert.
IPR011263. DNA-dir_RNA_pol_RpoA/D/Rpb3.
IPR009025. RBP11-like_dimer.
IPR033901. RNAPI/II_AC40.
[Graphical view]
PfamiPF01000. RNA_pol_A_bac. 1 hit.
PF01193. RNA_pol_L. 1 hit.
[Graphical view]
SMARTiSM00662. RPOLD. 1 hit.
[Graphical view]
SUPFAMiSSF55257. SSF55257. 2 hits.
SSF56553. SSF56553. 1 hit.
PROSITEiPS00446. RNA_POL_D_30KD. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiRPAC1_HUMAN
AccessioniPrimary (citable) accession number: O15160
Secondary accession number(s): O75395, Q5JTE3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 15, 1998
Last sequence update: January 1, 1998
Last modified: November 30, 2016
This is version 175 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.