Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger and BTB domain-containing protein 7B

Gene

ZBTB7B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Transcription regulator that acts as a key regulator of lineage commitment of immature T-cell precursors. Necessary and sufficient for commitment of CD4 lineage, while its absence causes CD8 commitment. Development of immature T-cell precursors (thymocytes) to either the CD4 helper or CD8 killer T-cell lineages correlates precisely with their T-cell receptor specificity for major histocompatibility complex class II or class I molecules, respectively. Transcriptional repressor of the collagen COL1A1 and COL1A2 genes. May also function as a repressor of fibronectin and possibly other extracellular matrix genes (By similarity).By similarity1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri346 – 368C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri374 – 396C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri402 – 424C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri430 – 454C2H2-type 4; atypicalPROSITE-ProRule annotationAdd BLAST25

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Developmental protein, Repressor

Keywords - Biological processi

Differentiation, Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Enzyme and pathway databases

BioCyciZFISH:ENSG00000160685-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger and BTB domain-containing protein 7B
Alternative name(s):
Krueppel-related zinc finger protein cKrox
Short name:
hcKrox
T-helper-inducing POZ/Krueppel-like factor
Zinc finger and BTB domain-containing protein 15
Zinc finger protein 67 homolog
Short name:
Zfp-67
Zinc finger protein 857B
Zinc finger protein Th-POK
Gene namesi
Name:ZBTB7B
Synonyms:ZBTB15, ZFP67, ZNF857B
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:18668. ZBTB7B.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi51043.
OpenTargetsiENSG00000160685.
PharmGKBiPA38630.

Polymorphism and mutation databases

BioMutaiZBTB7B.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000477191 – 539Zinc finger and BTB domain-containing protein 7BAdd BLAST539

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei150PhosphoserineCombined sources1
Modified residuei369PhosphothreonineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiO15156.
MaxQBiO15156.
PaxDbiO15156.
PeptideAtlasiO15156.
PRIDEiO15156.

PTM databases

iPTMnetiO15156.
PhosphoSitePlusiO15156.

Expressioni

Gene expression databases

BgeeiENSG00000160685.
CleanExiHS_ZBTB7B.
GenevisibleiO15156. HS.

Organism-specific databases

HPAiHPA006811.
HPA025820.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
Q5JPT63EBI-740434,EBI-10244213
BCL6P411823EBI-740434,EBI-765407
GRB2P629933EBI-740434,EBI-401755
IMP4Q96G214EBI-740434,EBI-8641721
MORF4L2Q150143EBI-740434,EBI-399257
NCK2O436393EBI-740434,EBI-713635
PIN1Q135263EBI-740434,EBI-714158
RPL9P9P329693EBI-740434,EBI-358122
SH3YL1Q96HL83EBI-740434,EBI-722667
SORBS3O605043EBI-740434,EBI-741237
SYTL4Q96C243EBI-740434,EBI-747142
ZBTB5O150623EBI-740434,EBI-722671

Protein-protein interaction databases

BioGridi119242. 36 interactors.
IntActiO15156. 20 interactors.
MINTiMINT-1451723.
STRINGi9606.ENSP00000292176.

Structurei

3D structure databases

ProteinModelPortaliO15156.
SMRiO15156.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini34 – 115BTBPROSITE-ProRule annotationAdd BLAST82

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi181 – 196Pro-richAdd BLAST16

Sequence similaritiesi

Contains 1 BTB (POZ) domain.PROSITE-ProRule annotation
Contains 4 C2H2-type zinc fingers.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri346 – 368C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri374 – 396C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri402 – 424C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri430 – 454C2H2-type 4; atypicalPROSITE-ProRule annotationAdd BLAST25

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00850000132251.
HOGENOMiHOG000082521.
HOVERGENiHBG059461.
InParanoidiO15156.
KOiK10494.
OMAiPNGDDSP.
OrthoDBiEOG091G08VI.
PhylomeDBiO15156.
TreeFamiTF331824.

Family and domain databases

Gene3Di3.30.160.60. 4 hits.
InterProiIPR000210. BTB/POZ_dom.
IPR011333. SKP1/BTB/POZ.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF00651. BTB. 1 hit.
[Graphical view]
SMARTiSM00225. BTB. 1 hit.
SM00355. ZnF_C2H2. 4 hits.
[Graphical view]
SUPFAMiSSF54695. SSF54695. 1 hit.
PROSITEiPS50097. BTB. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 3 hits.
PS50157. ZINC_FINGER_C2H2_2. 4 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O15156-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGSPEDDLIG IPFPDHSSEL LSCLNEQRQL GHLCDLTIRT QGLEYRTHRA
60 70 80 90 100
VLAACSHYFK KLFTEGGGGA VMGAGGSGTA TGGAGAGVCE LDFVGPEALG
110 120 130 140 150
ALLEFAYTAT LTTSSANMPA VLQAARLLEI PCVIAACMEI LQGSGLEAPS
160 170 180 190 200
PDEDDCERAR QYLEAFATAT ASGVPNGEDS PPQVPLPPPP PPPPRPVARR
210 220 230 240 250
SRKPRKAFLQ TKGARANHLV PEVPTVPAHP LTYEEEEVAG RVGSSGGSGP
260 270 280 290 300
GDSYSPPTGT ASPPEGPQSY EPYEGEEEEE ELVYPPAYGL AQGGGPPLSP
310 320 330 340 350
EELGSDEDAI DPDLMAYLSS LHQDNLAPGL DSQDKLVRKR RSQMPQECPV
360 370 380 390 400
CHKIIHGAGK LPRHMRTHTG EKPFACEVCG VRFTRNDKLK IHMRKHTGER
410 420 430 440 450
PYSCPHCPAR FLHSYDLKNH MHLHTGDRPY ECHLCHKAFA KEDHLQRHLK
460 470 480 490 500
GQNCLEVRTR RRRKDDAPPH YPPPSTAAAS PAGLDLSNGH LDTFRLSLAR
510 520 530
FWEQSAPTGP PVSTPGPPDD DEEEGAPTTP QAEGAMESS
Length:539
Mass (Da):58,027
Last modified:August 16, 2004 - v2
Checksum:i86B3616504B05B7E
GO
Isoform 2 (identifier: O15156-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLQPGPHPPSPQAAAPGEAWPGPSQAPWQSLEEKM

Note: No experimental confirmation available.
Show »
Length:573
Mass (Da):61,584
Checksum:iF85D79769C9BE294
GO

Sequence cautioni

The sequence CAH18158 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti90E → K in BAG65517 (PubMed:14702039).Curated1
Sequence conflicti235E → G in BAG65517 (PubMed:14702039).Curated1
Sequence conflicti437K → R in AAC51847 (PubMed:9370309).Curated1
Sequence conflicti480S → F in AAC51847 (PubMed:9370309).Curated1
Sequence conflicti509 – 510GP → WA in AAC51847 (PubMed:9370309).Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0447211M → MLQPGPHPPSPQAAAPGEAW PGPSQAPWQSLEEKM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF007833 mRNA. Translation: AAC51847.1.
AK304762 mRNA. Translation: BAG65517.1.
CR749303 mRNA. Translation: CAH18158.1. Different initiation.
AL451085 Genomic DNA. Translation: CAI13266.1.
CH471121 Genomic DNA. Translation: EAW53149.1.
CH471121 Genomic DNA. Translation: EAW53150.1.
CH471121 Genomic DNA. Translation: EAW53151.1.
BC012070 mRNA. Translation: AAH12070.1.
CCDSiCCDS1081.1. [O15156-1]
CCDS58030.1. [O15156-2]
RefSeqiNP_001239335.1. NM_001252406.2. [O15156-2]
NP_001243384.1. NM_001256455.1. [O15156-1]
XP_006711412.2. XM_006711349.2. [O15156-1]
XP_006711416.1. XM_006711353.1. [O15156-1]
XP_006711417.1. XM_006711354.1. [O15156-1]
XP_006711419.1. XM_006711356.3. [O15156-1]
XP_006711420.1. XM_006711357.1. [O15156-1]
XP_006711421.1. XM_006711358.1. [O15156-1]
XP_006711422.1. XM_006711359.2. [O15156-1]
XP_011507900.1. XM_011509598.2. [O15156-2]
XP_011507901.1. XM_011509599.2. [O15156-1]
UniGeneiHs.729279.
Hs.744441.

Genome annotation databases

EnsembliENST00000292176; ENSP00000292176; ENSG00000160685. [O15156-1]
ENST00000368426; ENSP00000357411; ENSG00000160685. [O15156-1]
ENST00000417934; ENSP00000406286; ENSG00000160685. [O15156-2]
ENST00000535420; ENSP00000438647; ENSG00000160685. [O15156-1]
GeneIDi51043.
KEGGihsa:51043.
UCSCiuc001fgk.5. human. [O15156-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF007833 mRNA. Translation: AAC51847.1.
AK304762 mRNA. Translation: BAG65517.1.
CR749303 mRNA. Translation: CAH18158.1. Different initiation.
AL451085 Genomic DNA. Translation: CAI13266.1.
CH471121 Genomic DNA. Translation: EAW53149.1.
CH471121 Genomic DNA. Translation: EAW53150.1.
CH471121 Genomic DNA. Translation: EAW53151.1.
BC012070 mRNA. Translation: AAH12070.1.
CCDSiCCDS1081.1. [O15156-1]
CCDS58030.1. [O15156-2]
RefSeqiNP_001239335.1. NM_001252406.2. [O15156-2]
NP_001243384.1. NM_001256455.1. [O15156-1]
XP_006711412.2. XM_006711349.2. [O15156-1]
XP_006711416.1. XM_006711353.1. [O15156-1]
XP_006711417.1. XM_006711354.1. [O15156-1]
XP_006711419.1. XM_006711356.3. [O15156-1]
XP_006711420.1. XM_006711357.1. [O15156-1]
XP_006711421.1. XM_006711358.1. [O15156-1]
XP_006711422.1. XM_006711359.2. [O15156-1]
XP_011507900.1. XM_011509598.2. [O15156-2]
XP_011507901.1. XM_011509599.2. [O15156-1]
UniGeneiHs.729279.
Hs.744441.

3D structure databases

ProteinModelPortaliO15156.
SMRiO15156.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119242. 36 interactors.
IntActiO15156. 20 interactors.
MINTiMINT-1451723.
STRINGi9606.ENSP00000292176.

PTM databases

iPTMnetiO15156.
PhosphoSitePlusiO15156.

Polymorphism and mutation databases

BioMutaiZBTB7B.

Proteomic databases

EPDiO15156.
MaxQBiO15156.
PaxDbiO15156.
PeptideAtlasiO15156.
PRIDEiO15156.

Protocols and materials databases

DNASUi51043.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000292176; ENSP00000292176; ENSG00000160685. [O15156-1]
ENST00000368426; ENSP00000357411; ENSG00000160685. [O15156-1]
ENST00000417934; ENSP00000406286; ENSG00000160685. [O15156-2]
ENST00000535420; ENSP00000438647; ENSG00000160685. [O15156-1]
GeneIDi51043.
KEGGihsa:51043.
UCSCiuc001fgk.5. human. [O15156-1]

Organism-specific databases

CTDi51043.
DisGeNETi51043.
GeneCardsiZBTB7B.
HGNCiHGNC:18668. ZBTB7B.
HPAiHPA006811.
HPA025820.
MIMi607646. gene.
neXtProtiNX_O15156.
OpenTargetsiENSG00000160685.
PharmGKBiPA38630.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00850000132251.
HOGENOMiHOG000082521.
HOVERGENiHBG059461.
InParanoidiO15156.
KOiK10494.
OMAiPNGDDSP.
OrthoDBiEOG091G08VI.
PhylomeDBiO15156.
TreeFamiTF331824.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000160685-MONOMER.

Miscellaneous databases

ChiTaRSiZBTB7B. human.
GeneWikiiZBTB7B.
GenomeRNAii51043.
PROiO15156.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000160685.
CleanExiHS_ZBTB7B.
GenevisibleiO15156. HS.

Family and domain databases

Gene3Di3.30.160.60. 4 hits.
InterProiIPR000210. BTB/POZ_dom.
IPR011333. SKP1/BTB/POZ.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF00651. BTB. 1 hit.
[Graphical view]
SMARTiSM00225. BTB. 1 hit.
SM00355. ZnF_C2H2. 4 hits.
[Graphical view]
SUPFAMiSSF54695. SSF54695. 1 hit.
PROSITEiPS50097. BTB. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 3 hits.
PS50157. ZINC_FINGER_C2H2_2. 4 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiZBT7B_HUMAN
AccessioniPrimary (citable) accession number: O15156
Secondary accession number(s): B4E3K5
, D3DV83, J3KQQ3, Q68DR2, Q96EP2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 16, 2004
Last sequence update: August 16, 2004
Last modified: November 30, 2016
This is version 146 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.