Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O15130

- NPFF_HUMAN

UniProt

O15130 - NPFF_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Pro-FMRFamide-related neuropeptide FF

Gene

NPFF

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli

Functioni

Morphine modulating peptides. Have wide-ranging physiologic effects, including the modulation of morphine-induced analgesia, elevation of arterial blood pressure, and increased somatostatin secretion from the pancreas. Neuropeptide FF potentiates and sensitizes ASIC1 and ASIC3 channels.1 Publication

GO - Molecular functioni

  1. receptor binding Source: ProtInc

GO - Biological processi

  1. acute inflammatory response to antigenic stimulus Source: Ensembl
  2. maternal process involved in female pregnancy Source: Ensembl
  3. negative regulation of appetite Source: Ensembl
  4. negative regulation of heart rate Source: Ensembl
  5. negative regulation of insulin secretion Source: Ensembl
  6. neuropeptide signaling pathway Source: ProtInc
  7. positive regulation of blood pressure Source: Ensembl
  8. positive regulation of cytosolic calcium ion concentration Source: Ensembl
  9. regulation of excitatory postsynaptic membrane potential Source: Ensembl
  10. regulation of membrane depolarization Source: Ensembl
  11. regulation of sensory perception of pain Source: Ensembl
  12. response to drug Source: Ensembl
  13. response to morphine Source: Ensembl
  14. somatostatin secretion Source: Ensembl
  15. spinal cord development Source: Ensembl
  16. synaptic transmission Source: ProtInc
  17. vasopressin secretion Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Neuropeptide

Enzyme and pathway databases

ReactomeiREACT_16973. Orexin and neuropeptides FF and QRFP bind to their respective receptors.
REACT_18283. G alpha (q) signalling events.

Names & Taxonomyi

Protein namesi
Recommended name:
Pro-FMRFamide-related neuropeptide FF
Alternative name(s):
FMRFamide-related peptides
Cleaved into the following 3 chains:
Neuropeptide SF
Short name:
NPSF
Neuropeptide FF
Short name:
NPFF
Neuropeptide AF
Short name:
NPAF
Gene namesi
Name:NPFF
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 12

Organism-specific databases

HGNCiHGNC:7901. NPFF.

Subcellular locationi

GO - Cellular componenti

  1. axon terminus Source: Ensembl
  2. dendrite Source: Ensembl
  3. extracellular region Source: Reactome
  4. extracellular space Source: Ensembl
  5. perikaryon Source: Ensembl
  6. vesicle Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA31704.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2020Sequence AnalysisAdd
BLAST
Propeptidei21 – 6545PRO_0000009898Add
BLAST
Peptidei66 – 7611Neuropeptide SFPRO_0000009899Add
BLAST
Peptidei69 – 768Neuropeptide FFPRO_0000009900
Propeptidei79 – 9214PRO_0000009901Add
BLAST
Peptidei93 – 11018Neuropeptide AFPRO_0000009902Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei76 – 761Phenylalanine amideBy similarity
Modified residuei110 – 1101Phenylalanine amideBy similarity

Keywords - PTMi

Amidation, Cleavage on pair of basic residues

Proteomic databases

PaxDbiO15130.
PRIDEiO15130.

Expressioni

Gene expression databases

BgeeiO15130.
CleanExiHS_NPFF.
GenevestigatoriO15130.

Interactioni

Protein-protein interaction databases

IntActiO15130. 1 interaction.
STRINGi9606.ENSP00000267017.

Structurei

3D structure databases

ProteinModelPortaliO15130.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiNOG44970.
GeneTreeiENSGT00390000015021.
HOGENOMiHOG000113843.
HOVERGENiHBG006519.
InParanoidiO15130.
KOiK05247.
OMAiDSHERWG.
OrthoDBiEOG75B87K.
PhylomeDBiO15130.
TreeFamiTF330924.

Family and domain databases

InterProiIPR008065. FMRFamid-related_peptide.
[Graphical view]
PANTHERiPTHR15044. PTHR15044. 1 hit.
PfamiPF15085. NPFF. 1 hit.
[Graphical view]
PIRSFiPIRSF038092. FMRFamid-rel_pep_precur. 1 hit.
PRINTSiPR01682. FMRFAMIDEPEP.

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O15130-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDSRQAAALL VLLLLIDGGC AEGPGGQQED QLSAEEDSEP LPPQDAQTSG
60 70 80 90 100
SLLHYLLQAM ERPGRSQAFL FQPQRFGRNT QGSWRNEWLS PRAGEGLNSQ
110
FWSLAAPQRF GKK
Length:113
Mass (Da):12,440
Last modified:January 1, 1998 - v1
Checksum:i1E9D4ED2A69238E3
GO
Isoform 2 (identifier: O15130-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MDSRQAAALLVLLLLIDGGCAEGPGGQQEDQLSA → MVPQPPTTCPWKPVPSPCDLRVQGICPSSFPDTPLAQ

Note: No experimental confirmation available.

Show »
Length:116
Mass (Da):12,991
Checksum:i0E1EB094309C3105
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti88 – 881W → R.
Corresponds to variant rs35822762 [ dbSNP | Ensembl ].
VAR_049183

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3434MDSRQ…DQLSA → MVPQPPTTCPWKPVPSPCDL RVQGICPSSFPDTPLAQ in isoform 2. 1 PublicationVSP_056475Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF005271 mRNA. Translation: AAB64288.1.
AC023509 Genomic DNA. No translation available.
CH471054 Genomic DNA. Translation: EAW96721.1.
BC104234 mRNA. Translation: AAI04235.1.
BC104235 mRNA. Translation: AAI04236.1.
CCDSiCCDS8862.1. [O15130-1]
RefSeqiNP_003708.1. NM_003717.2. [O15130-1]
XP_005269263.1. XM_005269206.2. [O15130-2]
UniGeneiHs.733076.

Genome annotation databases

EnsembliENST00000267017; ENSP00000267017; ENSG00000139574. [O15130-1]
GeneIDi8620.
KEGGihsa:8620.
UCSCiuc001sdw.1. human. [O15130-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF005271 mRNA. Translation: AAB64288.1 .
AC023509 Genomic DNA. No translation available.
CH471054 Genomic DNA. Translation: EAW96721.1 .
BC104234 mRNA. Translation: AAI04235.1 .
BC104235 mRNA. Translation: AAI04236.1 .
CCDSi CCDS8862.1. [O15130-1 ]
RefSeqi NP_003708.1. NM_003717.2. [O15130-1 ]
XP_005269263.1. XM_005269206.2. [O15130-2 ]
UniGenei Hs.733076.

3D structure databases

ProteinModelPortali O15130.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

IntActi O15130. 1 interaction.
STRINGi 9606.ENSP00000267017.

Proteomic databases

PaxDbi O15130.
PRIDEi O15130.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000267017 ; ENSP00000267017 ; ENSG00000139574 . [O15130-1 ]
GeneIDi 8620.
KEGGi hsa:8620.
UCSCi uc001sdw.1. human. [O15130-1 ]

Organism-specific databases

CTDi 8620.
GeneCardsi GC12M053896.
HGNCi HGNC:7901. NPFF.
MIMi 604643. gene.
neXtProti NX_O15130.
PharmGKBi PA31704.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG44970.
GeneTreei ENSGT00390000015021.
HOGENOMi HOG000113843.
HOVERGENi HBG006519.
InParanoidi O15130.
KOi K05247.
OMAi DSHERWG.
OrthoDBi EOG75B87K.
PhylomeDBi O15130.
TreeFami TF330924.

Enzyme and pathway databases

Reactomei REACT_16973. Orexin and neuropeptides FF and QRFP bind to their respective receptors.
REACT_18283. G alpha (q) signalling events.

Miscellaneous databases

GeneWikii NPFF.
GenomeRNAii 8620.
NextBioi 32299.
PROi O15130.
SOURCEi Search...

Gene expression databases

Bgeei O15130.
CleanExi HS_NPFF.
Genevestigatori O15130.

Family and domain databases

InterProi IPR008065. FMRFamid-related_peptide.
[Graphical view ]
PANTHERi PTHR15044. PTHR15044. 1 hit.
Pfami PF15085. NPFF. 1 hit.
[Graphical view ]
PIRSFi PIRSF038092. FMRFamid-rel_pep_precur. 1 hit.
PRINTSi PR01682. FMRFAMIDEPEP.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "A human gene encoding morphine modulating peptides related to NPFF and FMRFamide."
    Perry S.J., Yi-Kung Huang E., Cronk D., Bagust J., Sharma R., Walker R.J., Wilson S., Burke J.F.
    FEBS Lett. 409:426-430(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Testis.
  2. "The finished DNA sequence of human chromosome 12."
    Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
    , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
    Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  5. "Selective modulation of heteromeric ASIC proton-gated channels by neuropeptide FF."
    Catarsi S., Babinski K., Seguela P.
    Neuropharmacology 41:592-600(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.

Entry informationi

Entry nameiNPFF_HUMAN
AccessioniPrimary (citable) accession number: O15130
Secondary accession number(s): Q3SXL4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: January 1, 1998
Last modified: November 26, 2014
This is version 108 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3