Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O15155

- BET1_HUMAN

UniProt

O15155 - BET1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

BET1 homolog

Gene

BET1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli

Functioni

Required for vesicular transport from the ER to the Golgi complex. Functions as a SNARE involved in the docking process of ER-derived vesicles with the cis-Golgi membrane (By similarity).By similarity

GO - Biological processi

  1. ER to Golgi vesicle-mediated transport Source: ProtInc
  2. protein transport Source: UniProtKB-KW
  3. vesicle fusion with Golgi apparatus Source: Ensembl
Complete GO annotation...

Keywords - Biological processi

ER-Golgi transport, Protein transport, Transport

Names & Taxonomyi

Protein namesi
Recommended name:
BET1 homolog
Short name:
hBET1
Alternative name(s):
Golgi vesicular membrane-trafficking protein p18
Gene namesi
Name:BET1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 7

Organism-specific databases

HGNCiHGNC:14562. BET1.

Subcellular locationi

Endoplasmic reticulum membrane By similarity; Single-pass type IV membrane protein By similarity. Golgi apparatuscis-Golgi network membrane By similarity. Golgi apparatus membrane By similarity
Note: Concentrated most in the intermediate compartment/cis-Golgi network and the cis-Golgi cisternae 1 and 2. Greatly reduced in concentration at the trans end of the Golgi apparatus (By similarity).By similarity

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 9494CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei95 – 11521Helical; Anchor for type IV membrane proteinSequence AnalysisAdd
BLAST
Topological domaini116 – 1183VesicularSequence Analysis

GO - Cellular componenti

  1. cis-Golgi network Source: Ensembl
  2. endoplasmic reticulum Source: UniProtKB-KW
  3. Golgi cisterna Source: Ensembl
  4. Golgi membrane Source: ProtInc
  5. integral component of membrane Source: UniProtKB-KW
  6. membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Golgi apparatus, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA25338.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 118118BET1 homologPRO_0000206884Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei50 – 501Phosphoserine3 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiO15155.
PaxDbiO15155.
PRIDEiO15155.

PTM databases

PhosphoSiteiO15155.

Expressioni

Gene expression databases

BgeeiO15155.
CleanExiHS_BET1.
ExpressionAtlasiO15155. baseline and differential.
GenevestigatoriO15155.

Organism-specific databases

HPAiHPA042778.

Interactioni

Subunit structurei

Interacts with STX17.By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
USHBP1Q8N6Y02EBI-749204,EBI-739895

Protein-protein interaction databases

BioGridi115571. 7 interactions.
IntActiO15155. 2 interactions.
MINTiMINT-2998603.
STRINGi9606.ENSP00000222547.

Structurei

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3EGXX-ray3.30D24-32[»]
ProteinModelPortaliO15155.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO15155.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini26 – 8863t-SNARE coiled-coil homologyPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Belongs to the BET1 family.Curated
Contains 1 t-SNARE coiled-coil homology domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG292170.
GeneTreeiENSGT00570000079186.
HOGENOMiHOG000290697.
HOVERGENiHBG029661.
InParanoidiO15155.
KOiK08504.
PhylomeDBiO15155.
TreeFamiTF323307.

Family and domain databases

InterProiIPR000727. T_SNARE_dom.
[Graphical view]
PfamiPF05739. SNARE. 1 hit.
[Graphical view]
SMARTiSM00397. t_SNARE. 1 hit.
[Graphical view]
PROSITEiPS50192. T_SNARE. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O15155-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRRAGLGEGV PPGNYGNYGY ANSGYSACEE ENERLTESLR SKVTAIKSLS
60 70 80 90 100
IEIGHEVKTQ NKLLAEMDSQ FDSTTGFLGK TMGKLKILSR GSQTKLLCYM
110
MLFSLFVFFI IYWIIKLR
Length:118
Mass (Da):13,289
Last modified:January 1, 1998 - v1
Checksum:iB83B76ACBB3DA57E
GO
Isoform 2 (identifier: O15155-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     80-118: KTMGKLKILSRGSQTKLLCYMMLFSLFVFFIIYWIIKLR → LCPM

Note: No experimental confirmation available.

Show »
Length:83
Mass (Da):9,020
Checksum:i71D35D46B020CD54
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei80 – 11839KTMGK…IIKLR → LCPM in isoform 2. 1 PublicationVSP_056216Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF007551 mRNA. Translation: AAB62941.1.
AC006378 Genomic DNA. Translation: AAD47132.1.
CH471091 Genomic DNA. Translation: EAW76802.1.
BC000899 mRNA. Translation: AAH00899.1.
BC012595 mRNA. Translation: AAH12595.1.
CCDSiCCDS5635.1. [O15155-1]
RefSeqiNP_005859.1. NM_005868.4. [O15155-1]
UniGeneiHs.489132.

Genome annotation databases

EnsembliENST00000222547; ENSP00000222547; ENSG00000105829. [O15155-1]
ENST00000433727; ENSP00000391228; ENSG00000105829. [O15155-2]
GeneIDi10282.
KEGGihsa:10282.
UCSCiuc003unf.1. human. [O15155-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF007551 mRNA. Translation: AAB62941.1 .
AC006378 Genomic DNA. Translation: AAD47132.1 .
CH471091 Genomic DNA. Translation: EAW76802.1 .
BC000899 mRNA. Translation: AAH00899.1 .
BC012595 mRNA. Translation: AAH12595.1 .
CCDSi CCDS5635.1. [O15155-1 ]
RefSeqi NP_005859.1. NM_005868.4. [O15155-1 ]
UniGenei Hs.489132.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
3EGX X-ray 3.30 D 24-32 [» ]
ProteinModelPortali O15155.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 115571. 7 interactions.
IntActi O15155. 2 interactions.
MINTi MINT-2998603.
STRINGi 9606.ENSP00000222547.

PTM databases

PhosphoSitei O15155.

Proteomic databases

MaxQBi O15155.
PaxDbi O15155.
PRIDEi O15155.

Protocols and materials databases

DNASUi 10282.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000222547 ; ENSP00000222547 ; ENSG00000105829 . [O15155-1 ]
ENST00000433727 ; ENSP00000391228 ; ENSG00000105829 . [O15155-2 ]
GeneIDi 10282.
KEGGi hsa:10282.
UCSCi uc003unf.1. human. [O15155-1 ]

Organism-specific databases

CTDi 10282.
GeneCardsi GC07M093592.
HGNCi HGNC:14562. BET1.
HPAi HPA042778.
MIMi 605456. gene.
neXtProti NX_O15155.
PharmGKBi PA25338.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG292170.
GeneTreei ENSGT00570000079186.
HOGENOMi HOG000290697.
HOVERGENi HBG029661.
InParanoidi O15155.
KOi K08504.
PhylomeDBi O15155.
TreeFami TF323307.

Miscellaneous databases

EvolutionaryTracei O15155.
GeneWikii BET1.
GenomeRNAii 10282.
NextBioi 38956.
PROi O15155.
SOURCEi Search...

Gene expression databases

Bgeei O15155.
CleanExi HS_BET1.
ExpressionAtlasi O15155. baseline and differential.
Genevestigatori O15155.

Family and domain databases

InterProi IPR000727. T_SNARE_dom.
[Graphical view ]
Pfami PF05739. SNARE. 1 hit.
[Graphical view ]
SMARTi SM00397. t_SNARE. 1 hit.
[Graphical view ]
PROSITEi PS50192. T_SNARE. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The mammalian protein (rbet1) homologous to yeast Bet1p is primarily associated with the pre-Golgi intermediate compartment and is involved in vesicular transport from the endoplasmic reticulum to the Golgi apparatus."
    Zhang T., Wong S.H., Tang B.L., Xu Y., Peter F., Subramaniam V.N., Hong W.
    J. Cell Biol. 139:1157-1168(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "The DNA sequence of human chromosome 7."
    Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
    , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
    Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Brain and Placenta.
  5. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  6. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-50, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  7. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-50, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  9. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-50, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiBET1_HUMAN
AccessioniPrimary (citable) accession number: O15155
Secondary accession number(s): Q96EA0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 17, 2003
Last sequence update: January 1, 1998
Last modified: November 26, 2014
This is version 115 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3