Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O15084

- ANR28_HUMAN

UniProt

O15084 - ANR28_HUMAN

Protein

Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A

Gene

ANKRD28

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 131 (01 Oct 2014)
      Sequence version 5 (03 May 2011)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Putative regulatory subunit of protein phosphatase 6 (PP6) that may be involved in the recognition of phosphoprotein substrates. Involved in the PP6-mediated dephosphorylation of NFKBIE opposing its degradation in response to TNF-alpha. Selectively inhibits the phosphatase activity of PPP1C. Targets PPP1C to modulate HNRPK phosphorylation.2 Publications

    GO - Molecular functioni

    1. protein binding Source: IntAct

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A
    Short name:
    PP6-ARS-A
    Short name:
    Serine/threonine-protein phosphatase 6 regulatory subunit ARS-A
    Alternative name(s):
    Ankyrin repeat domain-containing protein 28
    Phosphatase interactor targeting protein hnRNP K
    Short name:
    PITK
    Gene namesi
    Name:ANKRD28
    Synonyms:KIAA0379
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 3

    Organism-specific databases

    HGNCiHGNC:29024. ANKRD28.

    Subcellular locationi

    Nucleusnucleoplasm 1 Publication
    Note: Seems to be excluded from nucleoli.

    GO - Cellular componenti

    1. nucleoplasm Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi1007 – 10115SKTVS → AKTVA: Marked decrease in phosphorylation. Increased PPP1C-binding. No effect on HNRPK-binding. 1 Publication

    Organism-specific databases

    PharmGKBiPA134880251.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 10531053Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit APRO_0000066919Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei1007 – 10071Phosphoserine1 Publication
    Modified residuei1011 – 10111Phosphoserine1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiO15084.
    PaxDbiO15084.
    PRIDEiO15084.

    PTM databases

    PhosphoSiteiO15084.

    Expressioni

    Gene expression databases

    ArrayExpressiO15084.
    BgeeiO15084.
    CleanExiHS_ANKRD28.
    GenevestigatoriO15084.

    Organism-specific databases

    HPAiHPA052925.

    Interactioni

    Subunit structurei

    Protein phosphatase 6 (PP6) holoenzyme is proposed to be a heterotrimeric complex formed by the catalytic subunit, a SAPS domain-containing subunit (PP6R) and an ankyrin repeat-domain containing regulatory subunit (ARS). Interacts with PPP1C and HNRPK. Interacts with PPP6C, PPP6R1 and PPP6R3.2 Publications

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    DOCK1Q141854EBI-359567,EBI-446740
    PPP6CO007439EBI-359567,EBI-359751
    PPP6R1Q9UPN710EBI-359567,EBI-359745
    PPP6R2O751707EBI-359567,EBI-359739
    PPP6R3Q5H9R75EBI-359567,EBI-355498
    TNKS2Q9H2K23EBI-359567,EBI-4398527

    Protein-protein interaction databases

    BioGridi116847. 58 interactions.
    DIPiDIP-27583N.
    IntActiO15084. 74 interactions.
    MINTiMINT-1150737.
    STRINGi9606.ENSP00000382379.

    Structurei

    3D structure databases

    ProteinModelPortaliO15084.
    SMRiO15084. Positions 8-1022.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati40 – 6930ANK 1Add
    BLAST
    Repeati73 – 10230ANK 2Add
    BLAST
    Repeati106 – 13530ANK 3Add
    BLAST
    Repeati139 – 16830ANK 4Add
    BLAST
    Repeati172 – 20130ANK 5Add
    BLAST
    Repeati205 – 23430ANK 6Add
    BLAST
    Repeati238 – 26730ANK 7Add
    BLAST
    Repeati271 – 30131ANK 8Add
    BLAST
    Repeati305 – 33430ANK 9Add
    BLAST
    Repeati338 – 36730ANK 10Add
    BLAST
    Repeati371 – 40030ANK 11Add
    BLAST
    Repeati404 – 43330ANK 12Add
    BLAST
    Repeati437 – 46630ANK 13Add
    BLAST
    Repeati470 – 50031ANK 14Add
    BLAST
    Repeati504 – 53431ANK 15Add
    BLAST
    Repeati549 – 57830ANK 16Add
    BLAST
    Repeati582 – 61130ANK 17Add
    BLAST
    Repeati616 – 64530ANK 18Add
    BLAST
    Repeati652 – 68130ANK 19Add
    BLAST
    Repeati685 – 71430ANK 20Add
    BLAST
    Repeati718 – 74730ANK 21Add
    BLAST
    Repeati755 – 78430ANK 22Add
    BLAST
    Repeati787 – 81731ANK 23Add
    BLAST
    Repeati822 – 85130ANK 24Add
    BLAST
    Repeati855 – 88531ANK 25Add
    BLAST
    Repeati889 – 91830ANK 26Add
    BLAST
    Repeati925 – 95430ANK 27Add
    BLAST

    Sequence similaritiesi

    Contains 27 ANK repeats.PROSITE-ProRule annotation

    Keywords - Domaini

    ANK repeat, Repeat

    Phylogenomic databases

    eggNOGiCOG0666.
    HOGENOMiHOG000033959.
    HOVERGENiHBG067697.
    InParanoidiO15084.
    KOiK15502.
    OMAiDMLNDSD.
    OrthoDBiEOG7QG436.
    TreeFamiTF312824.

    Family and domain databases

    Gene3Di1.25.40.20. 4 hits.
    InterProiIPR002110. Ankyrin_rpt.
    IPR020683. Ankyrin_rpt-contain_dom.
    [Graphical view]
    PfamiPF00023. Ank. 22 hits.
    PF12796. Ank_2. 1 hit.
    [Graphical view]
    PRINTSiPR01415. ANKYRIN.
    SMARTiSM00248. ANK. 28 hits.
    [Graphical view]
    SUPFAMiSSF48403. SSF48403. 4 hits.
    PROSITEiPS50297. ANK_REP_REGION. 1 hit.
    PS50088. ANK_REPEAT. 24 hits.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative promoter usage and alternative splicing. Align

    Isoform 1 (identifier: O15084-3) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAFLKLRDQP SLVQAIFNGD PDEVRALIFK KEDVNFQDNE KRTPLHAAAY     50
    LGDAEIIELL ILSGARVNAK DSKWLTPLHR AVASCSEEAV QVLLKHSADV 100
    NARDKNWQTP LHIAAANKAV KCAEALVPLL SNVNVSDRAG RTALHHAAFS 150
    GHGEMVKLLL SRGANINAFD KKDRRAIHWA AYMGHIEVVK LLVSHGAEVT 200
    CKDKKSYTPL HAAASSGMIS VVKYLLDLGV DMNEPNAYGN TPLHVACYNG 250
    QDVVVNELID CGAIVNQKNE KGFTPLHFAA ASTHGALCLE LLVGNGADVN 300
    MKSKDGKTPL HMTALHGRFS RSQTIIQSGA VIDCEDKNGN TPLHIAARYG 350
    HELLINTLIT SGADTAKRGI HGMFPLHLAA LSGFSDCCRK LLSSGFDIDT 400
    PDDFGRTCLH AAAAGGNLEC LNLLLNTGAD FNKKDKFGRS PLHYAAANCN 450
    YQCLFALVGS GASVNDLDER GCTPLHYAAT SDTDGKCLEY LLRNDANPGI 500
    RDKQGYNAVH YSAAYGHRLC LQLIASETPL DVLMETSGTD MLSDSDNRAT 550
    ISPLHLAAYH GHHQALEVLV QSLLDLDVRN SSGRTPLDLA AFKGHVECVD 600
    VLINQGASIL VKDYILKRTP IHAAATNGHS ECLRLLIGNA EPQNAVDIQD 650
    GNGQTPLMLS VLNGHTDCVY SLLNKGANVD AKDKWGRTAL HRGAVTGHEE 700
    CVDALLQHGA KCLLRDSRGR TPIHLSAACG HIGVLGALLQ SAASMDANPA 750
    TADNHGYTAL HWACYNGHET CVELLLEQEV FQKTEGNAFS PLHCAVINDN 800
    EGAAEMLIDT LGASIVNATD SKGRTPLHAA AFTDHVECLQ LLLSHNAQVN 850
    SVDSTGKTPL MMAAENGQTN TVEMLVSSAS AELTLQDNSK NTALHLACSK 900
    GHETSALLIL EKITDRNLIN ATNAALQTPL HVAARNGLTM VVQELLGKGA 950
    SVLAVDENGY TPALACAPNK DVADCLALIL ATMMPVSSSS PLSSLTFNAI 1000
    NRYTNTSKTV SFEALPIMRN EPSSYCSFNN IGGEQEYLYT DVDELNDSDS 1050
    ETY 1053
    Length:1,053
    Mass (Da):112,966
    Last modified:May 3, 2011 - v5
    Checksum:iBDB4855193364585
    GO
    Isoform 2 (identifier: O15084-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-154: Missing.

    Note: Produced by alternative promoter usage.

    Show »
    Length:899
    Mass (Da):96,161
    Checksum:iE06723898ABF4B08
    GO
    Isoform 3 (identifier: O15084-1) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-9: MAFLKLRDQ → MSRVCIVVLEEVEDESPAFISKLPQENKSLHSPPSGNVLVRY

    Show »
    Length:1,086
    Mass (Da):116,543
    Checksum:i47A3F97E5C72F0E8
    GO
    Isoform 4 (identifier: O15084-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-9: MAFLKLRDQ → MSRVCIVVLEEVEDESPAFISKLPQENKSLHSPPSGNVL

    Note: No experimental confirmation available.

    Show »
    Length:1,083
    Mass (Da):116,124
    Checksum:i349BC9338F251E08
    GO

    Sequence cautioni

    The sequence BAC86737.1 differs from that shown. Reason: Intron retention.
    The sequence AAQ72374.1 differs from that shown. Reason: Frameshift at position 408.
    The sequence BAA20833.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti293 – 2931V → A in AAQ72374. 1 PublicationCurated
    Sequence conflicti500 – 5001I → V in AAQ72374. 1 PublicationCurated
    Sequence conflicti500 – 5001I → V in BAC86737. (PubMed:14702039)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 154154Missing in isoform 2. 2 PublicationsVSP_012433Add
    BLAST
    Alternative sequencei1 – 99MAFLKLRDQ → MSRVCIVVLEEVEDESPAFI SKLPQENKSLHSPPSGNVLV RY in isoform 3. 2 PublicationsVSP_041013
    Alternative sequencei1 – 99MAFLKLRDQ → MSRVCIVVLEEVEDESPAFI SKLPQENKSLHSPPSGNVL in isoform 4. 1 PublicationVSP_041014

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY367056 mRNA. Translation: AAQ72374.1. Frameshift.
    AB002377 mRNA. Translation: BAA20833.2. Different initiation.
    AK126888 mRNA. Translation: BAC86737.1. Sequence problems.
    AK293770 mRNA. Translation: BAG57186.1.
    BC106948 mRNA. Translation: AAI06949.2.
    BC113868 mRNA. Translation: AAI13869.1.
    BC114476 mRNA. Translation: AAI14477.1.
    CCDSiCCDS46769.1. [O15084-3]
    RefSeqiNP_001182027.1. NM_001195098.1. [O15084-2]
    NP_001182028.1. NM_001195099.1. [O15084-2]
    NP_056014.2. NM_015199.3. [O15084-3]
    XP_005265053.1. XM_005264996.2. [O15084-4]
    UniGeneiHs.335239.

    Genome annotation databases

    EnsembliENST00000383777; ENSP00000373287; ENSG00000206560. [O15084-1]
    ENST00000399451; ENSP00000382379; ENSG00000206560. [O15084-3]
    ENST00000412318; ENSP00000397341; ENSG00000206560. [O15084-3]
    GeneIDi23243.
    KEGGihsa:23243.
    UCSCiuc003cai.1. human. [O15084-3]
    uc003cal.1. human. [O15084-4]
    uc003cam.2. human. [O15084-1]

    Keywords - Coding sequence diversityi

    Alternative promoter usage, Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY367056 mRNA. Translation: AAQ72374.1 . Frameshift.
    AB002377 mRNA. Translation: BAA20833.2 . Different initiation.
    AK126888 mRNA. Translation: BAC86737.1 . Sequence problems.
    AK293770 mRNA. Translation: BAG57186.1 .
    BC106948 mRNA. Translation: AAI06949.2 .
    BC113868 mRNA. Translation: AAI13869.1 .
    BC114476 mRNA. Translation: AAI14477.1 .
    CCDSi CCDS46769.1. [O15084-3 ]
    RefSeqi NP_001182027.1. NM_001195098.1. [O15084-2 ]
    NP_001182028.1. NM_001195099.1. [O15084-2 ]
    NP_056014.2. NM_015199.3. [O15084-3 ]
    XP_005265053.1. XM_005264996.2. [O15084-4 ]
    UniGenei Hs.335239.

    3D structure databases

    ProteinModelPortali O15084.
    SMRi O15084. Positions 8-1022.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 116847. 58 interactions.
    DIPi DIP-27583N.
    IntActi O15084. 74 interactions.
    MINTi MINT-1150737.
    STRINGi 9606.ENSP00000382379.

    PTM databases

    PhosphoSitei O15084.

    Proteomic databases

    MaxQBi O15084.
    PaxDbi O15084.
    PRIDEi O15084.

    Protocols and materials databases

    DNASUi 23243.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000383777 ; ENSP00000373287 ; ENSG00000206560 . [O15084-1 ]
    ENST00000399451 ; ENSP00000382379 ; ENSG00000206560 . [O15084-3 ]
    ENST00000412318 ; ENSP00000397341 ; ENSG00000206560 . [O15084-3 ]
    GeneIDi 23243.
    KEGGi hsa:23243.
    UCSCi uc003cai.1. human. [O15084-3 ]
    uc003cal.1. human. [O15084-4 ]
    uc003cam.2. human. [O15084-1 ]

    Organism-specific databases

    CTDi 23243.
    GeneCardsi GC03M015708.
    H-InvDB HIX0003106.
    HGNCi HGNC:29024. ANKRD28.
    HPAi HPA052925.
    MIMi 611122. gene.
    neXtProti NX_O15084.
    PharmGKBi PA134880251.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0666.
    HOGENOMi HOG000033959.
    HOVERGENi HBG067697.
    InParanoidi O15084.
    KOi K15502.
    OMAi DMLNDSD.
    OrthoDBi EOG7QG436.
    TreeFami TF312824.

    Miscellaneous databases

    GenomeRNAii 23243.
    NextBioi 44912.
    PROi O15084.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O15084.
    Bgeei O15084.
    CleanExi HS_ANKRD28.
    Genevestigatori O15084.

    Family and domain databases

    Gene3Di 1.25.40.20. 4 hits.
    InterProi IPR002110. Ankyrin_rpt.
    IPR020683. Ankyrin_rpt-contain_dom.
    [Graphical view ]
    Pfami PF00023. Ank. 22 hits.
    PF12796. Ank_2. 1 hit.
    [Graphical view ]
    PRINTSi PR01415. ANKYRIN.
    SMARTi SM00248. ANK. 28 hits.
    [Graphical view ]
    SUPFAMi SSF48403. SSF48403. 4 hits.
    PROSITEi PS50297. ANK_REP_REGION. 1 hit.
    PS50088. ANK_REPEAT. 24 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning a new transcript of KIAA0379 protein in testis."
      Lu L., Huang X.Y., Yin L.L., Xu M., Li J.M., Zhou Z.M., Sha J.H.
      Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
      Tissue: Testis.
    2. "Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro."
      Nagase T., Ishikawa K., Nakajima D., Ohira M., Seki N., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
      DNA Res. 4:141-150(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    3. "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
      Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
      DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: SEQUENCE REVISION.
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-767 (ISOFORM 3).
      Tissue: Amygdala and Cerebellum.
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-752 (ISOFORMS 3 AND 4).
    6. "PITK, a PP1 targeting subunit that modulates the phosphorylation of the transcriptional regulator hnRNP K."
      Kwiek N.C., Thacker D.F., Datto M.B., Megosh H.B., Haystead T.A.J.
      Cell. Signal. 18:1769-1778(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH PPP1C AND HNRPK, PHOSPHORYLATION AT SER-1007 AND SER-1011, MUTAGENESIS OF 1007-SER--SER-1011.
    7. "Protein phosphatase 6 regulatory subunits composed of ankyrin repeat domains."
      Stefansson B., Ohama T., Daugherty A.E., Brautigan D.L.
      Biochemistry 47:1442-1451(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH PPP6C; PPP6R1 AND PPP6R3.
    8. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
      Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
      Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    9. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    10. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    11. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiANR28_HUMAN
    AccessioniPrimary (citable) accession number: O15084
    Secondary accession number(s): B4DES5
    , Q1WWL4, Q29RW6, Q3B857, Q6ULS0, Q6ZT57
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 20, 2001
    Last sequence update: May 3, 2011
    Last modified: October 1, 2014
    This is version 131 of the entry and version 5 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 3
      Human chromosome 3: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3