Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Rho guanine nucleotide exchange factor 11

Gene

ARHGEF11

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May play a role in the regulation of RhoA GTPase by guanine nucleotide-binding alpha-12 (GNA12) and alpha-13 (GNA13). Acts as guanine nucleotide exchange factor (GEF) for RhoA GTPase and may act as GTPase-activating protein (GAP) for GNA12 and GNA13. Involved in neurotrophin-induced neurite outgrowth.1 Publication

GO - Molecular functioni

  • G-protein coupled receptor binding Source: MGI
  • GTPase activator activity Source: UniProtKB-KW
  • guanyl-nucleotide exchange factor activity Source: Reactome
  • Rho guanyl-nucleotide exchange factor activity Source: UniProtKB

GO - Biological processi

  • actin cytoskeleton organization Source: UniProtKB
  • cytokinesis Source: UniProtKB
  • establishment of cell polarity Source: UniProtKB
  • G-protein coupled receptor signaling pathway Source: UniProtKB
  • movement of cell or subcellular component Source: UniProtKB
  • positive regulation of apoptotic process Source: Reactome
  • positive regulation of transcription, DNA-templated Source: UniProtKB
  • regulation of cell growth Source: UniProtKB
  • regulation of Rho protein signal transduction Source: InterPro
  • regulation of small GTPase mediated signal transduction Source: Reactome
  • Rho protein signal transduction Source: UniProtKB
  • striated muscle contraction Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

GTPase activation, Guanine-nucleotide releasing factor

Enzyme and pathway databases

BioCyciZFISH:ENSG00000132694-MONOMER.
ReactomeiR-HSA-193648. NRAGE signals death through JNK.
R-HSA-194840. Rho GTPase cycle.
R-HSA-416482. G alpha (12/13) signalling events.
R-HSA-416572. Sema4D induced cell migration and growth-cone collapse.

Names & Taxonomyi

Protein namesi
Recommended name:
Rho guanine nucleotide exchange factor 11
Alternative name(s):
PDZ-RhoGEF
Gene namesi
Name:ARHGEF11
Synonyms:KIAA0380
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:14580. ARHGEF11.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: MGI
  • cytosol Source: Reactome
  • intracellular Source: UniProtKB
  • membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi9826.
OpenTargetsiENSG00000132694.
PharmGKBiPA24968.

Polymorphism and mutation databases

BioMutaiARHGEF11.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000809281 – 1522Rho guanine nucleotide exchange factor 11Add BLAST1522

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2PhosphoserineCombined sources1
Modified residuei14PhosphoserineBy similarity1
Modified residuei16PhosphoserineCombined sources1
Modified residuei35PhosphoserineCombined sources1
Modified residuei245PhosphoserineCombined sources1
Modified residuei251PhosphoserineCombined sources1
Modified residuei254PhosphothreonineCombined sources1
Modified residuei255PhosphoserineBy similarity1
Modified residuei271PhosphoserineBy similarity1
Modified residuei556PhosphoserineCombined sources1
Modified residuei635PhosphoserineCombined sources1
Modified residuei663PhosphoserineCombined sources1
Modified residuei668PhosphothreonineCombined sources1
Modified residuei672PhosphothreonineCombined sources1
Modified residuei1155PhosphoserineCombined sources1
Modified residuei1295PhosphoserineCombined sources1
Modified residuei1300PhosphoserineCombined sources1
Modified residuei1457PhosphoserineCombined sources1
Modified residuei1458PhosphoserineCombined sources1
Modified residuei1462PhosphothreonineCombined sources1
Modified residuei1475PhosphothreonineCombined sources1
Modified residuei1480PhosphoserineCombined sources1

Post-translational modificationi

Phosphorylated by MAP kinase p38 (MAPK11, MAPK12, MAPK13 and/or MAPK14).
Ubiquitinated by the BCR(KLHL20) E3 ubiquitin ligase complex when previously phosphorylated by MAP kinase p38 (MAPK11, MAPK12, MAPK13 and/or MAPK14), leading to its degradation, thereby restricting RhoA activity and facilitating growth cone spreading and neurite outgrowth.1 Publication

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

MaxQBiO15085.
PaxDbiO15085.
PeptideAtlasiO15085.
PRIDEiO15085.

PTM databases

iPTMnetiO15085.
PhosphoSitePlusiO15085.

Expressioni

Tissue specificityi

Ubiquitously expressed.1 Publication

Gene expression databases

BgeeiENSG00000132694.
CleanExiHS_ARHGEF11.
GenevisibleiO15085. HS.

Organism-specific databases

HPAiHPA011026.
HPA012037.
HPA014658.

Interactioni

Subunit structurei

Interacts with GNA12 and GNA13 through the RGS domain. Interacts with RHOA, PLXNB1 and PLXNB2. Interacts with SLC1A6 (By similarity). Interacts (via DH domain) with GCSAM (via C-terminus).By similarity5 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
CRKP461082EBI-311099,EBI-886
Daam1Q8BPM03EBI-6169263,EBI-772938From a different organism.
NCK1P163333EBI-311099,EBI-389883
RHOAP615866EBI-311099,EBI-446668
Z5115Q7DB744EBI-311099,EBI-7864788From a different organism.

GO - Molecular functioni

  • G-protein coupled receptor binding Source: MGI

Protein-protein interaction databases

BioGridi115164. 20 interactors.
DIPiDIP-31622N.
IntActiO15085. 23 interactors.
MINTiMINT-1897198.
STRINGi9606.ENSP00000357177.

Structurei

Secondary structure

11522
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi46 – 50Combined sources5
Beta strandi53 – 56Combined sources4
Beta strandi59 – 62Combined sources4
Beta strandi64 – 66Combined sources3
Beta strandi68 – 72Combined sources5
Beta strandi76 – 78Combined sources3
Beta strandi88 – 92Combined sources5
Beta strandi98 – 100Combined sources3
Helixi102 – 110Combined sources9
Beta strandi111 – 120Combined sources10
Helixi307 – 312Combined sources6
Helixi314 – 319Combined sources6
Helixi321 – 334Combined sources14
Helixi338 – 349Combined sources12
Helixi356 – 368Combined sources13
Helixi381 – 392Combined sources12
Helixi398 – 424Combined sources27
Helixi428 – 431Combined sources4
Turni432 – 434Combined sources3
Helixi435 – 438Combined sources4
Helixi443 – 462Combined sources20
Helixi466 – 482Combined sources17
Turni716 – 718Combined sources3
Beta strandi719 – 724Combined sources6
Helixi725 – 727Combined sources3
Helixi730 – 759Combined sources30
Helixi761 – 766Combined sources6
Helixi772 – 778Combined sources7
Beta strandi779 – 781Combined sources3
Helixi782 – 801Combined sources20
Helixi810 – 817Combined sources8
Helixi819 – 833Combined sources15
Helixi836 – 849Combined sources14
Helixi851 – 861Combined sources11
Helixi864 – 866Combined sources3
Helixi871 – 874Combined sources4
Helixi877 – 894Combined sources18
Helixi901 – 939Combined sources39
Turni943 – 945Combined sources3
Turni951 – 953Combined sources3
Helixi954 – 958Combined sources5
Helixi961 – 963Combined sources3
Beta strandi966 – 974Combined sources9
Beta strandi977 – 979Combined sources3
Beta strandi983 – 998Combined sources16
Beta strandi1024 – 1027Combined sources4
Helixi1028 – 1030Combined sources3
Beta strandi1031 – 1035Combined sources5
Beta strandi1040 – 1047Combined sources8
Beta strandi1050 – 1052Combined sources3
Beta strandi1056 – 1060Combined sources5
Helixi1064 – 1080Combined sources17

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1HTJX-ray2.20F281-490[»]
1XCGX-ray2.50A/E714-1081[»]
2DLSNMR-A44-123[»]
3KZ1X-ray2.70A/B710-1085[»]
3T06X-ray2.84A/E672-1081[»]
5E6PX-ray3.21B42-125[»]
ProteinModelPortaliO15085.
SMRiO15085.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO15085.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini47 – 126PDZPROSITE-ProRule annotationAdd BLAST80
Domaini306 – 486RGSLPROSITE-ProRule annotationAdd BLAST181
Domaini734 – 923DHPROSITE-ProRule annotationAdd BLAST190
Domaini965 – 1079PHPROSITE-ProRule annotationAdd BLAST115

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili444 – 470Sequence analysisAdd BLAST27

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi1094 – 1099Poly-Pro6

Domaini

The poly-Pro region is essential for plasma membrane localization upon stimulation.

Sequence similaritiesi

Contains 1 DH (DBL-homology) domain.PROSITE-ProRule annotation
Contains 1 PDZ (DHR) domain.PROSITE-ProRule annotation
Contains 1 PH domain.PROSITE-ProRule annotation
Contains 1 RGSL (RGS-like) domain.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG3520. Eukaryota.
COG5422. LUCA.
GeneTreeiENSGT00760000119193.
HOGENOMiHOG000034045.
HOVERGENiHBG101340.
InParanoidiO15085.
KOiK12331.
OMAiTGNCFYV.
OrthoDBiEOG091G0CZH.
PhylomeDBiO15085.
TreeFamiTF106495.

Family and domain databases

Gene3Di1.20.900.10. 1 hit.
2.30.29.30. 1 hit.
2.30.42.10. 1 hit.
InterProiIPR000219. DH-domain.
IPR001478. PDZ.
IPR032919. PDZ-RhoGEF.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR016137. RGS.
IPR015212. RGS-like_dom.
[Graphical view]
PANTHERiPTHR12673:SF111. PTHR12673:SF111. 2 hits.
PfamiPF00595. PDZ. 1 hit.
PF09128. RGS-like. 1 hit.
PF00621. RhoGEF. 1 hit.
[Graphical view]
SMARTiSM00228. PDZ. 1 hit.
SM00233. PH. 1 hit.
SM00315. RGS. 1 hit.
SM00325. RhoGEF. 1 hit.
[Graphical view]
SUPFAMiSSF48065. SSF48065. 1 hit.
SSF48097. SSF48097. 1 hit.
SSF50156. SSF50156. 1 hit.
SSF50729. SSF50729. 1 hit.
PROSITEiPS50010. DH_2. 1 hit.
PS50106. PDZ. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
PS50132. RGS. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O15085-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSVRLPQSID RLSSLSSLGD SAPERKSPSH HRQPSDASET TGLVQRCVII
60 70 80 90 100
QKDQHGFGFT VSGDRIVLVQ SVRPGGAAMK AGVKEGDRII KVNGTMVTNS
110 120 130 140 150
SHLEVVKLIK SGAYVALTLL GSSPSSMGIS GLQQDPSPAG APRITSVIPS
160 170 180 190 200
PPPPPPLPPP QRITGPKPLQ DPEVQKHATQ ILRNMLRQEE KELQDILPLY
210 220 230 240 250
GDTSQRPSEG RLSLDSQEGD SGLDSGTERF PSLSESLMNR NSVLSDPGLD
260 270 280 290 300
SPRTSPVIMA RVAQHHRRQG SDAAVPSTGD QGVDQSPKPL IIGPEEDYDP
310 320 330 340 350
GYFNNESDII FQDLEKLKSR PAHLGVFLRY IFSQADPSPL LFYLCAEVYQ
360 370 380 390 400
QASPKDSRSL GKDIWNIFLE KNAPLRVKIP EMLQAEIDSR LRNSEDARGV
410 420 430 440 450
LCEAQEAAMP EIQEQIHDYR TKRTLGLGSL YGENDLLDLD GDPLRERQVA
460 470 480 490 500
EKQLAALGDI LSKYEEDRSA PMDFALNTYM SHAGIRLREA RPSNTAEKAQ
510 520 530 540 550
SAPDKDKWLP FFPKTKKSSN SKKEKDALED KKRNPILKYI GKPKSSSQST
560 570 580 590 600
FHIPLSPVEV KPGNVRNIIQ HFENNQQYDA PEPGTQRLST GSFPEDLLES
610 620 630 640 650
DSSRSEIRLG RSESLKGREE MKRSRKAENV PRSRSDVDMD AAAEATRLHQ
660 670 680 690 700
SASSSTSSLS TRSLENPTPP FTPKMGRRSI ESPSLGFCTD TLLPHLLEDD
710 720 730 740 750
LGQLSDLEPE PDAQNWQHTV GKDVVAGLTQ REIDRQEVIN ELFVTEASHL
760 770 780 790 800
RTLRVLDLIF YQRMKKENLM PREELARLFP NLPELIEIHN SWCEAMKKLR
810 820 830 840 850
EEGPIIKEIS DLMLARFDGP AREELQQVAA QFCSYQSIAL ELIKTKQRKE
860 870 880 890 900
SRFQLFMQEA ESHPQCRRLQ LRDLIISEMQ RLTKYPLLLE SIIKHTEGGT
910 920 930 940 950
SEHEKLCRAR DQCREILKYV NEAVKQTENR HRLEGYQKRL DATALERASN
960 970 980 990 1000
PLAAEFKSLD LTTRKMIHEG PLTWRISKDK TLDLHVLLLE DLLVLLQKQD
1010 1020 1030 1040 1050
EKLLLKCHSK TAVGSSDSKQ TFSPVLKLNA VLIRSVATDK RAFFIICTSK
1060 1070 1080 1090 1100
LGPPQIYELV ALTSSDKNTW MELLEEAVRN ATRHPGAAPM PVHPPPPGPR
1110 1120 1130 1140 1150
EPAQQGPTPS RVELDDSDVF HGEPEPEELP GGTGSQQRVQ GKHQVLLEDP
1160 1170 1180 1190 1200
EQEGSAEEEE LGVLPCPSTS LDGENRGIRT RNPIHLAFPG PLFMEGLADS
1210 1220 1230 1240 1250
ALEDVENLRH LILWSLLPGH TMETQAAQEP EDDLTPTPSV ISVTSHPWDP
1260 1270 1280 1290 1300
GSPGQAPPGG EGDNTQLAGL EGERPEQEDM GLCSLEHLPP RTRNSGIWES
1310 1320 1330 1340 1350
PELDRNLAED ASSTEAAGGY KVVRKAEVAG SKVVPALPES GQSEPGPPEV
1360 1370 1380 1390 1400
EGGTKATGNC FYVSMPSGPP DSSTDHSEAP MSPPQPDSLP AGQTEPQPQL
1410 1420 1430 1440 1450
QGGNDDPRRP SRSPPSLALR DVGMIFHTIE QLTLKLNRLK DMELAHRELL
1460 1470 1480 1490 1500
KSLGGESSGG TTPVGSFHTE AARWTDGSLS PPAKEPLASD SRNSHELGPC
1510 1520
PEDGSDAPLE DSTADAAASP GP
Length:1,522
Mass (Da):167,704
Last modified:January 1, 1998 - v1
Checksum:iCA16E125B9F8A4AA
GO
Isoform 2 (identifier: O15085-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     194-194: Q → QRICEVYSRNPASLLEEQIEGARRRVTQLQLKIQQETGGSV

Note: No experimental confirmation available.
Show »
Length:1,562
Mass (Da):172,244
Checksum:iB12857A4FE2BA0AC
GO

Sequence cautioni

The sequence BAA20834 differs from that shown. Reason: Erroneous initiation.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0617951416S → G.Corresponds to variant rs868188dbSNPEnsembl.1
Natural variantiVAR_0242851427H → R.1 PublicationCorresponds to variant rs945508dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_042003194Q → QRICEVYSRNPASLLEEQIE GARRRVTQLQLKIQQETGGS V in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB002378 mRNA. Translation: BAA20834.2. Different initiation.
AL356104, AL157713 Genomic DNA. Translation: CAH72940.1.
AL157713, AL356104 Genomic DNA. Translation: CAH70127.1.
AL157713, AL356104 Genomic DNA. Translation: CAH70128.1.
AL356104, AL157713 Genomic DNA. Translation: CAH72939.1.
CH471121 Genomic DNA. Translation: EAW52893.1.
CH471121 Genomic DNA. Translation: EAW52894.1.
BC057394 mRNA. Translation: AAH57394.1.
CCDSiCCDS1162.1. [O15085-1]
CCDS1163.1. [O15085-2]
RefSeqiNP_055599.1. NM_014784.3. [O15085-1]
NP_937879.1. NM_198236.2. [O15085-2]
UniGeneiHs.516954.

Genome annotation databases

EnsembliENST00000361409; ENSP00000354644; ENSG00000132694. [O15085-1]
ENST00000368194; ENSP00000357177; ENSG00000132694. [O15085-2]
GeneIDi9826.
KEGGihsa:9826.
UCSCiuc001fqn.3. human. [O15085-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB002378 mRNA. Translation: BAA20834.2. Different initiation.
AL356104, AL157713 Genomic DNA. Translation: CAH72940.1.
AL157713, AL356104 Genomic DNA. Translation: CAH70127.1.
AL157713, AL356104 Genomic DNA. Translation: CAH70128.1.
AL356104, AL157713 Genomic DNA. Translation: CAH72939.1.
CH471121 Genomic DNA. Translation: EAW52893.1.
CH471121 Genomic DNA. Translation: EAW52894.1.
BC057394 mRNA. Translation: AAH57394.1.
CCDSiCCDS1162.1. [O15085-1]
CCDS1163.1. [O15085-2]
RefSeqiNP_055599.1. NM_014784.3. [O15085-1]
NP_937879.1. NM_198236.2. [O15085-2]
UniGeneiHs.516954.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1HTJX-ray2.20F281-490[»]
1XCGX-ray2.50A/E714-1081[»]
2DLSNMR-A44-123[»]
3KZ1X-ray2.70A/B710-1085[»]
3T06X-ray2.84A/E672-1081[»]
5E6PX-ray3.21B42-125[»]
ProteinModelPortaliO15085.
SMRiO15085.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115164. 20 interactors.
DIPiDIP-31622N.
IntActiO15085. 23 interactors.
MINTiMINT-1897198.
STRINGi9606.ENSP00000357177.

PTM databases

iPTMnetiO15085.
PhosphoSitePlusiO15085.

Polymorphism and mutation databases

BioMutaiARHGEF11.

Proteomic databases

MaxQBiO15085.
PaxDbiO15085.
PeptideAtlasiO15085.
PRIDEiO15085.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000361409; ENSP00000354644; ENSG00000132694. [O15085-1]
ENST00000368194; ENSP00000357177; ENSG00000132694. [O15085-2]
GeneIDi9826.
KEGGihsa:9826.
UCSCiuc001fqn.3. human. [O15085-1]

Organism-specific databases

CTDi9826.
DisGeNETi9826.
GeneCardsiARHGEF11.
HGNCiHGNC:14580. ARHGEF11.
HPAiHPA011026.
HPA012037.
HPA014658.
MIMi605708. gene.
neXtProtiNX_O15085.
OpenTargetsiENSG00000132694.
PharmGKBiPA24968.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3520. Eukaryota.
COG5422. LUCA.
GeneTreeiENSGT00760000119193.
HOGENOMiHOG000034045.
HOVERGENiHBG101340.
InParanoidiO15085.
KOiK12331.
OMAiTGNCFYV.
OrthoDBiEOG091G0CZH.
PhylomeDBiO15085.
TreeFamiTF106495.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000132694-MONOMER.
ReactomeiR-HSA-193648. NRAGE signals death through JNK.
R-HSA-194840. Rho GTPase cycle.
R-HSA-416482. G alpha (12/13) signalling events.
R-HSA-416572. Sema4D induced cell migration and growth-cone collapse.

Miscellaneous databases

ChiTaRSiARHGEF11. human.
EvolutionaryTraceiO15085.
GeneWikiiARHGEF11.
GenomeRNAii9826.
PROiO15085.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000132694.
CleanExiHS_ARHGEF11.
GenevisibleiO15085. HS.

Family and domain databases

Gene3Di1.20.900.10. 1 hit.
2.30.29.30. 1 hit.
2.30.42.10. 1 hit.
InterProiIPR000219. DH-domain.
IPR001478. PDZ.
IPR032919. PDZ-RhoGEF.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR016137. RGS.
IPR015212. RGS-like_dom.
[Graphical view]
PANTHERiPTHR12673:SF111. PTHR12673:SF111. 2 hits.
PfamiPF00595. PDZ. 1 hit.
PF09128. RGS-like. 1 hit.
PF00621. RhoGEF. 1 hit.
[Graphical view]
SMARTiSM00228. PDZ. 1 hit.
SM00233. PH. 1 hit.
SM00315. RGS. 1 hit.
SM00325. RhoGEF. 1 hit.
[Graphical view]
SUPFAMiSSF48065. SSF48065. 1 hit.
SSF48097. SSF48097. 1 hit.
SSF50156. SSF50156. 1 hit.
SSF50729. SSF50729. 1 hit.
PROSITEiPS50010. DH_2. 1 hit.
PS50106. PDZ. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
PS50132. RGS. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiARHGB_HUMAN
AccessioniPrimary (citable) accession number: O15085
Secondary accession number(s): D3DVD0, Q5VY40, Q6PFW2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 29, 2003
Last sequence update: January 1, 1998
Last modified: November 2, 2016
This is version 160 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.