O15084 (ANR28_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 117.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A Short name=PP6-ARS-A Short name=Serine/threonine-protein phosphatase 6 regulatory subunit ARS-A Alternative name(s): Ankyrin repeat domain-containing protein 28 Phosphatase interactor targeting protein hnRNP K Short name=PITK | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1053 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Putative regulatory subunit of protein phosphatase 6 (PP6) that may be involved in the recognition of phosphoprotein substrates. Involved in the PP6-mediated dephosphorylation of NFKBIE opposing its degradation in response to TNF-alpha. Selectively inhibits the phosphatase activity of PPP1C. Targets PPP1C to modulate HNRPK phosphorylation. Ref.6 Ref.7 |
| Subunit structure | Protein phosphatase 6 (PP6) holoenzyme is proposed to be a heterotrimeric complex formed by the catalytic subunit, a SAPS domain-containing subunit (PP6R) and an ankyrin repeat-domain containing regulatory subunit (ARS). Interacts with PPP1C and HNRPK. Interacts with PPP6C, PPP6R1 and PPP6R3. Ref.6 Ref.7 |
| Subcellular location | Nucleus › nucleoplasm. Note: Seems to be excluded from nucleoli. Ref.6 |
| Sequence similarities | Contains 27 ANK repeats. |
| Sequence caution | The sequence AAQ72374.1 differs from that shown. Reason: Frameshift at position 408. The sequence BAA20833.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. The sequence BAC86737.1 differs from that shown. Reason: Intron retention. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative promoter usage Alternative splicing |
| Domain | ANK repeat Repeat |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | nucleoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| PPP6C | O00743 | 3 | EBI-359567,EBI-359751 | |
| PPP6R1 | Q9UPN7 | 4 | EBI-359567,EBI-359745 | |
| PPP6R3 | Q5H9R7 | 3 | EBI-359567,EBI-355498 | |
| TNKS2 | Q9H2K2 | 3 | EBI-359567,EBI-4398527 |
Alternative products
| This entry describes 4 isoforms produced by alternative promoter usage and alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O15084-3) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O15084-2) The sequence of this isoform differs from the canonical sequence as follows: 1-154: Missing. | ||||||
| Note: Produced by alternative promoter usage. | ||||||
| Isoform 3 (identifier: O15084-1) The sequence of this isoform differs from the canonical sequence as follows: 1-9: MAFLKLRDQ → MSRVCIVVLEEVEDESPAFISKLPQENKSLHSPPSGNVLVRY | ||||||
| Isoform 4 (identifier: O15084-4) The sequence of this isoform differs from the canonical sequence as follows: 1-9: MAFLKLRDQ → MSRVCIVVLEEVEDESPAFISKLPQENKSLHSPPSGNVL | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1053 | 1053 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A | PRO_0000066919 | |||||
Regions | |||||||||
| Repeat | 40 – 69 | 30 | ANK 1 | ||||||
| Repeat | 73 – 102 | 30 | ANK 2 | ||||||
| Repeat | 106 – 135 | 30 | ANK 3 | ||||||
| Repeat | 139 – 168 | 30 | ANK 4 | ||||||
| Repeat | 172 – 201 | 30 | ANK 5 | ||||||
| Repeat | 205 – 234 | 30 | ANK 6 | ||||||
| Repeat | 238 – 267 | 30 | ANK 7 | ||||||
| Repeat | 271 – 301 | 31 | ANK 8 | ||||||
| Repeat | 305 – 334 | 30 | ANK 9 | ||||||
| Repeat | 338 – 367 | 30 | ANK 10 | ||||||
| Repeat | 371 – 400 | 30 | ANK 11 | ||||||
| Repeat | 404 – 433 | 30 | ANK 12 | ||||||
| Repeat | 437 – 466 | 30 | ANK 13 | ||||||
| Repeat | 470 – 500 | 31 | ANK 14 | ||||||
| Repeat | 504 – 534 | 31 | ANK 15 | ||||||
| Repeat | 549 – 578 | 30 | ANK 16 | ||||||
| Repeat | 582 – 611 | 30 | ANK 17 | ||||||
| Repeat | 616 – 645 | 30 | ANK 18 | ||||||
| Repeat | 652 – 681 | 30 | ANK 19 | ||||||
| Repeat | 685 – 714 | 30 | ANK 20 | ||||||
| Repeat | 718 – 747 | 30 | ANK 21 | ||||||
| Repeat | 755 – 784 | 30 | ANK 22 | ||||||
| Repeat | 787 – 817 | 31 | ANK 23 | ||||||
| Repeat | 822 – 851 | 30 | ANK 24 | ||||||
| Repeat | 855 – 885 | 31 | ANK 25 | ||||||
| Repeat | 889 – 918 | 30 | ANK 26 | ||||||
| Repeat | 925 – 954 | 30 | ANK 27 | ||||||
Amino acid modifications | |||||||||
| Modified residue | 84 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 1007 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 1011 | 1 | Phosphoserine Ref.6 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 154 | 154 | Missing in isoform 2. | VSP_012433 | |||||
| Alternative sequence | 1 – 9 | 9 | MAFLKLRDQ → MSRVCIVVLEEVEDESPAFI SKLPQENKSLHSPPSGNVLV RY in isoform 3. | VSP_041013 | |||||
| Alternative sequence | 1 – 9 | 9 | MAFLKLRDQ → MSRVCIVVLEEVEDESPAFI SKLPQENKSLHSPPSGNVL in isoform 4. | VSP_041014 | |||||
Experimental info | |||||||||
| Mutagenesis | 1007 – 1011 | 5 | SKTVS → AKTVA: Marked decrease in phosphorylation. Increased PPP1C-binding. No effect on HNRPK-binding. Ref.6 | ||||||
| Sequence conflict | 293 | 1 | V → A in AAQ72374. Ref.1 | ||||||
| Sequence conflict | 500 | 1 | I → V in AAQ72374. Ref.1 | ||||||
| Sequence conflict | 500 | 1 | I → V in BAC86737. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning a new transcript of KIAA0379 protein in testis." Lu L., Huang X.Y., Yin L.L., Xu M., Li J.M., Zhou Z.M., Sha J.H. Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Tissue: Testis. |
| [2] | "Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro." Nagase T., Ishikawa K., Nakajima D., Ohira M., Seki N., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 4:141-150(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [3] | "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones." Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T. DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract] Cited for: SEQUENCE REVISION. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-767 (ISOFORM 3). Tissue: Amygdala and Cerebellum. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-752 (ISOFORMS 3 AND 4). |
| [6] | "PITK, a PP1 targeting subunit that modulates the phosphorylation of the transcriptional regulator hnRNP K." Kwiek N.C., Thacker D.F., Datto M.B., Megosh H.B., Haystead T.A.J. Cell. Signal. 18:1769-1778(2006) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH PPP1C AND HNRPK, PHOSPHORYLATION AT SER-1007 AND SER-1011, MUTAGENESIS OF 1007-SER--SER-1011. |
| [7] | "Protein phosphatase 6 regulatory subunits composed of ankyrin repeat domains." Stefansson B., Ohama T., Daugherty A.E., Brautigan D.L. Biochemistry 47:1442-1451(2008) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH PPP6C; PPP6R1 AND PPP6R3. |
| [8] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [9] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [10] | "Large-scale proteomics analysis of the human kinome." Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G., Mann M., Daub H. Mol. Cell. Proteomics 8:1751-1764(2009) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [11] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY367056 mRNA. Translation: AAQ72374.1. Frameshift. AB002377 mRNA. Translation: BAA20833.2. Different initiation. AK126888 mRNA. Translation: BAC86737.1. Sequence problems. AK293770 mRNA. Translation: BAG57186.1. BC106948 mRNA. Translation: AAI06949.2. BC113868 mRNA. Translation: AAI13869.1. BC114476 mRNA. Translation: AAI14477.1. |
| IPI | IPI00477505. IPI00514769. IPI00981632. IPI01009712. |
| RefSeq | NP_001182027.1. NM_001195098.1. NP_001182028.1. NM_001195099.1. NP_056014.2. NM_015199.3. |
| UniGene | Hs.335239. |
3D structure databases | |
| ProteinModelPortal | O15084. |
| SMR | O15084. Positions 8-1022. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-27583N. |
| IntAct | O15084. 32 interactions. |
| MINT | MINT-1150737. |
| STRING | 9606.ENSP00000382379. |
PTM databases | |
| PhosphoSite | O15084. |
Proteomic databases | |
| PaxDb | O15084. |
| PRIDE | O15084. |
Protocols and materials databases | |
| DNASU | 23243. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000383777; ENSP00000373287; ENSG00000206560. ENST00000399451; ENSP00000382379; ENSG00000206560. ENST00000412318; ENSP00000397341; ENSG00000206560. |
| GeneID | 23243. |
| KEGG | hsa:23243. |
| UCSC | uc003cai.1. human. uc003cal.1. human. uc003cam.2. human. |
Organism-specific databases | |
| CTD | 23243. |
| GeneCards | GC03M015708. |
| H-InvDB | HIX0003106. |
| HGNC | HGNC:29024. ANKRD28. |
| MIM | 611122. gene. |
| neXtProt | NX_O15084. |
| PharmGKB | PA134880251. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0666. |
| HOGENOM | HOG000033959. |
| HOVERGEN | HBG067697. |
| InParanoid | O15084. |
| KO | K15502. |
| OMA | DMLNDSD. |
| OrthoDB | EOG4NCMCR. |
Gene expression databases | |
| ArrayExpress | O15084. |
| Bgee | O15084. |
| CleanEx | HS_ANKRD28. |
| Genevestigator | O15084. |
| GermOnline | ENSG00000206560. Homo sapiens. |
Family and domain databases | |
| Gene3D | 1.25.40.20. 4 hits. |
| InterPro | IPR002110. Ankyrin_rpt. IPR020683. Ankyrin_rpt-contain_dom. [Graphical view] |
| Pfam | PF00023. Ank. 22 hits. PF12796. Ank_2. 1 hit. [Graphical view] |
| PRINTS | PR01415. ANKYRIN. |
| SMART | SM00248. ANK. 28 hits. [Graphical view] |
| SUPFAM | SSF48403. ANK. 3 hits. |
| PROSITE | PS50297. ANK_REP_REGION. 1 hit. PS50088. ANK_REPEAT. 24 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 23243. |
| NextBio | 44912. |
| SOURCE | Search... |
Entry information
| Entry name | ANR28_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O15084 Secondary accession number(s): B4DES5 Q6ZT57 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
