Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O15156

- ZBT7B_HUMAN

UniProt

O15156 - ZBT7B_HUMAN

Protein

Zinc finger and BTB domain-containing protein 7B

Gene

ZBTB7B

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 122 (01 Oct 2014)
      Sequence version 2 (16 Aug 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Transcription regulator that acts as a key regulator of lineage commitment of immature T-cell precursors. Necessary and sufficient for commitment of CD4 lineage, while its absence causes CD8 commitment. Development of immature T-cell precursors (thymocytes) to either the CD4 helper or CD8 killer T-cell lineages correlates precisely with their T-cell receptor specificity for major histocompatibility complex class II or class I molecules, respectively. Transcriptional repressor of the collagen COL1A1 and COL1A2 genes. May also function as a repressor of fibronectin and possibly other extracellular matrix genes By similarity.By similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri346 – 36823C2H2-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri374 – 39623C2H2-type 2PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri402 – 42423C2H2-type 3PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri430 – 45425C2H2-type 4; atypicalPROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. DNA binding Source: UniProtKB-KW
    2. metal ion binding Source: UniProtKB-KW

    GO - Biological processi

    1. cell differentiation Source: UniProtKB-KW
    2. ectoderm development Source: ProtInc
    3. multicellular organismal development Source: UniProtKB-KW
    4. regulation of transcription, DNA-templated Source: UniProtKB-KW
    5. transcription from RNA polymerase II promoter Source: ProtInc

    Keywords - Molecular functioni

    Developmental protein, Repressor

    Keywords - Biological processi

    Differentiation, Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding, Metal-binding, Zinc

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Zinc finger and BTB domain-containing protein 7B
    Alternative name(s):
    Krueppel-related zinc finger protein cKrox
    Short name:
    hcKrox
    T-helper-inducing POZ/Krueppel-like factor
    Zinc finger and BTB domain-containing protein 15
    Zinc finger protein 67 homolog
    Short name:
    Zfp-67
    Zinc finger protein 857B
    Zinc finger protein Th-POK
    Gene namesi
    Name:ZBTB7B
    Synonyms:ZBTB15, ZFP67, ZNF857B
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:18668. ZBTB7B.

    Subcellular locationi

    GO - Cellular componenti

    1. nucleus Source: HPA

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA38630.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 539539Zinc finger and BTB domain-containing protein 7BPRO_0000047719Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei369 – 3691Phosphothreonine1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiO15156.
    PaxDbiO15156.
    PRIDEiO15156.

    PTM databases

    PhosphoSiteiO15156.

    Expressioni

    Gene expression databases

    BgeeiO15156.
    CleanExiHS_ZBTB7B.
    GenevestigatoriO15156.

    Organism-specific databases

    HPAiHPA006811.
    HPA025820.

    Interactioni

    Protein-protein interaction databases

    BioGridi119242. 20 interactions.
    IntActiO15156. 3 interactions.
    MINTiMINT-1451723.
    STRINGi9606.ENSP00000292176.

    Structurei

    3D structure databases

    ProteinModelPortaliO15156.
    SMRiO15156. Positions 9-141, 317-448.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini34 – 11582BTBPROSITE-ProRule annotationAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi181 – 19616Pro-richAdd
    BLAST

    Sequence similaritiesi

    Contains 1 BTB (POZ) domain.PROSITE-ProRule annotation
    Contains 4 C2H2-type zinc fingers.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri346 – 36823C2H2-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri374 – 39623C2H2-type 2PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri402 – 42423C2H2-type 3PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri430 – 45425C2H2-type 4; atypicalPROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Repeat, Zinc-finger

    Phylogenomic databases

    eggNOGiCOG5048.
    HOGENOMiHOG000082521.
    HOVERGENiHBG059461.
    InParanoidiO15156.
    KOiK10494.
    OMAiIGIPFPE.
    OrthoDBiEOG70CR6Z.
    PhylomeDBiO15156.
    TreeFamiTF331824.

    Family and domain databases

    Gene3Di3.30.160.60. 4 hits.
    3.30.710.10. 1 hit.
    InterProiIPR000210. BTB/POZ-like.
    IPR011333. BTB/POZ_fold.
    IPR013069. BTB_POZ.
    IPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    IPR013087. Znf_C2H2/integrase_DNA-bd.
    [Graphical view]
    PfamiPF00651. BTB. 1 hit.
    [Graphical view]
    SMARTiSM00225. BTB. 1 hit.
    SM00355. ZnF_C2H2. 4 hits.
    [Graphical view]
    SUPFAMiSSF54695. SSF54695. 1 hit.
    PROSITEiPS50097. BTB. 1 hit.
    PS00028. ZINC_FINGER_C2H2_1. 3 hits.
    PS50157. ZINC_FINGER_C2H2_2. 4 hits.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O15156-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGSPEDDLIG IPFPDHSSEL LSCLNEQRQL GHLCDLTIRT QGLEYRTHRA    50
    VLAACSHYFK KLFTEGGGGA VMGAGGSGTA TGGAGAGVCE LDFVGPEALG 100
    ALLEFAYTAT LTTSSANMPA VLQAARLLEI PCVIAACMEI LQGSGLEAPS 150
    PDEDDCERAR QYLEAFATAT ASGVPNGEDS PPQVPLPPPP PPPPRPVARR 200
    SRKPRKAFLQ TKGARANHLV PEVPTVPAHP LTYEEEEVAG RVGSSGGSGP 250
    GDSYSPPTGT ASPPEGPQSY EPYEGEEEEE ELVYPPAYGL AQGGGPPLSP 300
    EELGSDEDAI DPDLMAYLSS LHQDNLAPGL DSQDKLVRKR RSQMPQECPV 350
    CHKIIHGAGK LPRHMRTHTG EKPFACEVCG VRFTRNDKLK IHMRKHTGER 400
    PYSCPHCPAR FLHSYDLKNH MHLHTGDRPY ECHLCHKAFA KEDHLQRHLK 450
    GQNCLEVRTR RRRKDDAPPH YPPPSTAAAS PAGLDLSNGH LDTFRLSLAR 500
    FWEQSAPTGP PVSTPGPPDD DEEEGAPTTP QAEGAMESS 539
    Length:539
    Mass (Da):58,027
    Last modified:August 16, 2004 - v2
    Checksum:i86B3616504B05B7E
    GO
    Isoform 2 (identifier: O15156-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MLQPGPHPPSPQAAAPGEAWPGPSQAPWQSLEEKM

    Note: No experimental confirmation available.

    Show »
    Length:573
    Mass (Da):61,584
    Checksum:iF85D79769C9BE294
    GO

    Sequence cautioni

    The sequence CAH18158.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti90 – 901E → K in BAG65517. (PubMed:14702039)Curated
    Sequence conflicti235 – 2351E → G in BAG65517. (PubMed:14702039)Curated
    Sequence conflicti437 – 4371K → R in AAC51847. (PubMed:9370309)Curated
    Sequence conflicti480 – 4801S → F in AAC51847. (PubMed:9370309)Curated
    Sequence conflicti509 – 5102GP → WA in AAC51847. (PubMed:9370309)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11M → MLQPGPHPPSPQAAAPGEAW PGPSQAPWQSLEEKM in isoform 2. 1 PublicationVSP_044721

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF007833 mRNA. Translation: AAC51847.1.
    AK304762 mRNA. Translation: BAG65517.1.
    CR749303 mRNA. Translation: CAH18158.1. Different initiation.
    AL451085 Genomic DNA. Translation: CAI13266.1.
    CH471121 Genomic DNA. Translation: EAW53149.1.
    CH471121 Genomic DNA. Translation: EAW53150.1.
    CH471121 Genomic DNA. Translation: EAW53151.1.
    BC012070 mRNA. Translation: AAH12070.1.
    CCDSiCCDS1081.1. [O15156-1]
    CCDS58030.1. [O15156-2]
    RefSeqiNP_001239335.1. NM_001252406.2. [O15156-2]
    NP_001243384.1. NM_001256455.1. [O15156-1]
    XP_006711416.1. XM_006711353.1. [O15156-1]
    XP_006711417.1. XM_006711354.1. [O15156-1]
    XP_006711418.1. XM_006711355.1. [O15156-1]
    XP_006711419.1. XM_006711356.1. [O15156-1]
    XP_006711420.1. XM_006711357.1. [O15156-1]
    XP_006711421.1. XM_006711358.1. [O15156-1]
    XP_006711422.1. XM_006711359.1. [O15156-1]
    UniGeneiHs.729279.
    Hs.744441.

    Genome annotation databases

    EnsembliENST00000292176; ENSP00000292176; ENSG00000160685. [O15156-1]
    ENST00000368426; ENSP00000357411; ENSG00000160685. [O15156-1]
    ENST00000417934; ENSP00000406286; ENSG00000160685. [O15156-2]
    ENST00000535420; ENSP00000438647; ENSG00000160685. [O15156-1]
    GeneIDi51043.
    KEGGihsa:51043.
    UCSCiuc001fgk.4. human. [O15156-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF007833 mRNA. Translation: AAC51847.1 .
    AK304762 mRNA. Translation: BAG65517.1 .
    CR749303 mRNA. Translation: CAH18158.1 . Different initiation.
    AL451085 Genomic DNA. Translation: CAI13266.1 .
    CH471121 Genomic DNA. Translation: EAW53149.1 .
    CH471121 Genomic DNA. Translation: EAW53150.1 .
    CH471121 Genomic DNA. Translation: EAW53151.1 .
    BC012070 mRNA. Translation: AAH12070.1 .
    CCDSi CCDS1081.1. [O15156-1 ]
    CCDS58030.1. [O15156-2 ]
    RefSeqi NP_001239335.1. NM_001252406.2. [O15156-2 ]
    NP_001243384.1. NM_001256455.1. [O15156-1 ]
    XP_006711416.1. XM_006711353.1. [O15156-1 ]
    XP_006711417.1. XM_006711354.1. [O15156-1 ]
    XP_006711418.1. XM_006711355.1. [O15156-1 ]
    XP_006711419.1. XM_006711356.1. [O15156-1 ]
    XP_006711420.1. XM_006711357.1. [O15156-1 ]
    XP_006711421.1. XM_006711358.1. [O15156-1 ]
    XP_006711422.1. XM_006711359.1. [O15156-1 ]
    UniGenei Hs.729279.
    Hs.744441.

    3D structure databases

    ProteinModelPortali O15156.
    SMRi O15156. Positions 9-141, 317-448.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 119242. 20 interactions.
    IntActi O15156. 3 interactions.
    MINTi MINT-1451723.
    STRINGi 9606.ENSP00000292176.

    PTM databases

    PhosphoSitei O15156.

    Proteomic databases

    MaxQBi O15156.
    PaxDbi O15156.
    PRIDEi O15156.

    Protocols and materials databases

    DNASUi 51043.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000292176 ; ENSP00000292176 ; ENSG00000160685 . [O15156-1 ]
    ENST00000368426 ; ENSP00000357411 ; ENSG00000160685 . [O15156-1 ]
    ENST00000417934 ; ENSP00000406286 ; ENSG00000160685 . [O15156-2 ]
    ENST00000535420 ; ENSP00000438647 ; ENSG00000160685 . [O15156-1 ]
    GeneIDi 51043.
    KEGGi hsa:51043.
    UCSCi uc001fgk.4. human. [O15156-1 ]

    Organism-specific databases

    CTDi 51043.
    GeneCardsi GC01P154975.
    HGNCi HGNC:18668. ZBTB7B.
    HPAi HPA006811.
    HPA025820.
    MIMi 607646. gene.
    neXtProti NX_O15156.
    PharmGKBi PA38630.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5048.
    HOGENOMi HOG000082521.
    HOVERGENi HBG059461.
    InParanoidi O15156.
    KOi K10494.
    OMAi IGIPFPE.
    OrthoDBi EOG70CR6Z.
    PhylomeDBi O15156.
    TreeFami TF331824.

    Miscellaneous databases

    ChiTaRSi ZBTB7B. human.
    GeneWikii ZBTB7B.
    GenomeRNAii 51043.
    NextBioi 35535390.
    PROi O15156.
    SOURCEi Search...

    Gene expression databases

    Bgeei O15156.
    CleanExi HS_ZBTB7B.
    Genevestigatori O15156.

    Family and domain databases

    Gene3Di 3.30.160.60. 4 hits.
    3.30.710.10. 1 hit.
    InterProi IPR000210. BTB/POZ-like.
    IPR011333. BTB/POZ_fold.
    IPR013069. BTB_POZ.
    IPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    IPR013087. Znf_C2H2/integrase_DNA-bd.
    [Graphical view ]
    Pfami PF00651. BTB. 1 hit.
    [Graphical view ]
    SMARTi SM00225. BTB. 1 hit.
    SM00355. ZnF_C2H2. 4 hits.
    [Graphical view ]
    SUPFAMi SSF54695. SSF54695. 1 hit.
    PROSITEi PS50097. BTB. 1 hit.
    PS00028. ZINC_FINGER_C2H2_1. 3 hits.
    PS50157. ZINC_FINGER_C2H2_2. 4 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and characterization of hcKrox, a transcriptional regulator of extracellular matrix gene expression."
      Widom R.L., Culic I., Lee J.Y., Korn J.H.
      Gene 198:407-420(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION.
      Tissue: Skin fibroblast.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Uterus.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Salivary gland.
    4. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Uterus.
    7. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-369, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    8. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.

    Entry informationi

    Entry nameiZBT7B_HUMAN
    AccessioniPrimary (citable) accession number: O15156
    Secondary accession number(s): B4E3K5
    , D3DV83, J3KQQ3, Q68DR2, Q96EP2
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: August 16, 2004
    Last sequence update: August 16, 2004
    Last modified: October 1, 2014
    This is version 122 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3