Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

O15156 (ZBT7B_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 121. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Zinc finger and BTB domain-containing protein 7B
Alternative name(s):
Krueppel-related zinc finger protein cKrox
Short name=hcKrox
T-helper-inducing POZ/Krueppel-like factor
Zinc finger and BTB domain-containing protein 15
Zinc finger protein 67 homolog
Short name=Zfp-67
Zinc finger protein 857B
Zinc finger protein Th-POK
Gene names
Name:ZBTB7B
Synonyms:ZBTB15, ZFP67, ZNF857B
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length539 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Transcription regulator that acts as a key regulator of lineage commitment of immature T-cell precursors. Necessary and sufficient for commitment of CD4 lineage, while its absence causes CD8 commitment. Development of immature T-cell precursors (thymocytes) to either the CD4 helper or CD8 killer T-cell lineages correlates precisely with their T-cell receptor specificity for major histocompatibility complex class II or class I molecules, respectively. Transcriptional repressor of the collagen COL1A1 and COL1A2 genes. May also function as a repressor of fibronectin and possibly other extracellular matrix genes By similarity. Ref.1

Subcellular location

Nucleus.

Sequence similarities

Contains 1 BTB (POZ) domain.

Contains 4 C2H2-type zinc fingers.

Sequence caution

The sequence CAH18158.1 differs from that shown. Reason: Erroneous initiation.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: O15156-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: O15156-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLQPGPHPPSPQAAAPGEAWPGPSQAPWQSLEEKM
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 539539Zinc finger and BTB domain-containing protein 7B
PRO_0000047719

Regions

Domain34 – 11582BTB
Zinc finger346 – 36823C2H2-type 1
Zinc finger374 – 39623C2H2-type 2
Zinc finger402 – 42423C2H2-type 3
Zinc finger430 – 45425C2H2-type 4; atypical
Compositional bias181 – 19616Pro-rich

Amino acid modifications

Modified residue3691Phosphothreonine Ref.7

Natural variations

Alternative sequence11M → MLQPGPHPPSPQAAAPGEAW PGPSQAPWQSLEEKM in isoform 2.
VSP_044721

Experimental info

Sequence conflict901E → K in BAG65517. Ref.2
Sequence conflict2351E → G in BAG65517. Ref.2
Sequence conflict4371K → R in AAC51847. Ref.1
Sequence conflict4801S → F in AAC51847. Ref.1
Sequence conflict509 – 5102GP → WA in AAC51847. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified August 16, 2004. Version 2.
Checksum: 86B3616504B05B7E

FASTA53958,027
        10         20         30         40         50         60 
MGSPEDDLIG IPFPDHSSEL LSCLNEQRQL GHLCDLTIRT QGLEYRTHRA VLAACSHYFK 

        70         80         90        100        110        120 
KLFTEGGGGA VMGAGGSGTA TGGAGAGVCE LDFVGPEALG ALLEFAYTAT LTTSSANMPA 

       130        140        150        160        170        180 
VLQAARLLEI PCVIAACMEI LQGSGLEAPS PDEDDCERAR QYLEAFATAT ASGVPNGEDS 

       190        200        210        220        230        240 
PPQVPLPPPP PPPPRPVARR SRKPRKAFLQ TKGARANHLV PEVPTVPAHP LTYEEEEVAG 

       250        260        270        280        290        300 
RVGSSGGSGP GDSYSPPTGT ASPPEGPQSY EPYEGEEEEE ELVYPPAYGL AQGGGPPLSP 

       310        320        330        340        350        360 
EELGSDEDAI DPDLMAYLSS LHQDNLAPGL DSQDKLVRKR RSQMPQECPV CHKIIHGAGK 

       370        380        390        400        410        420 
LPRHMRTHTG EKPFACEVCG VRFTRNDKLK IHMRKHTGER PYSCPHCPAR FLHSYDLKNH 

       430        440        450        460        470        480 
MHLHTGDRPY ECHLCHKAFA KEDHLQRHLK GQNCLEVRTR RRRKDDAPPH YPPPSTAAAS 

       490        500        510        520        530 
PAGLDLSNGH LDTFRLSLAR FWEQSAPTGP PVSTPGPPDD DEEEGAPTTP QAEGAMESS 

« Hide

Isoform 2 [UniParc].

Checksum: F85D79769C9BE294
Show »

FASTA57361,584

References

« Hide 'large scale' references
[1]"Cloning and characterization of hcKrox, a transcriptional regulator of extracellular matrix gene expression."
Widom R.L., Culic I., Lee J.Y., Korn J.H.
Gene 198:407-420(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION.
Tissue: Skin fibroblast.
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Uterus.
[3]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Salivary gland.
[4]"The DNA sequence and biological annotation of human chromosome 1."
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. expand/collapse author list , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Uterus.
[7]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-369, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[8]"Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF007833 mRNA. Translation: AAC51847.1.
AK304762 mRNA. Translation: BAG65517.1.
CR749303 mRNA. Translation: CAH18158.1. Different initiation.
AL451085 Genomic DNA. Translation: CAI13266.1.
CH471121 Genomic DNA. Translation: EAW53149.1.
CH471121 Genomic DNA. Translation: EAW53150.1.
CH471121 Genomic DNA. Translation: EAW53151.1.
BC012070 mRNA. Translation: AAH12070.1.
CCDSCCDS1081.1. [O15156-1]
CCDS58030.1. [O15156-2]
RefSeqNP_001239335.1. NM_001252406.2. [O15156-2]
NP_001243384.1. NM_001256455.1. [O15156-1]
XP_006711416.1. XM_006711353.1. [O15156-1]
XP_006711417.1. XM_006711354.1. [O15156-1]
XP_006711418.1. XM_006711355.1. [O15156-1]
XP_006711419.1. XM_006711356.1. [O15156-1]
XP_006711420.1. XM_006711357.1. [O15156-1]
XP_006711421.1. XM_006711358.1. [O15156-1]
XP_006711422.1. XM_006711359.1. [O15156-1]
UniGeneHs.729279.
Hs.744441.

3D structure databases

ProteinModelPortalO15156.
SMRO15156. Positions 9-141, 317-448.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid119242. 20 interactions.
IntActO15156. 3 interactions.
MINTMINT-1451723.
STRING9606.ENSP00000292176.

PTM databases

PhosphoSiteO15156.

Proteomic databases

MaxQBO15156.
PaxDbO15156.
PRIDEO15156.

Protocols and materials databases

DNASU51043.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000292176; ENSP00000292176; ENSG00000160685. [O15156-1]
ENST00000368426; ENSP00000357411; ENSG00000160685. [O15156-1]
ENST00000417934; ENSP00000406286; ENSG00000160685. [O15156-2]
ENST00000535420; ENSP00000438647; ENSG00000160685. [O15156-1]
GeneID51043.
KEGGhsa:51043.
UCSCuc001fgk.4. human. [O15156-1]

Organism-specific databases

CTD51043.
GeneCardsGC01P154975.
HGNCHGNC:18668. ZBTB7B.
HPAHPA006811.
HPA025820.
MIM607646. gene.
neXtProtNX_O15156.
PharmGKBPA38630.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG5048.
HOGENOMHOG000082521.
HOVERGENHBG059461.
InParanoidO15156.
KOK10494.
OMAIGIPFPE.
OrthoDBEOG70CR6Z.
PhylomeDBO15156.
TreeFamTF331824.

Gene expression databases

BgeeO15156.
CleanExHS_ZBTB7B.
GenevestigatorO15156.

Family and domain databases

Gene3D3.30.160.60. 4 hits.
3.30.710.10. 1 hit.
InterProIPR000210. BTB/POZ-like.
IPR011333. BTB/POZ_fold.
IPR013069. BTB_POZ.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamPF00651. BTB. 1 hit.
[Graphical view]
SMARTSM00225. BTB. 1 hit.
SM00355. ZnF_C2H2. 4 hits.
[Graphical view]
SUPFAMSSF54695. SSF54695. 1 hit.
PROSITEPS50097. BTB. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 3 hits.
PS50157. ZINC_FINGER_C2H2_2. 4 hits.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSZBTB7B. human.
GeneWikiZBTB7B.
GenomeRNAi51043.
NextBio35535390.
PROO15156.
SOURCESearch...

Entry information

Entry nameZBT7B_HUMAN
AccessionPrimary (citable) accession number: O15156
Secondary accession number(s): B4E3K5 expand/collapse secondary AC list , D3DV83, J3KQQ3, Q68DR2, Q96EP2
Entry history
Integrated into UniProtKB/Swiss-Prot: August 16, 2004
Last sequence update: August 16, 2004
Last modified: July 9, 2014
This is version 121 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 1

Human chromosome 1: entries, gene names and cross-references to MIM