Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

FYN-binding protein

Gene

FYB

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Acts as an adapter protein of the FYN and LCP2 signaling cascades in T-cells. Modulates the expression of interleukin-2 (IL-2). Involved in platelet activation. Prevents the degradation of SKAP1 and SKAP2. May play a role in linking T-cell signaling to remodeling of the actin cytoskeleton.3 Publications

GO - Molecular functioni

  • receptor binding Source: UniProtKB

GO - Biological processi

  • immune response Source: ProtInc
  • intracellular signal transduction Source: ProtInc
  • NLS-bearing protein import into nucleus Source: ProtInc
  • protein localization to plasma membrane Source: Ensembl
  • protein phosphorylation Source: ProtInc
  • signal transduction Source: ProtInc
  • T cell receptor signaling pathway Source: Reactome
Complete GO annotation...

Enzyme and pathway databases

BioCyciZFISH:ENSG00000082074-MONOMER.
ReactomeiR-HSA-202433. Generation of second messenger molecules.
R-HSA-391160. Signal regulatory protein (SIRP) family interactions.
SignaLinkiO15117.
SIGNORiO15117.

Names & Taxonomyi

Protein namesi
Recommended name:
FYN-binding protein
Alternative name(s):
Adhesion and degranulation promoting adaptor protein
Short name:
ADAP
FYB-120/130
Short name:
p120/p130
FYN-T-binding protein
SLAP-130
SLP-76-associated phosphoprotein
Gene namesi
Name:FYB
Synonyms:SLAP130
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

HGNCiHGNC:4036. FYB.

Subcellular locationi

GO - Cellular componenti

  • actin cytoskeleton Source: UniProtKB
  • cell junction Source: UniProtKB-SubCell
  • cytosol Source: Reactome
  • nucleus Source: ProtInc
  • plasma membrane Source: GO_Central
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi2533.
OpenTargetsiENSG00000082074.
PharmGKBiPA28452.

Polymorphism and mutation databases

BioMutaiFYB.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000873961 – 783FYN-binding proteinAdd BLAST783

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei3N6-acetyllysineCombined sources1
Modified residuei28PhosphoserineBy similarity1
Modified residuei46PhosphoserineCombined sources1
Modified residuei225PhosphoserineCombined sources1
Modified residuei329PhosphoserineCombined sources1
Modified residuei457PhosphoserineCombined sources1
Modified residuei571PhosphotyrosineCombined sources1
Modified residuei573PhosphoserineCombined sources1
Modified residuei580PhosphoserineBy similarity1
Modified residuei651PhosphotyrosineCombined sources1

Post-translational modificationi

T-cell receptor ligation leads to increased tyrosine phosphorylation.

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiO15117.
PeptideAtlasiO15117.
PRIDEiO15117.

2D gel databases

OGPiO15117.

PTM databases

iPTMnetiO15117.
PhosphoSitePlusiO15117.

Miscellaneous databases

PMAP-CutDBO15117.

Expressioni

Tissue specificityi

Expressed in hematopoietic tissues such as myeloid and T-cells, spleen and thymus. Not expressed in B-cells, nor in non-lymphoid tissues.

Gene expression databases

BgeeiENSG00000082074.
CleanExiHS_FYB.
ExpressionAtlasiO15117. baseline and differential.
GenevisibleiO15117. HS.

Organism-specific databases

HPAiCAB025336.
HPA026796.

Interactioni

Subunit structurei

Part of a complex consisting of SKAP2, FYB and PTPNS1. Part of a complex consisting of SKAP2, FYB and LILRB3 (By similarity). Interacts with FYN, LCP2, SKAP1 and SKAP2. Interacts with FASLG. Interacts with EVL. Interacts with TMEM47 (By similarity).By similarity10 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
FYNP062414EBI-1753267,EBI-515315
LCP2Q130947EBI-1753267,EBI-346946
NCK1P163333EBI-1753267,EBI-389883
NCK2O436393EBI-1753267,EBI-713635
SKAP1Q86WV16EBI-1753267,EBI-2477305

GO - Molecular functioni

  • receptor binding Source: UniProtKB

Protein-protein interaction databases

BioGridi108809. 13 interactors.
DIPiDIP-42204N.
IntActiO15117. 26 interactors.
MINTiMINT-1176058.

Structurei

Secondary structure

1783
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi498 – 504Combined sources7
Beta strandi514 – 520Combined sources7
Beta strandi526 – 528Combined sources3
Beta strandi537 – 541Combined sources5
Beta strandi546 – 548Combined sources3
Beta strandi551 – 553Combined sources3
Beta strandi559 – 562Combined sources4
Helixi564 – 566Combined sources3
Beta strandi567 – 569Combined sources3
Helixi572 – 575Combined sources4
Helixi690 – 698Combined sources9
Beta strandi736 – 750Combined sources15
Turni751 – 753Combined sources3
Beta strandi754 – 759Combined sources6
Helixi760 – 762Combined sources3

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1RI9NMR-A683-771[»]
2GTJNMR-A486-579[»]
2GTONMR-A486-579[»]
ProteinModelPortaliO15117.
SMRiO15117.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO15117.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini514 – 570SH3Add BLAST57

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni348 – 448Interaction with SKAP1Add BLAST101

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili456 – 507Sequence analysisAdd BLAST52

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi462 – 465SH2-bindingSequence analysis4
Motifi469 – 505Nuclear localization signalSequence analysisAdd BLAST37
Motifi595 – 598SH2-binding; to LCP24
Motifi625 – 628SH2-binding; to FYN4
Motifi674 – 700Nuclear localization signalSequence analysisAdd BLAST27

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi355 – 360Poly-Pro6
Compositional biasi393 – 397Poly-Pro5
Compositional biasi617 – 620Poly-Pro4

Sequence similaritiesi

Contains 1 SH3 domain.Curated

Keywords - Domaini

Coiled coil, SH3 domain

Phylogenomic databases

GeneTreeiENSGT00530000063460.
HOGENOMiHOG000008686.
HOVERGENiHBG005774.
InParanoidiO15117.
KOiK17698.
OMAiSWGILKM.
OrthoDBiEOG091G04X1.
PhylomeDBiO15117.
TreeFamiTF337003.

Family and domain databases

InterProiIPR030635. FYB.
IPR029294. hSH3.
IPR011511. SH3_2.
IPR001452. SH3_domain.
[Graphical view]
PANTHERiPTHR16830:SF13. PTHR16830:SF13. 1 hit.
PfamiPF14603. hSH3. 1 hit.
PF07653. SH3_2. 1 hit.
[Graphical view]
SMARTiSM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 2 hits.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform FYB-120 (identifier: O15117-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAKYNTGGNP TEDVSVNSRP FRVTGPNSSS GIQARKNLFN NQGNASPPAG
60 70 80 90 100
PSNVPKFGSP KPPVAVKPSS EEKPDKEPKP PFLKPTGAGQ RFGTPASLTT
110 120 130 140 150
RDPEAKVGFL KPVGPKPINL PKEDSKPTFP WPPGNKPSLH SVNQDHDLKP
160 170 180 190 200
LGPKSGPTPP TSENEQKQAF PKLTGVKGKF MSASQDLEPK PLFPKPAFGQ
210 220 230 240 250
KPPLSTENSH EDESPMKNVS SSKGSPAPLG VRSKSGPLKP AREDSENKDH
260 270 280 290 300
AGEISSLPFP GVVLKPAASR GGPGLSKNGE EKKEDRKIDA AKNTFQSKIN
310 320 330 340 350
QEELASGTPP ARFPKAPSKL TVGGPWGQSQ EKEKGDKNSA TPKQKPLPPL
360 370 380 390 400
FTLGPPPPKP NRPPNVDLTK FHKTSSGNST SKGQTSYSTT SLPPPPPSHP
410 420 430 440 450
ASQPPLPASH PSQPPVPSLP PRNIKPPFDL KSPVNEDNQD GVTHSDGAGN
460 470 480 490 500
LDEEQDSEGE TYEDIEASKE REKKREKEEK KRLELEKKEQ KEKEKKEQEI
510 520 530 540 550
KKKFKLTGPI QVIHLAKACC DVKGGKNELS FKQGEQIEII RITDNPEGKW
560 570 580 590 600
LGRTARGSYG YIKTTAVEID YDSLKLKKDS LGAPSRPIED DQEVYDDVAE
610 620 630 640 650
QDDISSHSQS GSGGIFPPPP DDDIYDGIEE EDADDGFPAP PKQLDMGDEV
660 670 680 690 700
YDDVDTSDFP VSSAEMSQGT NVGKAKTEEK DLKKLKKQEK EEKDFRKKFK
710 720 730 740 750
YDGEIRVLYS TKVTTSITSK KWGTRDLQVK PGESLEVIQT TDDTKVLCRN
760 770 780
EEGKYGYVLR SYLADNDGEI YDDIADGCIY DND
Length:783
Mass (Da):85,387
Last modified:November 24, 2009 - v2
Checksum:i4EE28EF12AA0E457
GO
Isoform FYB-130 (identifier: O15117-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     636-636: G → GSTLQVQEKSNTWSWGILKMLKGKDDRKKSIREKPKVSDSDNNEGSS

Show »
Length:829
Mass (Da):90,606
Checksum:iBDDEE1977674BC65
GO
Isoform 3 (identifier: O15117-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MDGKADVKSLM
     636-636: G → GSTLQVQEKSNTWSWGILKMLKGKDDRKKSIREKPKVSDSDNNEGSS

Note: No experimental confirmation available.
Show »
Length:839
Mass (Da):91,651
Checksum:i3EB9A0C1FF816B6B
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti27N → S in BAF83092 (PubMed:14702039).Curated1
Sequence conflicti273P → L in AAC51300 (PubMed:9115214).Curated1
Sequence conflicti275L → V in AAB62226 (PubMed:9207119).Curated1
Sequence conflicti541R → C in BAF83092 (PubMed:14702039).Curated1
Sequence conflicti674K → E in BAF83092 (PubMed:14702039).Curated1
Sequence conflicti729V → A in BAF83092 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05688051P → L.Corresponds to variant rs1642515dbSNPEnsembl.1
Natural variantiVAR_056881332K → R.Corresponds to variant rs3749741dbSNPEnsembl.1
Natural variantiVAR_060592672V → F.Combined sources5 PublicationsCorresponds to variant rs379707dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0472881M → MDGKADVKSLM in isoform 3. 1 Publication1
Alternative sequenceiVSP_042309636G → GSTLQVQEKSNTWSWGILKM LKGKDDRKKSIREKPKVSDS DNNEGSS in isoform FYB-130 and isoform 3. 3 Publications1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF001862 mRNA. Translation: AAB62226.1.
U93049 mRNA. Translation: AAC51300.1.
AF198052 mRNA. Translation: AAF62400.1.
AK290403 mRNA. Translation: BAF83092.1.
AK297077 mRNA. Translation: BAG59594.1.
AC008964 Genomic DNA. No translation available.
AC010633 Genomic DNA. No translation available.
AC025471 Genomic DNA. No translation available.
CH471119 Genomic DNA. Translation: EAW55984.1.
BC117449 mRNA. Translation: AAI17450.1.
BC143645 mRNA. Translation: AAI43646.1.
CCDSiCCDS47200.1. [O15117-1]
CCDS54848.1. [O15117-2]
CCDS58945.1. [O15117-3]
RefSeqiNP_001230022.1. NM_001243093.1. [O15117-3]
NP_001456.3. NM_001465.4. [O15117-2]
NP_955367.1. NM_199335.3. [O15117-1]
XP_006714527.1. XM_006714464.2. [O15117-2]
XP_006714528.1. XM_006714465.2. [O15117-2]
XP_006714529.1. XM_006714466.2. [O15117-2]
XP_011512310.1. XM_011514008.2. [O15117-3]
XP_011512311.1. XM_011514009.1. [O15117-2]
XP_011512312.1. XM_011514010.1. [O15117-2]
UniGeneiHs.370503.
Hs.691768.

Genome annotation databases

EnsembliENST00000351578; ENSP00000316460; ENSG00000082074. [O15117-1]
ENST00000505428; ENSP00000427114; ENSG00000082074. [O15117-2]
ENST00000512982; ENSP00000425845; ENSG00000082074. [O15117-3]
ENST00000515010; ENSP00000426346; ENSG00000082074. [O15117-1]
GeneIDi2533.
KEGGihsa:2533.
UCSCiuc003jls.4. human. [O15117-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF001862 mRNA. Translation: AAB62226.1.
U93049 mRNA. Translation: AAC51300.1.
AF198052 mRNA. Translation: AAF62400.1.
AK290403 mRNA. Translation: BAF83092.1.
AK297077 mRNA. Translation: BAG59594.1.
AC008964 Genomic DNA. No translation available.
AC010633 Genomic DNA. No translation available.
AC025471 Genomic DNA. No translation available.
CH471119 Genomic DNA. Translation: EAW55984.1.
BC117449 mRNA. Translation: AAI17450.1.
BC143645 mRNA. Translation: AAI43646.1.
CCDSiCCDS47200.1. [O15117-1]
CCDS54848.1. [O15117-2]
CCDS58945.1. [O15117-3]
RefSeqiNP_001230022.1. NM_001243093.1. [O15117-3]
NP_001456.3. NM_001465.4. [O15117-2]
NP_955367.1. NM_199335.3. [O15117-1]
XP_006714527.1. XM_006714464.2. [O15117-2]
XP_006714528.1. XM_006714465.2. [O15117-2]
XP_006714529.1. XM_006714466.2. [O15117-2]
XP_011512310.1. XM_011514008.2. [O15117-3]
XP_011512311.1. XM_011514009.1. [O15117-2]
XP_011512312.1. XM_011514010.1. [O15117-2]
UniGeneiHs.370503.
Hs.691768.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1RI9NMR-A683-771[»]
2GTJNMR-A486-579[»]
2GTONMR-A486-579[»]
ProteinModelPortaliO15117.
SMRiO15117.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi108809. 13 interactors.
DIPiDIP-42204N.
IntActiO15117. 26 interactors.
MINTiMINT-1176058.

PTM databases

iPTMnetiO15117.
PhosphoSitePlusiO15117.

Polymorphism and mutation databases

BioMutaiFYB.

2D gel databases

OGPiO15117.

Proteomic databases

MaxQBiO15117.
PeptideAtlasiO15117.
PRIDEiO15117.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000351578; ENSP00000316460; ENSG00000082074. [O15117-1]
ENST00000505428; ENSP00000427114; ENSG00000082074. [O15117-2]
ENST00000512982; ENSP00000425845; ENSG00000082074. [O15117-3]
ENST00000515010; ENSP00000426346; ENSG00000082074. [O15117-1]
GeneIDi2533.
KEGGihsa:2533.
UCSCiuc003jls.4. human. [O15117-1]

Organism-specific databases

CTDi2533.
DisGeNETi2533.
GeneCardsiFYB.
H-InvDBHIX0024785.
HGNCiHGNC:4036. FYB.
HPAiCAB025336.
HPA026796.
MIMi602731. gene.
neXtProtiNX_O15117.
OpenTargetsiENSG00000082074.
PharmGKBiPA28452.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00530000063460.
HOGENOMiHOG000008686.
HOVERGENiHBG005774.
InParanoidiO15117.
KOiK17698.
OMAiSWGILKM.
OrthoDBiEOG091G04X1.
PhylomeDBiO15117.
TreeFamiTF337003.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000082074-MONOMER.
ReactomeiR-HSA-202433. Generation of second messenger molecules.
R-HSA-391160. Signal regulatory protein (SIRP) family interactions.
SignaLinkiO15117.
SIGNORiO15117.

Miscellaneous databases

ChiTaRSiFYB. human.
EvolutionaryTraceiO15117.
GeneWikiiFYB.
GenomeRNAii2533.
PMAP-CutDBO15117.
PROiO15117.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000082074.
CleanExiHS_FYB.
ExpressionAtlasiO15117. baseline and differential.
GenevisibleiO15117. HS.

Family and domain databases

InterProiIPR030635. FYB.
IPR029294. hSH3.
IPR011511. SH3_2.
IPR001452. SH3_domain.
[Graphical view]
PANTHERiPTHR16830:SF13. PTHR16830:SF13. 1 hit.
PfamiPF14603. hSH3. 1 hit.
PF07653. SH3_2. 1 hit.
[Graphical view]
SMARTiSM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 2 hits.
ProtoNetiSearch...

Entry informationi

Entry nameiFYB_HUMAN
AccessioniPrimary (citable) accession number: O15117
Secondary accession number(s): A8K2Y8
, B4DLN2, E9PBV9, O00359, Q9NZI9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: November 24, 2009
Last modified: November 2, 2016
This is version 161 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.