Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O15155

- BET1_HUMAN

UniProt

O15155 - BET1_HUMAN

Protein

BET1 homolog

Gene

BET1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
  1. Functioni

    Required for vesicular transport from the ER to the Golgi complex. Functions as a SNARE involved in the docking process of ER-derived vesicles with the cis-Golgi membrane By similarity.By similarity

    GO - Molecular functioni

    1. protein binding Source: IntAct

    GO - Biological processi

    1. ER to Golgi vesicle-mediated transport Source: ProtInc
    2. protein transport Source: UniProtKB-KW
    3. vesicle fusion with Golgi apparatus Source: Ensembl

    Keywords - Biological processi

    ER-Golgi transport, Protein transport, Transport

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    BET1 homolog
    Short name:
    hBET1
    Alternative name(s):
    Golgi vesicular membrane-trafficking protein p18
    Gene namesi
    Name:BET1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 7

    Organism-specific databases

    HGNCiHGNC:14562. BET1.

    Subcellular locationi

    Endoplasmic reticulum membrane By similarity; Single-pass type IV membrane protein By similarity. Golgi apparatuscis-Golgi network membrane By similarity. Golgi apparatus membrane By similarity
    Note: Concentrated most in the intermediate compartment/cis-Golgi network and the cis-Golgi cisternae 1 and 2. Greatly reduced in concentration at the trans end of the Golgi apparatus By similarity.By similarity

    GO - Cellular componenti

    1. cis-Golgi network Source: Ensembl
    2. endoplasmic reticulum membrane Source: UniProtKB-SubCell
    3. Golgi cisterna Source: Ensembl
    4. Golgi membrane Source: ProtInc
    5. integral component of membrane Source: UniProtKB-KW
    6. membrane Source: UniProtKB

    Keywords - Cellular componenti

    Endoplasmic reticulum, Golgi apparatus, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA25338.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 118118BET1 homologPRO_0000206884Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei50 – 501Phosphoserine3 Publications

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiO15155.
    PaxDbiO15155.
    PRIDEiO15155.

    PTM databases

    PhosphoSiteiO15155.

    Expressioni

    Gene expression databases

    ArrayExpressiO15155.
    BgeeiO15155.
    CleanExiHS_BET1.
    GenevestigatoriO15155.

    Organism-specific databases

    HPAiHPA042778.

    Interactioni

    Subunit structurei

    Interacts with STX17.By similarity

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    USHBP1Q8N6Y02EBI-749204,EBI-739895

    Protein-protein interaction databases

    BioGridi115571. 6 interactions.
    IntActiO15155. 2 interactions.
    MINTiMINT-2998603.
    STRINGi9606.ENSP00000222547.

    Structurei

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    3EGXX-ray3.30D24-32[»]
    ProteinModelPortaliO15155.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiO15155.

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 9494CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini116 – 1183VesicularSequence Analysis

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei95 – 11521Helical; Anchor for type IV membrane proteinSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini26 – 8863t-SNARE coiled-coil homologyPROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Belongs to the BET1 family.Curated
    Contains 1 t-SNARE coiled-coil homology domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Coiled coil, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG292170.
    HOGENOMiHOG000290697.
    HOVERGENiHBG029661.
    KOiK08504.
    PhylomeDBiO15155.
    TreeFamiTF323307.

    Family and domain databases

    InterProiIPR000727. T_SNARE_dom.
    [Graphical view]
    PfamiPF05739. SNARE. 1 hit.
    [Graphical view]
    SMARTiSM00397. t_SNARE. 1 hit.
    [Graphical view]
    PROSITEiPS50192. T_SNARE. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O15155-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MRRAGLGEGV PPGNYGNYGY ANSGYSACEE ENERLTESLR SKVTAIKSLS    50
    IEIGHEVKTQ NKLLAEMDSQ FDSTTGFLGK TMGKLKILSR GSQTKLLCYM 100
    MLFSLFVFFI IYWIIKLR 118
    Length:118
    Mass (Da):13,289
    Last modified:January 1, 1998 - v1
    Checksum:iB83B76ACBB3DA57E
    GO
    Isoform 2 (identifier: O15155-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         80-118: KTMGKLKILSRGSQTKLLCYMMLFSLFVFFIIYWIIKLR → LCPM

    Note: No experimental confirmation available.

    Show »
    Length:83
    Mass (Da):9,020
    Checksum:i71D35D46B020CD54
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei80 – 11839KTMGK…IIKLR → LCPM in isoform 2. 1 PublicationVSP_056216Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF007551 mRNA. Translation: AAB62941.1.
    AC006378 Genomic DNA. Translation: AAD47132.1.
    CH471091 Genomic DNA. Translation: EAW76802.1.
    BC000899 mRNA. Translation: AAH00899.1.
    BC012595 mRNA. Translation: AAH12595.1.
    CCDSiCCDS5635.1.
    RefSeqiNP_005859.1. NM_005868.4.
    UniGeneiHs.489132.

    Genome annotation databases

    EnsembliENST00000222547; ENSP00000222547; ENSG00000105829.
    ENST00000433727; ENSP00000391228; ENSG00000105829.
    GeneIDi10282.
    KEGGihsa:10282.
    UCSCiuc003unf.1. human.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF007551 mRNA. Translation: AAB62941.1 .
    AC006378 Genomic DNA. Translation: AAD47132.1 .
    CH471091 Genomic DNA. Translation: EAW76802.1 .
    BC000899 mRNA. Translation: AAH00899.1 .
    BC012595 mRNA. Translation: AAH12595.1 .
    CCDSi CCDS5635.1.
    RefSeqi NP_005859.1. NM_005868.4.
    UniGenei Hs.489132.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    3EGX X-ray 3.30 D 24-32 [» ]
    ProteinModelPortali O15155.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 115571. 6 interactions.
    IntActi O15155. 2 interactions.
    MINTi MINT-2998603.
    STRINGi 9606.ENSP00000222547.

    PTM databases

    PhosphoSitei O15155.

    Proteomic databases

    MaxQBi O15155.
    PaxDbi O15155.
    PRIDEi O15155.

    Protocols and materials databases

    DNASUi 10282.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000222547 ; ENSP00000222547 ; ENSG00000105829 .
    ENST00000433727 ; ENSP00000391228 ; ENSG00000105829 .
    GeneIDi 10282.
    KEGGi hsa:10282.
    UCSCi uc003unf.1. human.

    Organism-specific databases

    CTDi 10282.
    GeneCardsi GC07M093592.
    HGNCi HGNC:14562. BET1.
    HPAi HPA042778.
    MIMi 605456. gene.
    neXtProti NX_O15155.
    PharmGKBi PA25338.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG292170.
    HOGENOMi HOG000290697.
    HOVERGENi HBG029661.
    KOi K08504.
    PhylomeDBi O15155.
    TreeFami TF323307.

    Miscellaneous databases

    EvolutionaryTracei O15155.
    GeneWikii BET1.
    GenomeRNAii 10282.
    NextBioi 38956.
    PROi O15155.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O15155.
    Bgeei O15155.
    CleanExi HS_BET1.
    Genevestigatori O15155.

    Family and domain databases

    InterProi IPR000727. T_SNARE_dom.
    [Graphical view ]
    Pfami PF05739. SNARE. 1 hit.
    [Graphical view ]
    SMARTi SM00397. t_SNARE. 1 hit.
    [Graphical view ]
    PROSITEi PS50192. T_SNARE. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The mammalian protein (rbet1) homologous to yeast Bet1p is primarily associated with the pre-Golgi intermediate compartment and is involved in vesicular transport from the endoplasmic reticulum to the Golgi apparatus."
      Zhang T., Wong S.H., Tang B.L., Xu Y., Peter F., Subramaniam V.N., Hong W.
      J. Cell Biol. 139:1157-1168(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "The DNA sequence of human chromosome 7."
      Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
      , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
      Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Brain and Placenta.
    5. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
      Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
      Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    6. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-50, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    7. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-50, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    8. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    9. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-50, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiBET1_HUMAN
    AccessioniPrimary (citable) accession number: O15155
    Secondary accession number(s): Q96EA0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 17, 2003
    Last sequence update: January 1, 1998
    Last modified: October 1, 2014
    This is version 113 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 7
      Human chromosome 7: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3