Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Guanine nucleotide exchange factor DBS

Gene

MCF2L

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Guanine nucleotide exchange factor that catalyzes guanine nucleotide exchange on RHOA and CDC42, and thereby contributes to the regulation of RHOA and CDC42 signaling pathways (By similarity). Seems to lack activity with RAC1. Becomes activated and highly tumorigenic by truncation of the N-terminus (By similarity). Isoform 5 activates CDC42 (PubMed:15157669).By similarity1 Publication
Isoform 3: Does not catalyze guanine nucleotide exchange on CDC42 (PubMed:15157669).1 Publication

GO - Molecular functioni

  • guanyl-nucleotide exchange factor activity Source: Reactome
  • phosphatidylinositol binding Source: UniProtKB
  • Rho guanyl-nucleotide exchange factor activity Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Guanine-nucleotide releasing factor

Keywords - Ligandi

Lipid-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000126217-MONOMER.
ReactomeiR-HSA-193648. NRAGE signals death through JNK.
R-HSA-194840. Rho GTPase cycle.
R-HSA-416482. G alpha (12/13) signalling events.

Chemistry databases

SwissLipidsiSLP:000001547.

Names & Taxonomyi

Protein namesi
Recommended name:
Guanine nucleotide exchange factor DBS
Alternative name(s):
DBL's big sister
MCF2-transforming sequence-like protein
Gene namesi
Name:MCF2L
Synonyms:KIAA0362, OST1 Publication
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 13

Organism-specific databases

HGNCiHGNC:14576. MCF2L.

Subcellular locationi

Isoform 5 :
  • Cytoplasm 1 Publication
  • Cell membrane 1 Publication; Peripheral membrane protein 1 Publication; Cytoplasmic side 1 Publication
Isoform 3 :
  • Cytoplasm 1 Publication
  • Endomembrane system 1 Publication

  • Note: Interaction with membranes enriched in phosphoinositides is mediated by the CRAL-TRIO domain.1 Publication
  • Cytoplasm By similarity
  • Cell membrane By similarity; Peripheral membrane protein By similarity; Cytoplasmic side By similarity

GO - Cellular componenti

  • cytoplasm Source: UniProtKB
  • cytosol Source: Reactome
  • endomembrane system Source: UniProtKB
  • extracellular space Source: UniProtKB
  • extrinsic component of cytoplasmic side of plasma membrane Source: UniProtKB
  • plasma membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane

Pathology & Biotechi

Keywords - Diseasei

Proto-oncogene

Organism-specific databases

DisGeNETi23263.
OpenTargetsiENSG00000126217.
PharmGKBiPA30685.

Polymorphism and mutation databases

BioMutaiMCF2L.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000809351 – 1137Guanine nucleotide exchange factor DBSAdd BLAST1137

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei457PhosphoserineBy similarity1
Modified residuei480PhosphoserineBy similarity1
Modified residuei620PhosphoserineBy similarity1
Modified residuei1033PhosphoserineBy similarity1
Modified residuei1034PhosphoserineBy similarity1
Modified residuei1041PhosphoserineBy similarity1
Modified residuei1042PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiO15068.
PaxDbiO15068.
PeptideAtlasiO15068.
PRIDEiO15068.

PTM databases

iPTMnetiO15068.
PhosphoSitePlusiO15068.

Expressioni

Gene expression databases

BgeeiENSG00000126217.
ExpressionAtlasiO15068. baseline and differential.
GenevisibleiO15068. HS.

Organism-specific databases

HPAiHPA008614.

Interactioni

Subunit structurei

Interacts with GTP-bound RAC1 (By similarity). Interacts with CDC42 (PubMed:15157669). Interacts with RHOA. Interacts with CCPG1, which results in specific inhibition of its exchange activity toward RHOA, but does not affect its activity on CDC42 (By similarity).By similarity1 Publication

Protein-protein interaction databases

BioGridi116865. 8 interactors.
IntActiO15068. 6 interactors.
STRINGi9606.ENSP00000440374.

Structurei

3D structure databases

ProteinModelPortaliO15068.
SMRiO15068.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini52 – 224CRAL-TRIOPROSITE-ProRule annotationAdd BLAST173
Repeati351 – 456SpectrinAdd BLAST106
Domaini631 – 811DHPROSITE-ProRule annotationAdd BLAST181
Domaini829 – 945PHPROSITE-ProRule annotationAdd BLAST117
Domaini1055 – 1116SH3PROSITE-ProRule annotationAdd BLAST62

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili503 – 529Sequence analysisAdd BLAST27

Domaini

The CRAL-TRIO domain mediates interaction with various inositol phospholipids, such as phosphatidylinositol 3-phosphate (PI3P), phosphatidylinositol 4-phosphate (PI4P) and phosphatidylinositol 5-phosphate (PI5P).1 Publication
The DH domain is involved in interaction with CCPG1.By similarity

Sequence similaritiesi

Belongs to the MCF2 family.Curated
Contains 1 CRAL-TRIO domain.PROSITE-ProRule annotation
Contains 1 DH (DBL-homology) domain.PROSITE-ProRule annotation
Contains 1 PH domain.PROSITE-ProRule annotation
Contains 1 SH3 domain.PROSITE-ProRule annotation
Contains 1 spectrin repeat.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IPNH. Eukaryota.
ENOG410XNYV. LUCA.
GeneTreeiENSGT00760000119030.
HOGENOMiHOG000231361.
HOVERGENiHBG062385.
InParanoidiO15068.
KOiK20685.
OMAiERMEDFQ.
OrthoDBiEOG091G04A2.
PhylomeDBiO15068.
TreeFamiTF318080.

Family and domain databases

Gene3Di1.20.900.10. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR001251. CRAL-TRIO_dom.
IPR000219. DH-domain.
IPR001331. GDS_CDC24_CS.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR011511. SH3_2.
IPR001452. SH3_domain.
IPR018159. Spectrin/alpha-actinin.
IPR002017. Spectrin_repeat.
[Graphical view]
PfamiPF13716. CRAL_TRIO_2. 1 hit.
PF00169. PH. 1 hit.
PF00621. RhoGEF. 1 hit.
PF07653. SH3_2. 1 hit.
PF00435. Spectrin. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
SM00325. RhoGEF. 1 hit.
SM00516. SEC14. 1 hit.
SM00326. SH3. 1 hit.
SM00150. SPEC. 1 hit.
[Graphical view]
SUPFAMiSSF48065. SSF48065. 1 hit.
SSF50044. SSF50044. 1 hit.
SSF50729. SSF50729. 1 hit.
SSF52087. SSF52087. 1 hit.
PROSITEiPS50191. CRAL_TRIO. 1 hit.
PS00741. DH_1. 1 hit.
PS50010. DH_2. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
PS50002. SH3. 1 hit.
[Graphical view]

Sequences (9)i

Sequence statusi: Complete.

This entry describes 9 isoformsi produced by alternative splicing. AlignAdd to basket

Note: A number of isoforms are produced. According to EST sequences. Experimental confirmation may be lacking for some isoforms.
Isoform 1 (identifier: O15068-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFDCWRFILC KRPGSNSYSS PQRPNEAKKE ETDHQIDVSD VIRLVQDTPE
60 70 80 90 100
ATAMATDEIM HQDIVPLCAA DIQDQLKKRF AYLSGGRGQD GSPVITFPDY
110 120 130 140 150
PAFSEIPDKE FQNVMTYLTS IPSLQDAGIG FILVIDRRRD KWTSVKASVL
160 170 180 190 200
RIAASFPANL QLVLVLRPTG FFQRTLSDIA FKFNRDDFKM KVPVIMLSSV
210 220 230 240 250
PDLHGYIDKS QLTEDLGGTL DYCHSRWLCQ RTAIESFALM VKQTAQMLQS
260 270 280 290 300
FGTELAETEL PNDVQSTSSV LCAHTEKKDK AKEDLRLALK EGHSVLESLR
310 320 330 340 350
ELQAEGSEPS VNQDQLDNQA TVQRLLAQLN ETEAAFDEFW AKHQQKLEQC
360 370 380 390 400
LQLRHFEQGF REVKAILDAA SQKIATFTDI GNSLAHVEHL LRDLASFEEK
410 420 430 440 450
SGVAVERARA LSLDGEQLIG NKHYAVDSIR PKCQELRHLC DQFSAEIARR
460 470 480 490 500
RGLLSKSLEL HRRLETSMKW CDEGIYLLAS QPVDKCQSQD GAEAALQEIE
510 520 530 540 550
KFLETGAENK IQELNAIYKE YESILNQDLM EHVRKVFQKQ ASMEEVFHRR
560 570 580 590 600
QASLKKLAAR QTRPVQPVAP RPEALAKSPC PSPGIRRGSE NSSSEGGALR
610 620 630 640 650
RGPYRRAKSE MSESRQGRGS AGEEEESLAI LRRHVMSELL DTERAYVEEL
660 670 680 690 700
LCVLEGYAAE MDNPLMAHLL STGLHNKKDV LFGNMEEIYH FHNRIFLREL
710 720 730 740 750
ENYTDCPELV GRCFLERMED FQIYEKYCQN KPRSESLWRQ CSDCPFFQEC
760 770 780 790 800
QRKLDHKLSL DSYLLKPVQR ITKYQLLLKE MLKYSRNCEG AEDLQEALSS
810 820 830 840 850
ILGILKAVND SMHLIAITGY DGNLGDLGKL LMQGSFSVWT DHKRGHTKVK
860 870 880 890 900
ELARFKPMQR HLFLHEKAVL FCKKREENGE GYEKAPSYSY KQSLNMAAVG
910 920 930 940 950
ITENVKGDAK KFEIWYNARE EVYIVQAPTP EIKAAWVNEI RKVLTSQLQA
960 970 980 990 1000
CREASQHRAL EQSQSLPLPA PTSTSPSRGN SRNIKKLEER KTDPLSLEGY
1010 1020 1030 1040 1050
VSSAPLTKPP EKGKGWSKTS HSLEAPEDDG GWSSAEEQIN SSDAEEDGGL
1060 1070 1080 1090 1100
GPKKLVPGKY TVVADHEKGG PDALRVRSGD VVELVQEGDE GLWYVRDPTT
1110 1120 1130
GKEGWVPASS LSVRLGPSGS AQCLSSSGKA HVPRAHP
Note: Gene prediction based on similarity to mouse ortholog.
Length:1,137
Mass (Da):128,109
Last modified:June 12, 2007 - v2
Checksum:iB2830890A69C8377
GO
Isoform 2 (identifier: O15068-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-56: MFDCWRFILC...DTPEATAMAT → MPLRGGAGPS...SFYTCHGAAG
     1094-1137: Missing.

Show »
Length:1,096
Mass (Da):122,895
Checksum:i31D641D6773111D8
GO
Isoform 3 (identifier: O15068-3) [UniParc]FASTAAdd to basket
Also known as: Ost-II1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-56: MFDCWRFILC...DTPEATAMAT → MAEKGASRGTLRRLWSLPRRRRGTAGRSRP
     1094-1137: Missing.

Show »
Length:1,067
Mass (Da):120,618
Checksum:i2F3F56C9605F5065
GO
Isoform 4 (identifier: O15068-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-56: MFDCWRFILC...DTPEATAMAT → MTVRRLSLLCRDLWALWLLLKAGA
     1015-1016: GW → EP
     1017-1137: Missing.

Show »
Length:984
Mass (Da):111,862
Checksum:i50B50DCB7CCF0AE1
GO
Isoform 5 (identifier: O15068-5) [UniParc]FASTAAdd to basket
Also known as: Ost-I1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-189: Missing.
     1094-1137: Missing.

Show »
Length:904
Mass (Da):102,175
Checksum:i563456F50829E587
GO
Isoform 6 (identifier: O15068-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-56: MFDCWRFILC...DTPEATAMAT → MRFWLRTEEMALEEMVQRLNAVSKHT

Show »
Length:1,107
Mass (Da):124,902
Checksum:iEA759E18895EA8A7
GO
Isoform 7 (identifier: O15068-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-56: MFDCWRFILC...DTPEATAMAT → MRFWLRTEEMALEEMVQRLNAVSKHT
     1128-1137: GKAHVPRAHP → ESSPGSAVLSNSSSCSEGGQAPFSDLQG

Note: No experimental confirmation available.
Show »
Length:1,125
Mass (Da):126,518
Checksum:iAE637064E50647B0
GO
Isoform 8 (identifier: O15068-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-56: MFDCWRFILC...DTPEATAMAT → MGDGKAVRISVAEMKSYYLYSEWCSWLLSVAE

Show »
Length:1,113
Mass (Da):125,368
Checksum:i9AE182A51542CDE4
GO
Isoform 9 (identifier: O15068-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-56: MFDCWRFILC...DTPEATAMAT → MTVRRLSLLCRDLWALWLLLKAGA
     1128-1137: GKAHVPRAHP → ESSPGSAVLSNSSSCSEGGQAPFSDLQG

Note: No experimental confirmation available.
Show »
Length:1,123
Mass (Da):126,111
Checksum:i3BB27FD875BF70B5
GO

Sequence cautioni

The sequence BAA20817 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti580C → S in BAG58097 (PubMed:14702039).Curated1
Sequence conflicti660E → G in BAG58097 (PubMed:14702039).Curated1
Sequence conflicti721F → L in BAG58528 (PubMed:14702039).Curated1
Sequence conflicti1052P → L in BAG58528 (PubMed:14702039).Curated1
Sequence conflicti1123C → R in BAG58097 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0261191 – 189Missing in isoform 5. 1 PublicationAdd BLAST189
Alternative sequenceiVSP_0261201 – 56MFDCW…TAMAT → MPLRGGAGPSPASHGPTHGP SDPRTCLPGRGAGGMRPHGR GALGCCGLCSFYTCHGAAG in isoform 2. 1 PublicationAdd BLAST56
Alternative sequenceiVSP_0261211 – 56MFDCW…TAMAT → MAEKGASRGTLRRLWSLPRR RRGTAGRSRP in isoform 3. 1 PublicationAdd BLAST56
Alternative sequenceiVSP_0261221 – 56MFDCW…TAMAT → MTVRRLSLLCRDLWALWLLL KAGA in isoform 4 and isoform 9. 2 PublicationsAdd BLAST56
Alternative sequenceiVSP_0261231 – 56MFDCW…TAMAT → MRFWLRTEEMALEEMVQRLN AVSKHT in isoform 6 and isoform 7. 1 PublicationAdd BLAST56
Alternative sequenceiVSP_0261241 – 56MFDCW…TAMAT → MGDGKAVRISVAEMKSYYLY SEWCSWLLSVAE in isoform 8. CuratedAdd BLAST56
Alternative sequenceiVSP_0261261015 – 1016GW → EP in isoform 4. 1 Publication2
Alternative sequenceiVSP_0261271017 – 1137Missing in isoform 4. 1 PublicationAdd BLAST121
Alternative sequenceiVSP_0261281094 – 1137Missing in isoform 2, isoform 3 and isoform 5. 2 PublicationsAdd BLAST44
Alternative sequenceiVSP_0390371128 – 1137GKAHVPRAHP → ESSPGSAVLSNSSSCSEGGQ APFSDLQG in isoform 7 and isoform 9. 1 Publication10

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB116074 mRNA. Translation: BAD08351.1.
AB116075 mRNA. Translation: BAD08352.1.
AB002360 mRNA. Translation: BAA20817.1. Different initiation.
AK295047 mRNA. Translation: BAG58097.1.
AK295670 mRNA. Translation: BAG58528.1.
AL356740 Genomic DNA. No translation available.
AL596093 Genomic DNA. No translation available.
AL162454 Genomic DNA. No translation available.
AL137002 Genomic DNA. No translation available.
BC011853 mRNA. Translation: AAH11853.1.
BC020208 mRNA. Translation: AAH20208.1.
CCDSiCCDS45070.2. [O15068-9]
CCDS81782.1. [O15068-4]
CCDS9527.3. [O15068-10]
RefSeqiNP_001106203.2. NM_001112732.2. [O15068-9]
NP_001307744.1. NM_001320815.1.
NP_001307745.1. NM_001320816.1.
NP_001307746.1. NM_001320817.1. [O15068-4]
NP_079255.4. NM_024979.4. [O15068-10]
UniGeneiHs.170422.

Genome annotation databases

EnsembliENST00000375597; ENSP00000364747; ENSG00000126217. [O15068-4]
ENST00000375604; ENSP00000364754; ENSG00000126217. [O15068-10]
ENST00000375608; ENSP00000364758; ENSG00000126217. [O15068-1]
ENST00000397030; ENSP00000380225; ENSG00000126217. [O15068-2]
ENST00000421756; ENSP00000397285; ENSG00000126217. [O15068-3]
ENST00000535094; ENSP00000440374; ENSG00000126217. [O15068-9]
GeneIDi23263.
KEGGihsa:23263.
UCSCiuc001vss.5. human. [O15068-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB116074 mRNA. Translation: BAD08351.1.
AB116075 mRNA. Translation: BAD08352.1.
AB002360 mRNA. Translation: BAA20817.1. Different initiation.
AK295047 mRNA. Translation: BAG58097.1.
AK295670 mRNA. Translation: BAG58528.1.
AL356740 Genomic DNA. No translation available.
AL596093 Genomic DNA. No translation available.
AL162454 Genomic DNA. No translation available.
AL137002 Genomic DNA. No translation available.
BC011853 mRNA. Translation: AAH11853.1.
BC020208 mRNA. Translation: AAH20208.1.
CCDSiCCDS45070.2. [O15068-9]
CCDS81782.1. [O15068-4]
CCDS9527.3. [O15068-10]
RefSeqiNP_001106203.2. NM_001112732.2. [O15068-9]
NP_001307744.1. NM_001320815.1.
NP_001307745.1. NM_001320816.1.
NP_001307746.1. NM_001320817.1. [O15068-4]
NP_079255.4. NM_024979.4. [O15068-10]
UniGeneiHs.170422.

3D structure databases

ProteinModelPortaliO15068.
SMRiO15068.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116865. 8 interactors.
IntActiO15068. 6 interactors.
STRINGi9606.ENSP00000440374.

Chemistry databases

SwissLipidsiSLP:000001547.

PTM databases

iPTMnetiO15068.
PhosphoSitePlusiO15068.

Polymorphism and mutation databases

BioMutaiMCF2L.

Proteomic databases

MaxQBiO15068.
PaxDbiO15068.
PeptideAtlasiO15068.
PRIDEiO15068.

Protocols and materials databases

DNASUi23263.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000375597; ENSP00000364747; ENSG00000126217. [O15068-4]
ENST00000375604; ENSP00000364754; ENSG00000126217. [O15068-10]
ENST00000375608; ENSP00000364758; ENSG00000126217. [O15068-1]
ENST00000397030; ENSP00000380225; ENSG00000126217. [O15068-2]
ENST00000421756; ENSP00000397285; ENSG00000126217. [O15068-3]
ENST00000535094; ENSP00000440374; ENSG00000126217. [O15068-9]
GeneIDi23263.
KEGGihsa:23263.
UCSCiuc001vss.5. human. [O15068-1]

Organism-specific databases

CTDi23263.
DisGeNETi23263.
GeneCardsiMCF2L.
HGNCiHGNC:14576. MCF2L.
HPAiHPA008614.
MIMi609499. gene.
neXtProtiNX_O15068.
OpenTargetsiENSG00000126217.
PharmGKBiPA30685.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IPNH. Eukaryota.
ENOG410XNYV. LUCA.
GeneTreeiENSGT00760000119030.
HOGENOMiHOG000231361.
HOVERGENiHBG062385.
InParanoidiO15068.
KOiK20685.
OMAiERMEDFQ.
OrthoDBiEOG091G04A2.
PhylomeDBiO15068.
TreeFamiTF318080.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000126217-MONOMER.
ReactomeiR-HSA-193648. NRAGE signals death through JNK.
R-HSA-194840. Rho GTPase cycle.
R-HSA-416482. G alpha (12/13) signalling events.

Miscellaneous databases

ChiTaRSiMCF2L. human.
GeneWikiiMCF2L.
GenomeRNAii23263.
PROiO15068.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000126217.
ExpressionAtlasiO15068. baseline and differential.
GenevisibleiO15068. HS.

Family and domain databases

Gene3Di1.20.900.10. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR001251. CRAL-TRIO_dom.
IPR000219. DH-domain.
IPR001331. GDS_CDC24_CS.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR011511. SH3_2.
IPR001452. SH3_domain.
IPR018159. Spectrin/alpha-actinin.
IPR002017. Spectrin_repeat.
[Graphical view]
PfamiPF13716. CRAL_TRIO_2. 1 hit.
PF00169. PH. 1 hit.
PF00621. RhoGEF. 1 hit.
PF07653. SH3_2. 1 hit.
PF00435. Spectrin. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
SM00325. RhoGEF. 1 hit.
SM00516. SEC14. 1 hit.
SM00326. SH3. 1 hit.
SM00150. SPEC. 1 hit.
[Graphical view]
SUPFAMiSSF48065. SSF48065. 1 hit.
SSF50044. SSF50044. 1 hit.
SSF50729. SSF50729. 1 hit.
SSF52087. SSF52087. 1 hit.
PROSITEiPS50191. CRAL_TRIO. 1 hit.
PS00741. DH_1. 1 hit.
PS50010. DH_2. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
PS50002. SH3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiMCF2L_HUMAN
AccessioniPrimary (citable) accession number: O15068
Secondary accession number(s): A2A2X1
, A2A2X2, A2A3G6, A2A3G8, B4DHD6, B4DIL6, E9PDN8, Q5JU56, Q5VXT1, Q6ZWD4, Q765G8, Q765G9, Q8N679
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: June 12, 2007
Last modified: November 2, 2016
This is version 160 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 13
    Human chromosome 13: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.