Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A

Gene

ANKRD28

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Putative regulatory subunit of protein phosphatase 6 (PP6) that may be involved in the recognition of phosphoprotein substrates. Involved in the PP6-mediated dephosphorylation of NFKBIE opposing its degradation in response to TNF-alpha. Selectively inhibits the phosphatase activity of PPP1C. Targets PPP1C to modulate HNRPK phosphorylation.2 Publications

GO - Biological processi

Complete GO annotation...

Enzyme and pathway databases

BioCyciZFISH:G66-30864-MONOMER.
ReactomeiR-HSA-204005. COPII (Coat Protein 2) Mediated Vesicle Transport.

Names & Taxonomyi

Protein namesi
Recommended name:
Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A
Short name:
PP6-ARS-A
Short name:
Serine/threonine-protein phosphatase 6 regulatory subunit ARS-A
Alternative name(s):
Ankyrin repeat domain-containing protein 28
Phosphatase interactor targeting protein hnRNP K
Short name:
PITK
Gene namesi
Name:ANKRD28
Synonyms:KIAA0379
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:29024. ANKRD28.

Subcellular locationi

  • Nucleusnucleoplasm 1 Publication

  • Note: Seems to be excluded from nucleoli.

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi1007 – 1011SKTVS → AKTVA: Marked decrease in phosphorylation. Increased PPP1C-binding. No effect on HNRPK-binding. 1 Publication5

Organism-specific databases

DisGeNETi23243.
OpenTargetsiENSG00000206560.
PharmGKBiPA134880251.

Polymorphism and mutation databases

BioMutaiANKRD28.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000669191 – 1053Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit AAdd BLAST1053

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1007Phosphoserine1 Publication1
Modified residuei1011PhosphoserineCombined sources1 Publication1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiO15084.
PaxDbiO15084.
PeptideAtlasiO15084.
PRIDEiO15084.

PTM databases

iPTMnetiO15084.
PhosphoSitePlusiO15084.

Expressioni

Gene expression databases

BgeeiENSG00000206560.
CleanExiHS_ANKRD28.
ExpressionAtlasiO15084. baseline and differential.
GenevisibleiO15084. HS.

Interactioni

Subunit structurei

Protein phosphatase 6 (PP6) holoenzyme is proposed to be a heterotrimeric complex formed by the catalytic subunit, a SAPS domain-containing subunit (PP6R) and an ankyrin repeat-domain containing regulatory subunit (ARS). Interacts with PPP1C and HNRPK. Interacts with PPP6C, PPP6R1 and PPP6R3.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
DOCK1Q141854EBI-359567,EBI-446740
PPP6CO007439EBI-359567,EBI-359751
PPP6R1Q9UPN710EBI-359567,EBI-359745
PPP6R2O751707EBI-359567,EBI-359739
PPP6R3Q5H9R75EBI-359567,EBI-355498
TNKS2Q9H2K23EBI-359567,EBI-4398527

Protein-protein interaction databases

BioGridi116847. 82 interactors.
DIPiDIP-27583N.
IntActiO15084. 97 interactors.
MINTiMINT-1150737.
STRINGi9606.ENSP00000382379.

Structurei

3D structure databases

ProteinModelPortaliO15084.
SMRiO15084.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati40 – 69ANK 1Add BLAST30
Repeati73 – 102ANK 2Add BLAST30
Repeati106 – 135ANK 3Add BLAST30
Repeati139 – 168ANK 4Add BLAST30
Repeati172 – 201ANK 5Add BLAST30
Repeati205 – 234ANK 6Add BLAST30
Repeati238 – 267ANK 7Add BLAST30
Repeati271 – 301ANK 8Add BLAST31
Repeati305 – 334ANK 9Add BLAST30
Repeati338 – 367ANK 10Add BLAST30
Repeati371 – 400ANK 11Add BLAST30
Repeati404 – 433ANK 12Add BLAST30
Repeati437 – 466ANK 13Add BLAST30
Repeati470 – 500ANK 14Add BLAST31
Repeati504 – 534ANK 15Add BLAST31
Repeati549 – 578ANK 16Add BLAST30
Repeati582 – 611ANK 17Add BLAST30
Repeati616 – 645ANK 18Add BLAST30
Repeati652 – 681ANK 19Add BLAST30
Repeati685 – 714ANK 20Add BLAST30
Repeati718 – 747ANK 21Add BLAST30
Repeati755 – 784ANK 22Add BLAST30
Repeati787 – 817ANK 23Add BLAST31
Repeati822 – 851ANK 24Add BLAST30
Repeati855 – 885ANK 25Add BLAST31
Repeati889 – 918ANK 26Add BLAST30
Repeati925 – 954ANK 27Add BLAST30

Sequence similaritiesi

Contains 27 ANK repeats.PROSITE-ProRule annotation

Keywords - Domaini

ANK repeat, Repeat

Phylogenomic databases

eggNOGiKOG0504. Eukaryota.
COG0666. LUCA.
GeneTreeiENSGT00840000129677.
HOGENOMiHOG000033959.
HOVERGENiHBG067697.
InParanoidiO15084.
KOiK15502.
OMAiQKMEGNS.
OrthoDBiEOG091G02S4.
TreeFamiTF312824.

Family and domain databases

Gene3Di1.25.40.20. 4 hits.
InterProiIPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
[Graphical view]
PfamiPF00023. Ank. 2 hits.
PF12796. Ank_2. 8 hits.
[Graphical view]
PRINTSiPR01415. ANKYRIN.
SMARTiSM00248. ANK. 28 hits.
[Graphical view]
SUPFAMiSSF48403. SSF48403. 4 hits.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 24 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O15084-3) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAFLKLRDQP SLVQAIFNGD PDEVRALIFK KEDVNFQDNE KRTPLHAAAY
60 70 80 90 100
LGDAEIIELL ILSGARVNAK DSKWLTPLHR AVASCSEEAV QVLLKHSADV
110 120 130 140 150
NARDKNWQTP LHIAAANKAV KCAEALVPLL SNVNVSDRAG RTALHHAAFS
160 170 180 190 200
GHGEMVKLLL SRGANINAFD KKDRRAIHWA AYMGHIEVVK LLVSHGAEVT
210 220 230 240 250
CKDKKSYTPL HAAASSGMIS VVKYLLDLGV DMNEPNAYGN TPLHVACYNG
260 270 280 290 300
QDVVVNELID CGAIVNQKNE KGFTPLHFAA ASTHGALCLE LLVGNGADVN
310 320 330 340 350
MKSKDGKTPL HMTALHGRFS RSQTIIQSGA VIDCEDKNGN TPLHIAARYG
360 370 380 390 400
HELLINTLIT SGADTAKRGI HGMFPLHLAA LSGFSDCCRK LLSSGFDIDT
410 420 430 440 450
PDDFGRTCLH AAAAGGNLEC LNLLLNTGAD FNKKDKFGRS PLHYAAANCN
460 470 480 490 500
YQCLFALVGS GASVNDLDER GCTPLHYAAT SDTDGKCLEY LLRNDANPGI
510 520 530 540 550
RDKQGYNAVH YSAAYGHRLC LQLIASETPL DVLMETSGTD MLSDSDNRAT
560 570 580 590 600
ISPLHLAAYH GHHQALEVLV QSLLDLDVRN SSGRTPLDLA AFKGHVECVD
610 620 630 640 650
VLINQGASIL VKDYILKRTP IHAAATNGHS ECLRLLIGNA EPQNAVDIQD
660 670 680 690 700
GNGQTPLMLS VLNGHTDCVY SLLNKGANVD AKDKWGRTAL HRGAVTGHEE
710 720 730 740 750
CVDALLQHGA KCLLRDSRGR TPIHLSAACG HIGVLGALLQ SAASMDANPA
760 770 780 790 800
TADNHGYTAL HWACYNGHET CVELLLEQEV FQKTEGNAFS PLHCAVINDN
810 820 830 840 850
EGAAEMLIDT LGASIVNATD SKGRTPLHAA AFTDHVECLQ LLLSHNAQVN
860 870 880 890 900
SVDSTGKTPL MMAAENGQTN TVEMLVSSAS AELTLQDNSK NTALHLACSK
910 920 930 940 950
GHETSALLIL EKITDRNLIN ATNAALQTPL HVAARNGLTM VVQELLGKGA
960 970 980 990 1000
SVLAVDENGY TPALACAPNK DVADCLALIL ATMMPVSSSS PLSSLTFNAI
1010 1020 1030 1040 1050
NRYTNTSKTV SFEALPIMRN EPSSYCSFNN IGGEQEYLYT DVDELNDSDS

ETY
Length:1,053
Mass (Da):112,966
Last modified:May 3, 2011 - v5
Checksum:iBDB4855193364585
GO
Isoform 2 (identifier: O15084-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-154: Missing.

Note: Produced by alternative promoter usage.
Show »
Length:899
Mass (Da):96,161
Checksum:iE06723898ABF4B08
GO
Isoform 3 (identifier: O15084-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-9: MAFLKLRDQ → MSRVCIVVLEEVEDESPAFISKLPQENKSLHSPPSGNVLVRY

Show »
Length:1,086
Mass (Da):116,543
Checksum:i47A3F97E5C72F0E8
GO
Isoform 4 (identifier: O15084-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-9: MAFLKLRDQ → MSRVCIVVLEEVEDESPAFISKLPQENKSLHSPPSGNVL

Note: No experimental confirmation available.
Show »
Length:1,083
Mass (Da):116,124
Checksum:i349BC9338F251E08
GO

Sequence cautioni

The sequence AAQ72374 differs from that shown. Reason: Frameshift at position 408.Curated
The sequence BAA20833 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAC86737 differs from that shown. Intron retention.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti293V → A in AAQ72374 (Ref. 1) Curated1
Sequence conflicti500I → V in AAQ72374 (Ref. 1) Curated1
Sequence conflicti500I → V in BAC86737 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0124331 – 154Missing in isoform 2. 2 PublicationsAdd BLAST154
Alternative sequenceiVSP_0410131 – 9MAFLKLRDQ → MSRVCIVVLEEVEDESPAFI SKLPQENKSLHSPPSGNVLV RY in isoform 3. 2 Publications9
Alternative sequenceiVSP_0410141 – 9MAFLKLRDQ → MSRVCIVVLEEVEDESPAFI SKLPQENKSLHSPPSGNVL in isoform 4. 1 Publication9

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY367056 mRNA. Translation: AAQ72374.1. Frameshift.
AB002377 mRNA. Translation: BAA20833.2. Different initiation.
AK126888 mRNA. Translation: BAC86737.1. Sequence problems.
AK293770 mRNA. Translation: BAG57186.1.
BC106948 mRNA. Translation: AAI06949.2.
BC113868 mRNA. Translation: AAI13869.1.
BC114476 mRNA. Translation: AAI14477.1.
CCDSiCCDS46769.1. [O15084-3]
CCDS74908.1. [O15084-2]
RefSeqiNP_001182027.1. NM_001195098.1. [O15084-2]
NP_001182028.1. NM_001195099.1. [O15084-2]
NP_056014.2. NM_015199.3. [O15084-3]
XP_005265053.1. XM_005264996.3. [O15084-4]
XP_011531842.1. XM_011533540.2. [O15084-1]
XP_016861515.1. XM_017006026.1. [O15084-2]
XP_016861516.1. XM_017006027.1. [O15084-2]
UniGeneiHs.335239.

Genome annotation databases

EnsembliENST00000399451; ENSP00000382379; ENSG00000206560. [O15084-3]
ENST00000412318; ENSP00000397341; ENSG00000206560. [O15084-3]
ENST00000624145; ENSP00000485421; ENSG00000206560. [O15084-2]
GeneIDi23243.
KEGGihsa:23243.
UCSCiuc003cai.2. human. [O15084-3]

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY367056 mRNA. Translation: AAQ72374.1. Frameshift.
AB002377 mRNA. Translation: BAA20833.2. Different initiation.
AK126888 mRNA. Translation: BAC86737.1. Sequence problems.
AK293770 mRNA. Translation: BAG57186.1.
BC106948 mRNA. Translation: AAI06949.2.
BC113868 mRNA. Translation: AAI13869.1.
BC114476 mRNA. Translation: AAI14477.1.
CCDSiCCDS46769.1. [O15084-3]
CCDS74908.1. [O15084-2]
RefSeqiNP_001182027.1. NM_001195098.1. [O15084-2]
NP_001182028.1. NM_001195099.1. [O15084-2]
NP_056014.2. NM_015199.3. [O15084-3]
XP_005265053.1. XM_005264996.3. [O15084-4]
XP_011531842.1. XM_011533540.2. [O15084-1]
XP_016861515.1. XM_017006026.1. [O15084-2]
XP_016861516.1. XM_017006027.1. [O15084-2]
UniGeneiHs.335239.

3D structure databases

ProteinModelPortaliO15084.
SMRiO15084.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116847. 82 interactors.
DIPiDIP-27583N.
IntActiO15084. 97 interactors.
MINTiMINT-1150737.
STRINGi9606.ENSP00000382379.

PTM databases

iPTMnetiO15084.
PhosphoSitePlusiO15084.

Polymorphism and mutation databases

BioMutaiANKRD28.

Proteomic databases

EPDiO15084.
PaxDbiO15084.
PeptideAtlasiO15084.
PRIDEiO15084.

Protocols and materials databases

DNASUi23243.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000399451; ENSP00000382379; ENSG00000206560. [O15084-3]
ENST00000412318; ENSP00000397341; ENSG00000206560. [O15084-3]
ENST00000624145; ENSP00000485421; ENSG00000206560. [O15084-2]
GeneIDi23243.
KEGGihsa:23243.
UCSCiuc003cai.2. human. [O15084-3]

Organism-specific databases

CTDi23243.
DisGeNETi23243.
GeneCardsiANKRD28.
H-InvDBHIX0003106.
HGNCiHGNC:29024. ANKRD28.
MIMi611122. gene.
neXtProtiNX_O15084.
OpenTargetsiENSG00000206560.
PharmGKBiPA134880251.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0504. Eukaryota.
COG0666. LUCA.
GeneTreeiENSGT00840000129677.
HOGENOMiHOG000033959.
HOVERGENiHBG067697.
InParanoidiO15084.
KOiK15502.
OMAiQKMEGNS.
OrthoDBiEOG091G02S4.
TreeFamiTF312824.

Enzyme and pathway databases

BioCyciZFISH:G66-30864-MONOMER.
ReactomeiR-HSA-204005. COPII (Coat Protein 2) Mediated Vesicle Transport.

Miscellaneous databases

ChiTaRSiANKRD28. human.
GenomeRNAii23243.
PROiO15084.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000206560.
CleanExiHS_ANKRD28.
ExpressionAtlasiO15084. baseline and differential.
GenevisibleiO15084. HS.

Family and domain databases

Gene3Di1.25.40.20. 4 hits.
InterProiIPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
[Graphical view]
PfamiPF00023. Ank. 2 hits.
PF12796. Ank_2. 8 hits.
[Graphical view]
PRINTSiPR01415. ANKYRIN.
SMARTiSM00248. ANK. 28 hits.
[Graphical view]
SUPFAMiSSF48403. SSF48403. 4 hits.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 24 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiANR28_HUMAN
AccessioniPrimary (citable) accession number: O15084
Secondary accession number(s): B4DES5
, Q1WWL4, Q29RW6, Q3B857, Q6ULS0, Q6ZT57
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 20, 2001
Last sequence update: May 3, 2011
Last modified: November 30, 2016
This is version 152 of the entry and version 5 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.