SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O15084

- ANR28_HUMAN

UniProt

O15084 - ANR28_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A

Gene
ANKRD28, KIAA0379
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Putative regulatory subunit of protein phosphatase 6 (PP6) that may be involved in the recognition of phosphoprotein substrates. Involved in the PP6-mediated dephosphorylation of NFKBIE opposing its degradation in response to TNF-alpha. Selectively inhibits the phosphatase activity of PPP1C. Targets PPP1C to modulate HNRPK phosphorylation.2 Publications

GO - Molecular functioni

  1. protein binding Source: IntAct
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A
Short name:
PP6-ARS-A
Short name:
Serine/threonine-protein phosphatase 6 regulatory subunit ARS-A
Alternative name(s):
Ankyrin repeat domain-containing protein 28
Phosphatase interactor targeting protein hnRNP K
Short name:
PITK
Gene namesi
Name:ANKRD28
Synonyms:KIAA0379
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 3

Organism-specific databases

HGNCiHGNC:29024. ANKRD28.

Subcellular locationi

Nucleusnucleoplasm
Note: Seems to be excluded from nucleoli.1 Publication

GO - Cellular componenti

  1. nucleoplasm Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi1007 – 10115SKTVS → AKTVA: Marked decrease in phosphorylation. Increased PPP1C-binding. No effect on HNRPK-binding. 1 Publication

Organism-specific databases

PharmGKBiPA134880251.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10531053Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit APRO_0000066919Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1007 – 10071Phosphoserine1 Publication
Modified residuei1011 – 10111Phosphoserine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiO15084.
PaxDbiO15084.
PRIDEiO15084.

PTM databases

PhosphoSiteiO15084.

Expressioni

Gene expression databases

ArrayExpressiO15084.
BgeeiO15084.
CleanExiHS_ANKRD28.
GenevestigatoriO15084.

Organism-specific databases

HPAiHPA052925.

Interactioni

Subunit structurei

Protein phosphatase 6 (PP6) holoenzyme is proposed to be a heterotrimeric complex formed by the catalytic subunit, a SAPS domain-containing subunit (PP6R) and an ankyrin repeat-domain containing regulatory subunit (ARS). Interacts with PPP1C and HNRPK. Interacts with PPP6C, PPP6R1 and PPP6R3.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
DOCK1Q141854EBI-359567,EBI-446740
PPP6CO007439EBI-359567,EBI-359751
PPP6R1Q9UPN710EBI-359567,EBI-359745
PPP6R2O751707EBI-359567,EBI-359739
PPP6R3Q5H9R75EBI-359567,EBI-355498
TNKS2Q9H2K23EBI-359567,EBI-4398527

Protein-protein interaction databases

BioGridi116847. 58 interactions.
DIPiDIP-27583N.
IntActiO15084. 74 interactions.
MINTiMINT-1150737.
STRINGi9606.ENSP00000382379.

Structurei

3D structure databases

ProteinModelPortaliO15084.
SMRiO15084. Positions 8-1022.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati40 – 6930ANK 1Add
BLAST
Repeati73 – 10230ANK 2Add
BLAST
Repeati106 – 13530ANK 3Add
BLAST
Repeati139 – 16830ANK 4Add
BLAST
Repeati172 – 20130ANK 5Add
BLAST
Repeati205 – 23430ANK 6Add
BLAST
Repeati238 – 26730ANK 7Add
BLAST
Repeati271 – 30131ANK 8Add
BLAST
Repeati305 – 33430ANK 9Add
BLAST
Repeati338 – 36730ANK 10Add
BLAST
Repeati371 – 40030ANK 11Add
BLAST
Repeati404 – 43330ANK 12Add
BLAST
Repeati437 – 46630ANK 13Add
BLAST
Repeati470 – 50031ANK 14Add
BLAST
Repeati504 – 53431ANK 15Add
BLAST
Repeati549 – 57830ANK 16Add
BLAST
Repeati582 – 61130ANK 17Add
BLAST
Repeati616 – 64530ANK 18Add
BLAST
Repeati652 – 68130ANK 19Add
BLAST
Repeati685 – 71430ANK 20Add
BLAST
Repeati718 – 74730ANK 21Add
BLAST
Repeati755 – 78430ANK 22Add
BLAST
Repeati787 – 81731ANK 23Add
BLAST
Repeati822 – 85130ANK 24Add
BLAST
Repeati855 – 88531ANK 25Add
BLAST
Repeati889 – 91830ANK 26Add
BLAST
Repeati925 – 95430ANK 27Add
BLAST

Sequence similaritiesi

Contains 27 ANK repeats.

Keywords - Domaini

ANK repeat, Repeat

Phylogenomic databases

eggNOGiCOG0666.
HOGENOMiHOG000033959.
HOVERGENiHBG067697.
InParanoidiO15084.
KOiK15502.
OMAiDMLNDSD.
OrthoDBiEOG7QG436.
TreeFamiTF312824.

Family and domain databases

Gene3Di1.25.40.20. 4 hits.
InterProiIPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
[Graphical view]
PfamiPF00023. Ank. 22 hits.
PF12796. Ank_2. 1 hit.
[Graphical view]
PRINTSiPR01415. ANKYRIN.
SMARTiSM00248. ANK. 28 hits.
[Graphical view]
SUPFAMiSSF48403. SSF48403. 4 hits.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 24 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative promoter usage and alternative splicing. Align

Isoform 1 (identifier: O15084-3) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAFLKLRDQP SLVQAIFNGD PDEVRALIFK KEDVNFQDNE KRTPLHAAAY     50
LGDAEIIELL ILSGARVNAK DSKWLTPLHR AVASCSEEAV QVLLKHSADV 100
NARDKNWQTP LHIAAANKAV KCAEALVPLL SNVNVSDRAG RTALHHAAFS 150
GHGEMVKLLL SRGANINAFD KKDRRAIHWA AYMGHIEVVK LLVSHGAEVT 200
CKDKKSYTPL HAAASSGMIS VVKYLLDLGV DMNEPNAYGN TPLHVACYNG 250
QDVVVNELID CGAIVNQKNE KGFTPLHFAA ASTHGALCLE LLVGNGADVN 300
MKSKDGKTPL HMTALHGRFS RSQTIIQSGA VIDCEDKNGN TPLHIAARYG 350
HELLINTLIT SGADTAKRGI HGMFPLHLAA LSGFSDCCRK LLSSGFDIDT 400
PDDFGRTCLH AAAAGGNLEC LNLLLNTGAD FNKKDKFGRS PLHYAAANCN 450
YQCLFALVGS GASVNDLDER GCTPLHYAAT SDTDGKCLEY LLRNDANPGI 500
RDKQGYNAVH YSAAYGHRLC LQLIASETPL DVLMETSGTD MLSDSDNRAT 550
ISPLHLAAYH GHHQALEVLV QSLLDLDVRN SSGRTPLDLA AFKGHVECVD 600
VLINQGASIL VKDYILKRTP IHAAATNGHS ECLRLLIGNA EPQNAVDIQD 650
GNGQTPLMLS VLNGHTDCVY SLLNKGANVD AKDKWGRTAL HRGAVTGHEE 700
CVDALLQHGA KCLLRDSRGR TPIHLSAACG HIGVLGALLQ SAASMDANPA 750
TADNHGYTAL HWACYNGHET CVELLLEQEV FQKTEGNAFS PLHCAVINDN 800
EGAAEMLIDT LGASIVNATD SKGRTPLHAA AFTDHVECLQ LLLSHNAQVN 850
SVDSTGKTPL MMAAENGQTN TVEMLVSSAS AELTLQDNSK NTALHLACSK 900
GHETSALLIL EKITDRNLIN ATNAALQTPL HVAARNGLTM VVQELLGKGA 950
SVLAVDENGY TPALACAPNK DVADCLALIL ATMMPVSSSS PLSSLTFNAI 1000
NRYTNTSKTV SFEALPIMRN EPSSYCSFNN IGGEQEYLYT DVDELNDSDS 1050
ETY 1053
Length:1,053
Mass (Da):112,966
Last modified:May 3, 2011 - v5
Checksum:iBDB4855193364585
GO
Isoform 2 (identifier: O15084-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-154: Missing.

Note: Produced by alternative promoter usage.

Show »
Length:899
Mass (Da):96,161
Checksum:iE06723898ABF4B08
GO
Isoform 3 (identifier: O15084-1) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-9: MAFLKLRDQ → MSRVCIVVLEEVEDESPAFISKLPQENKSLHSPPSGNVLVRY

Show »
Length:1,086
Mass (Da):116,543
Checksum:i47A3F97E5C72F0E8
GO
Isoform 4 (identifier: O15084-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-9: MAFLKLRDQ → MSRVCIVVLEEVEDESPAFISKLPQENKSLHSPPSGNVL

Note: No experimental confirmation available.

Show »
Length:1,083
Mass (Da):116,124
Checksum:i349BC9338F251E08
GO

Sequence cautioni

The sequence BAC86737.1 differs from that shown. Reason: Intron retention.
The sequence AAQ72374.1 differs from that shown. Reason: Frameshift at position 408.
The sequence BAA20833.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 154154Missing in isoform 2. VSP_012433Add
BLAST
Alternative sequencei1 – 99MAFLKLRDQ → MSRVCIVVLEEVEDESPAFI SKLPQENKSLHSPPSGNVLV RY in isoform 3. VSP_041013
Alternative sequencei1 – 99MAFLKLRDQ → MSRVCIVVLEEVEDESPAFI SKLPQENKSLHSPPSGNVL in isoform 4. VSP_041014

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti293 – 2931V → A in AAQ72374. 1 Publication
Sequence conflicti500 – 5001I → V in AAQ72374. 1 Publication
Sequence conflicti500 – 5001I → V in BAC86737. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY367056 mRNA. Translation: AAQ72374.1. Frameshift.
AB002377 mRNA. Translation: BAA20833.2. Different initiation.
AK126888 mRNA. Translation: BAC86737.1. Sequence problems.
AK293770 mRNA. Translation: BAG57186.1.
BC106948 mRNA. Translation: AAI06949.2.
BC113868 mRNA. Translation: AAI13869.1.
BC114476 mRNA. Translation: AAI14477.1.
CCDSiCCDS46769.1. [O15084-3]
RefSeqiNP_001182027.1. NM_001195098.1. [O15084-2]
NP_001182028.1. NM_001195099.1. [O15084-2]
NP_056014.2. NM_015199.3. [O15084-3]
XP_005265053.1. XM_005264996.2. [O15084-4]
UniGeneiHs.335239.

Genome annotation databases

EnsembliENST00000383777; ENSP00000373287; ENSG00000206560. [O15084-1]
ENST00000399451; ENSP00000382379; ENSG00000206560. [O15084-3]
ENST00000412318; ENSP00000397341; ENSG00000206560. [O15084-3]
GeneIDi23243.
KEGGihsa:23243.
UCSCiuc003cai.1. human. [O15084-3]
uc003cal.1. human. [O15084-4]
uc003cam.2. human. [O15084-1]

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY367056 mRNA. Translation: AAQ72374.1 . Frameshift.
AB002377 mRNA. Translation: BAA20833.2 . Different initiation.
AK126888 mRNA. Translation: BAC86737.1 . Sequence problems.
AK293770 mRNA. Translation: BAG57186.1 .
BC106948 mRNA. Translation: AAI06949.2 .
BC113868 mRNA. Translation: AAI13869.1 .
BC114476 mRNA. Translation: AAI14477.1 .
CCDSi CCDS46769.1. [O15084-3 ]
RefSeqi NP_001182027.1. NM_001195098.1. [O15084-2 ]
NP_001182028.1. NM_001195099.1. [O15084-2 ]
NP_056014.2. NM_015199.3. [O15084-3 ]
XP_005265053.1. XM_005264996.2. [O15084-4 ]
UniGenei Hs.335239.

3D structure databases

ProteinModelPortali O15084.
SMRi O15084. Positions 8-1022.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 116847. 58 interactions.
DIPi DIP-27583N.
IntActi O15084. 74 interactions.
MINTi MINT-1150737.
STRINGi 9606.ENSP00000382379.

PTM databases

PhosphoSitei O15084.

Proteomic databases

MaxQBi O15084.
PaxDbi O15084.
PRIDEi O15084.

Protocols and materials databases

DNASUi 23243.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000383777 ; ENSP00000373287 ; ENSG00000206560 . [O15084-1 ]
ENST00000399451 ; ENSP00000382379 ; ENSG00000206560 . [O15084-3 ]
ENST00000412318 ; ENSP00000397341 ; ENSG00000206560 . [O15084-3 ]
GeneIDi 23243.
KEGGi hsa:23243.
UCSCi uc003cai.1. human. [O15084-3 ]
uc003cal.1. human. [O15084-4 ]
uc003cam.2. human. [O15084-1 ]

Organism-specific databases

CTDi 23243.
GeneCardsi GC03M015708.
H-InvDB HIX0003106.
HGNCi HGNC:29024. ANKRD28.
HPAi HPA052925.
MIMi 611122. gene.
neXtProti NX_O15084.
PharmGKBi PA134880251.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0666.
HOGENOMi HOG000033959.
HOVERGENi HBG067697.
InParanoidi O15084.
KOi K15502.
OMAi DMLNDSD.
OrthoDBi EOG7QG436.
TreeFami TF312824.

Miscellaneous databases

GenomeRNAii 23243.
NextBioi 44912.
PROi O15084.
SOURCEi Search...

Gene expression databases

ArrayExpressi O15084.
Bgeei O15084.
CleanExi HS_ANKRD28.
Genevestigatori O15084.

Family and domain databases

Gene3Di 1.25.40.20. 4 hits.
InterProi IPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
[Graphical view ]
Pfami PF00023. Ank. 22 hits.
PF12796. Ank_2. 1 hit.
[Graphical view ]
PRINTSi PR01415. ANKYRIN.
SMARTi SM00248. ANK. 28 hits.
[Graphical view ]
SUPFAMi SSF48403. SSF48403. 4 hits.
PROSITEi PS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 24 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning a new transcript of KIAA0379 protein in testis."
    Lu L., Huang X.Y., Yin L.L., Xu M., Li J.M., Zhou Z.M., Sha J.H.
    Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Tissue: Testis.
  2. "Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro."
    Nagase T., Ishikawa K., Nakajima D., Ohira M., Seki N., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
    DNA Res. 4:141-150(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  3. "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
    Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
    DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: SEQUENCE REVISION.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-767 (ISOFORM 3).
    Tissue: Amygdala and Cerebellum.
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-752 (ISOFORMS 3 AND 4).
  6. "PITK, a PP1 targeting subunit that modulates the phosphorylation of the transcriptional regulator hnRNP K."
    Kwiek N.C., Thacker D.F., Datto M.B., Megosh H.B., Haystead T.A.J.
    Cell. Signal. 18:1769-1778(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH PPP1C AND HNRPK, PHOSPHORYLATION AT SER-1007 AND SER-1011, MUTAGENESIS OF 1007-SER--SER-1011.
  7. "Protein phosphatase 6 regulatory subunits composed of ankyrin repeat domains."
    Stefansson B., Ohama T., Daugherty A.E., Brautigan D.L.
    Biochemistry 47:1442-1451(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH PPP6C; PPP6R1 AND PPP6R3.
  8. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
    Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
    Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  10. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  11. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiANR28_HUMAN
AccessioniPrimary (citable) accession number: O15084
Secondary accession number(s): B4DES5
, Q1WWL4, Q29RW6, Q3B857, Q6ULS0, Q6ZT57
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 20, 2001
Last sequence update: May 3, 2011
Last modified: September 3, 2014
This is version 130 of the entry and version 5 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi