Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O15156

- ZBT7B_HUMAN

UniProt

O15156 - ZBT7B_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Zinc finger and BTB domain-containing protein 7B

Gene

ZBTB7B

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Transcription regulator that acts as a key regulator of lineage commitment of immature T-cell precursors. Necessary and sufficient for commitment of CD4 lineage, while its absence causes CD8 commitment. Development of immature T-cell precursors (thymocytes) to either the CD4 helper or CD8 killer T-cell lineages correlates precisely with their T-cell receptor specificity for major histocompatibility complex class II or class I molecules, respectively. Transcriptional repressor of the collagen COL1A1 and COL1A2 genes. May also function as a repressor of fibronectin and possibly other extracellular matrix genes (By similarity).By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri346 – 36823C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri374 – 39623C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri402 – 42423C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri430 – 45425C2H2-type 4; atypicalPROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  1. DNA binding Source: UniProtKB-KW
  2. metal ion binding Source: UniProtKB-KW

GO - Biological processi

  1. cell differentiation Source: UniProtKB-KW
  2. ectoderm development Source: ProtInc
  3. multicellular organismal development Source: UniProtKB-KW
  4. regulation of transcription, DNA-templated Source: UniProtKB-KW
  5. transcription from RNA polymerase II promoter Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein, Repressor

Keywords - Biological processi

Differentiation, Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger and BTB domain-containing protein 7B
Alternative name(s):
Krueppel-related zinc finger protein cKrox
Short name:
hcKrox
T-helper-inducing POZ/Krueppel-like factor
Zinc finger and BTB domain-containing protein 15
Zinc finger protein 67 homolog
Short name:
Zfp-67
Zinc finger protein 857B
Zinc finger protein Th-POK
Gene namesi
Name:ZBTB7B
Synonyms:ZBTB15, ZFP67, ZNF857B
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:18668. ZBTB7B.

Subcellular locationi

GO - Cellular componenti

  1. nucleus Source: HPA
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA38630.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 539539Zinc finger and BTB domain-containing protein 7BPRO_0000047719Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei369 – 3691Phosphothreonine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiO15156.
PaxDbiO15156.
PRIDEiO15156.

PTM databases

PhosphoSiteiO15156.

Expressioni

Gene expression databases

BgeeiO15156.
CleanExiHS_ZBTB7B.
GenevestigatoriO15156.

Organism-specific databases

HPAiHPA006811.
HPA025820.

Interactioni

Protein-protein interaction databases

BioGridi119242. 22 interactions.
IntActiO15156. 3 interactions.
MINTiMINT-1451723.
STRINGi9606.ENSP00000292176.

Structurei

3D structure databases

ProteinModelPortaliO15156.
SMRiO15156. Positions 9-141, 346-448.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini34 – 11582BTBPROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi181 – 19616Pro-richAdd
BLAST

Sequence similaritiesi

Contains 1 BTB (POZ) domain.PROSITE-ProRule annotation
Contains 4 C2H2-type zinc fingers.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri346 – 36823C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri374 – 39623C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri402 – 42423C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri430 – 45425C2H2-type 4; atypicalPROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiCOG5048.
GeneTreeiENSGT00770000120495.
HOGENOMiHOG000082521.
HOVERGENiHBG059461.
InParanoidiO15156.
KOiK10494.
OMAiIGIPFPE.
OrthoDBiEOG70CR6Z.
PhylomeDBiO15156.
TreeFamiTF331824.

Family and domain databases

Gene3Di3.30.160.60. 4 hits.
3.30.710.10. 1 hit.
InterProiIPR000210. BTB/POZ-like.
IPR011333. BTB/POZ_fold.
IPR013069. BTB_POZ.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF00651. BTB. 1 hit.
[Graphical view]
SMARTiSM00225. BTB. 1 hit.
SM00355. ZnF_C2H2. 4 hits.
[Graphical view]
SUPFAMiSSF54695. SSF54695. 1 hit.
PROSITEiPS50097. BTB. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 3 hits.
PS50157. ZINC_FINGER_C2H2_2. 4 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O15156-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGSPEDDLIG IPFPDHSSEL LSCLNEQRQL GHLCDLTIRT QGLEYRTHRA
60 70 80 90 100
VLAACSHYFK KLFTEGGGGA VMGAGGSGTA TGGAGAGVCE LDFVGPEALG
110 120 130 140 150
ALLEFAYTAT LTTSSANMPA VLQAARLLEI PCVIAACMEI LQGSGLEAPS
160 170 180 190 200
PDEDDCERAR QYLEAFATAT ASGVPNGEDS PPQVPLPPPP PPPPRPVARR
210 220 230 240 250
SRKPRKAFLQ TKGARANHLV PEVPTVPAHP LTYEEEEVAG RVGSSGGSGP
260 270 280 290 300
GDSYSPPTGT ASPPEGPQSY EPYEGEEEEE ELVYPPAYGL AQGGGPPLSP
310 320 330 340 350
EELGSDEDAI DPDLMAYLSS LHQDNLAPGL DSQDKLVRKR RSQMPQECPV
360 370 380 390 400
CHKIIHGAGK LPRHMRTHTG EKPFACEVCG VRFTRNDKLK IHMRKHTGER
410 420 430 440 450
PYSCPHCPAR FLHSYDLKNH MHLHTGDRPY ECHLCHKAFA KEDHLQRHLK
460 470 480 490 500
GQNCLEVRTR RRRKDDAPPH YPPPSTAAAS PAGLDLSNGH LDTFRLSLAR
510 520 530
FWEQSAPTGP PVSTPGPPDD DEEEGAPTTP QAEGAMESS
Length:539
Mass (Da):58,027
Last modified:August 16, 2004 - v2
Checksum:i86B3616504B05B7E
GO
Isoform 2 (identifier: O15156-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLQPGPHPPSPQAAAPGEAWPGPSQAPWQSLEEKM

Note: No experimental confirmation available.

Show »
Length:573
Mass (Da):61,584
Checksum:iF85D79769C9BE294
GO

Sequence cautioni

The sequence CAH18158.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti90 – 901E → K in BAG65517. (PubMed:14702039)Curated
Sequence conflicti235 – 2351E → G in BAG65517. (PubMed:14702039)Curated
Sequence conflicti437 – 4371K → R in AAC51847. (PubMed:9370309)Curated
Sequence conflicti480 – 4801S → F in AAC51847. (PubMed:9370309)Curated
Sequence conflicti509 – 5102GP → WA in AAC51847. (PubMed:9370309)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MLQPGPHPPSPQAAAPGEAW PGPSQAPWQSLEEKM in isoform 2. 1 PublicationVSP_044721

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF007833 mRNA. Translation: AAC51847.1.
AK304762 mRNA. Translation: BAG65517.1.
CR749303 mRNA. Translation: CAH18158.1. Different initiation.
AL451085 Genomic DNA. Translation: CAI13266.1.
CH471121 Genomic DNA. Translation: EAW53149.1.
CH471121 Genomic DNA. Translation: EAW53150.1.
CH471121 Genomic DNA. Translation: EAW53151.1.
BC012070 mRNA. Translation: AAH12070.1.
CCDSiCCDS1081.1. [O15156-1]
CCDS58030.1. [O15156-2]
RefSeqiNP_001239335.1. NM_001252406.2. [O15156-2]
NP_001243384.1. NM_001256455.1. [O15156-1]
XP_006711416.1. XM_006711353.1. [O15156-1]
XP_006711417.1. XM_006711354.1. [O15156-1]
XP_006711418.1. XM_006711355.1. [O15156-1]
XP_006711419.1. XM_006711356.1. [O15156-1]
XP_006711420.1. XM_006711357.1. [O15156-1]
XP_006711421.1. XM_006711358.1. [O15156-1]
XP_006711422.1. XM_006711359.1. [O15156-1]
UniGeneiHs.729279.
Hs.744441.

Genome annotation databases

EnsembliENST00000292176; ENSP00000292176; ENSG00000160685. [O15156-1]
ENST00000368426; ENSP00000357411; ENSG00000160685. [O15156-1]
ENST00000417934; ENSP00000406286; ENSG00000160685. [O15156-2]
ENST00000535420; ENSP00000438647; ENSG00000160685. [O15156-1]
GeneIDi51043.
KEGGihsa:51043.
UCSCiuc001fgk.4. human. [O15156-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF007833 mRNA. Translation: AAC51847.1 .
AK304762 mRNA. Translation: BAG65517.1 .
CR749303 mRNA. Translation: CAH18158.1 . Different initiation.
AL451085 Genomic DNA. Translation: CAI13266.1 .
CH471121 Genomic DNA. Translation: EAW53149.1 .
CH471121 Genomic DNA. Translation: EAW53150.1 .
CH471121 Genomic DNA. Translation: EAW53151.1 .
BC012070 mRNA. Translation: AAH12070.1 .
CCDSi CCDS1081.1. [O15156-1 ]
CCDS58030.1. [O15156-2 ]
RefSeqi NP_001239335.1. NM_001252406.2. [O15156-2 ]
NP_001243384.1. NM_001256455.1. [O15156-1 ]
XP_006711416.1. XM_006711353.1. [O15156-1 ]
XP_006711417.1. XM_006711354.1. [O15156-1 ]
XP_006711418.1. XM_006711355.1. [O15156-1 ]
XP_006711419.1. XM_006711356.1. [O15156-1 ]
XP_006711420.1. XM_006711357.1. [O15156-1 ]
XP_006711421.1. XM_006711358.1. [O15156-1 ]
XP_006711422.1. XM_006711359.1. [O15156-1 ]
UniGenei Hs.729279.
Hs.744441.

3D structure databases

ProteinModelPortali O15156.
SMRi O15156. Positions 9-141, 346-448.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 119242. 22 interactions.
IntActi O15156. 3 interactions.
MINTi MINT-1451723.
STRINGi 9606.ENSP00000292176.

PTM databases

PhosphoSitei O15156.

Proteomic databases

MaxQBi O15156.
PaxDbi O15156.
PRIDEi O15156.

Protocols and materials databases

DNASUi 51043.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000292176 ; ENSP00000292176 ; ENSG00000160685 . [O15156-1 ]
ENST00000368426 ; ENSP00000357411 ; ENSG00000160685 . [O15156-1 ]
ENST00000417934 ; ENSP00000406286 ; ENSG00000160685 . [O15156-2 ]
ENST00000535420 ; ENSP00000438647 ; ENSG00000160685 . [O15156-1 ]
GeneIDi 51043.
KEGGi hsa:51043.
UCSCi uc001fgk.4. human. [O15156-1 ]

Organism-specific databases

CTDi 51043.
GeneCardsi GC01P154975.
HGNCi HGNC:18668. ZBTB7B.
HPAi HPA006811.
HPA025820.
MIMi 607646. gene.
neXtProti NX_O15156.
PharmGKBi PA38630.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5048.
GeneTreei ENSGT00770000120495.
HOGENOMi HOG000082521.
HOVERGENi HBG059461.
InParanoidi O15156.
KOi K10494.
OMAi IGIPFPE.
OrthoDBi EOG70CR6Z.
PhylomeDBi O15156.
TreeFami TF331824.

Miscellaneous databases

ChiTaRSi ZBTB7B. human.
GeneWikii ZBTB7B.
GenomeRNAii 51043.
NextBioi 35535390.
PROi O15156.
SOURCEi Search...

Gene expression databases

Bgeei O15156.
CleanExi HS_ZBTB7B.
Genevestigatori O15156.

Family and domain databases

Gene3Di 3.30.160.60. 4 hits.
3.30.710.10. 1 hit.
InterProi IPR000210. BTB/POZ-like.
IPR011333. BTB/POZ_fold.
IPR013069. BTB_POZ.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view ]
Pfami PF00651. BTB. 1 hit.
[Graphical view ]
SMARTi SM00225. BTB. 1 hit.
SM00355. ZnF_C2H2. 4 hits.
[Graphical view ]
SUPFAMi SSF54695. SSF54695. 1 hit.
PROSITEi PS50097. BTB. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 3 hits.
PS50157. ZINC_FINGER_C2H2_2. 4 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and characterization of hcKrox, a transcriptional regulator of extracellular matrix gene expression."
    Widom R.L., Culic I., Lee J.Y., Korn J.H.
    Gene 198:407-420(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION.
    Tissue: Skin fibroblast.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Uterus.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Salivary gland.
  4. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Uterus.
  7. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-369, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.

Entry informationi

Entry nameiZBT7B_HUMAN
AccessioniPrimary (citable) accession number: O15156
Secondary accession number(s): B4E3K5
, D3DV83, J3KQQ3, Q68DR2, Q96EP2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 16, 2004
Last sequence update: August 16, 2004
Last modified: November 26, 2014
This is version 124 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3