Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

BET1 homolog

Gene

BET1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Required for vesicular transport from the ER to the Golgi complex. Functions as a SNARE involved in the docking process of ER-derived vesicles with the cis-Golgi membrane (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processER-Golgi transport, Protein transport, Transport

Enzyme and pathway databases

ReactomeiR-HSA-204005. COPII (Coat Protein 2) Mediated Vesicle Transport.
R-HSA-6807878. COPI-mediated anterograde transport.

Names & Taxonomyi

Protein namesi
Recommended name:
BET1 homolog
Short name:
hBET1
Alternative name(s):
Golgi vesicular membrane-trafficking protein p18
Gene namesi
Name:BET1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

EuPathDBiHostDB:ENSG00000105829.11.
HGNCiHGNC:14562. BET1.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 94CytoplasmicSequence analysisAdd BLAST94
Transmembranei95 – 115Helical; Anchor for type IV membrane proteinSequence analysisAdd BLAST21
Topological domaini116 – 118VesicularSequence analysis3

Keywords - Cellular componenti

Endoplasmic reticulum, Golgi apparatus, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi10282.
OpenTargetsiENSG00000105829.
PharmGKBiPA25338.

Polymorphism and mutation databases

BioMutaiBET1.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002068841 – 118BET1 homologAdd BLAST118

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei50PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiO15155.
PaxDbiO15155.
PeptideAtlasiO15155.
PRIDEiO15155.
TopDownProteomicsiO15155-1. [O15155-1]

PTM databases

iPTMnetiO15155.
PhosphoSitePlusiO15155.
SwissPalmiO15155.

Expressioni

Gene expression databases

BgeeiENSG00000105829.
CleanExiHS_BET1.
ExpressionAtlasiO15155. baseline and differential.
GenevisibleiO15155. HS.

Interactioni

Subunit structurei

Interacts with STX17.By similarity

Binary interactionsi

Show more details

GO - Molecular functioni

Protein-protein interaction databases

BioGridi115571. 28 interactors.
IntActiO15155. 26 interactors.
MINTiMINT-2998603.
STRINGi9606.ENSP00000222547.

Structurei

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3EGXX-ray3.30D24-32[»]
ProteinModelPortaliO15155.
SMRiO15155.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO15155.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini26 – 88t-SNARE coiled-coil homologyPROSITE-ProRule annotationAdd BLAST63

Sequence similaritiesi

Belongs to the BET1 family.Curated

Keywords - Domaini

Coiled coil, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3385. Eukaryota.
ENOG4111W10. LUCA.
GeneTreeiENSGT00570000079186.
HOGENOMiHOG000290697.
HOVERGENiHBG029661.
InParanoidiO15155.
KOiK08504.
PhylomeDBiO15155.
TreeFamiTF323307.

Family and domain databases

InterProiView protein in InterPro
IPR000727. T_SNARE_dom.
SMARTiView protein in SMART
SM00397. t_SNARE. 1 hit.
PROSITEiView protein in PROSITE
PS50192. T_SNARE. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O15155-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRRAGLGEGV PPGNYGNYGY ANSGYSACEE ENERLTESLR SKVTAIKSLS
60 70 80 90 100
IEIGHEVKTQ NKLLAEMDSQ FDSTTGFLGK TMGKLKILSR GSQTKLLCYM
110
MLFSLFVFFI IYWIIKLR
Length:118
Mass (Da):13,289
Last modified:January 1, 1998 - v1
Checksum:iB83B76ACBB3DA57E
GO
Isoform 2 (identifier: O15155-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     80-118: KTMGKLKILSRGSQTKLLCYMMLFSLFVFFIIYWIIKLR → LCPM

Note: No experimental confirmation available.
Show »
Length:83
Mass (Da):9,020
Checksum:i71D35D46B020CD54
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_05621680 – 118KTMGK…IIKLR → LCPM in isoform 2. 1 PublicationAdd BLAST39

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF007551 mRNA. Translation: AAB62941.1.
AC006378 Genomic DNA. Translation: AAD47132.1.
CH471091 Genomic DNA. Translation: EAW76802.1.
BC000899 mRNA. Translation: AAH00899.1.
BC012595 mRNA. Translation: AAH12595.1.
CCDSiCCDS5635.1. [O15155-1]
CCDS83203.1. [O15155-2]
RefSeqiNP_001304668.1. NM_001317739.1. [O15155-2]
NP_005859.1. NM_005868.5. [O15155-1]
UniGeneiHs.489132.

Genome annotation databases

EnsembliENST00000222547; ENSP00000222547; ENSG00000105829. [O15155-1]
ENST00000433727; ENSP00000391228; ENSG00000105829. [O15155-2]
GeneIDi10282.
KEGGihsa:10282.
UCSCiuc064fkr.1. human. [O15155-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiBET1_HUMAN
AccessioniPrimary (citable) accession number: O15155
Secondary accession number(s): Q96EA0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 17, 2003
Last sequence update: January 1, 1998
Last modified: September 27, 2017
This is version 141 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families