Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Guanine nucleotide exchange factor DBS

Gene

MCF2L

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Guanine nucleotide exchange factor that catalyzes guanine nucleotide exchange on RHOA and CDC42, and thereby contributes to the regulation of RHOA and CDC42 signaling pathways (By similarity). Seems to lack activity with RAC1. Becomes activated and highly tumorigenic by truncation of the N-terminus (By similarity). Isoform 5 activates CDC42 (PubMed:15157669).By similarity1 Publication
Isoform 3: Does not catalyze guanine nucleotide exchange on CDC42 (PubMed:15157669).1 Publication

GO - Molecular functioni

  • guanyl-nucleotide exchange factor activity Source: Reactome
  • phosphatidylinositol binding Source: UniProtKB
  • Rho guanyl-nucleotide exchange factor activity Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Guanine-nucleotide releasing factor

Keywords - Ligandi

Lipid-binding

Enzyme and pathway databases

ReactomeiR-HSA-193648. NRAGE signals death through JNK.
R-HSA-194840. Rho GTPase cycle.
R-HSA-416482. G alpha (12/13) signalling events.

Chemistry

SwissLipidsiSLP:000001547.

Names & Taxonomyi

Protein namesi
Recommended name:
Guanine nucleotide exchange factor DBS
Alternative name(s):
DBL's big sister
MCF2-transforming sequence-like protein
Gene namesi
Name:MCF2L
Synonyms:KIAA0362, OST1 Publication
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 13

Organism-specific databases

HGNCiHGNC:14576. MCF2L.

Subcellular locationi

Isoform 5 :
  • Cytoplasm 1 Publication
  • Cell membrane 1 Publication; Peripheral membrane protein 1 Publication; Cytoplasmic side 1 Publication
Isoform 3 :
  • Cytoplasm 1 Publication
  • Endomembrane system 1 Publication

  • Note: Interaction with membranes enriched in phosphoinositides is mediated by the CRAL-TRIO domain.1 Publication
  • Cytoplasm By similarity
  • Cell membrane By similarity; Peripheral membrane protein By similarity; Cytoplasmic side By similarity

GO - Cellular componenti

  • cytoplasm Source: UniProtKB
  • cytosol Source: Reactome
  • endomembrane system Source: UniProtKB
  • extracellular space Source: UniProtKB
  • extrinsic component of cytoplasmic side of plasma membrane Source: UniProtKB
  • plasma membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane

Pathology & Biotechi

Keywords - Diseasei

Proto-oncogene

Organism-specific databases

PharmGKBiPA30685.

Polymorphism and mutation databases

BioMutaiMCF2L.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 11371137Guanine nucleotide exchange factor DBSPRO_0000080935Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei457 – 4571PhosphoserineBy similarity
Modified residuei480 – 4801PhosphoserineBy similarity
Modified residuei620 – 6201PhosphoserineBy similarity
Modified residuei1033 – 10331PhosphoserineBy similarity
Modified residuei1034 – 10341PhosphoserineBy similarity
Modified residuei1041 – 10411PhosphoserineBy similarity
Modified residuei1042 – 10421PhosphoserineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiO15068.
PaxDbiO15068.
PRIDEiO15068.

PTM databases

iPTMnetiO15068.
PhosphoSiteiO15068.

Expressioni

Gene expression databases

BgeeiO15068.
ExpressionAtlasiO15068. baseline and differential.
GenevisibleiO15068. HS.

Organism-specific databases

HPAiHPA008614.

Interactioni

Subunit structurei

Interacts with GTP-bound RAC1 (By similarity). Interacts with CDC42 (PubMed:15157669). Interacts with RHOA. Interacts with CCPG1, which results in specific inhibition of its exchange activity toward RHOA, but does not affect its activity on CDC42 (By similarity).By similarity1 Publication

Protein-protein interaction databases

BioGridi116865. 8 interactions.
IntActiO15068. 6 interactions.
STRINGi9606.ENSP00000440374.

Structurei

3D structure databases

ProteinModelPortaliO15068.
SMRiO15068. Positions 623-964.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini52 – 224173CRAL-TRIOPROSITE-ProRule annotationAdd
BLAST
Repeati351 – 456106SpectrinAdd
BLAST
Domaini631 – 811181DHPROSITE-ProRule annotationAdd
BLAST
Domaini829 – 945117PHPROSITE-ProRule annotationAdd
BLAST
Domaini1055 – 111662SH3PROSITE-ProRule annotationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili503 – 52927Sequence analysisAdd
BLAST

Domaini

The CRAL-TRIO domain mediates interaction with various inositol phospholipids, such as phosphatidylinositol 3-phosphate (PI3P), phosphatidylinositol 4-phosphate (PI4P) and phosphatidylinositol 5-phosphate (PI5P).1 Publication
The DH domain is involved in interaction with CCPG1.By similarity

Sequence similaritiesi

Belongs to the MCF2 family.Curated
Contains 1 CRAL-TRIO domain.PROSITE-ProRule annotation
Contains 1 DH (DBL-homology) domain.PROSITE-ProRule annotation
Contains 1 PH domain.PROSITE-ProRule annotation
Contains 1 SH3 domain.PROSITE-ProRule annotation
Contains 1 spectrin repeat.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IPNH. Eukaryota.
ENOG410XNYV. LUCA.
GeneTreeiENSGT00760000119030.
HOGENOMiHOG000231361.
HOVERGENiHBG062385.
InParanoidiO15068.
OMAiERMEDFQ.
OrthoDBiEOG7KQ210.
PhylomeDBiO15068.
TreeFamiTF318080.

Family and domain databases

Gene3Di1.20.900.10. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR001251. CRAL-TRIO_dom.
IPR000219. DH-domain.
IPR001331. GDS_CDC24_CS.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR011511. SH3_2.
IPR001452. SH3_domain.
IPR018159. Spectrin/alpha-actinin.
IPR002017. Spectrin_repeat.
[Graphical view]
PfamiPF13716. CRAL_TRIO_2. 1 hit.
PF00169. PH. 1 hit.
PF00621. RhoGEF. 1 hit.
PF07653. SH3_2. 1 hit.
PF00435. Spectrin. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
SM00325. RhoGEF. 1 hit.
SM00516. SEC14. 1 hit.
SM00326. SH3. 1 hit.
SM00150. SPEC. 1 hit.
[Graphical view]
SUPFAMiSSF48065. SSF48065. 1 hit.
SSF50044. SSF50044. 1 hit.
SSF50729. SSF50729. 1 hit.
SSF52087. SSF52087. 1 hit.
PROSITEiPS50191. CRAL_TRIO. 1 hit.
PS00741. DH_1. 1 hit.
PS50010. DH_2. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
PS50002. SH3. 1 hit.
[Graphical view]

Sequences (9)i

Sequence statusi: Complete.

This entry describes 9 isoformsi produced by alternative splicing. AlignAdd to basket

Note: A number of isoforms are produced. According to EST sequences. Experimental confirmation may be lacking for some isoforms.

Isoform 1 (identifier: O15068-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFDCWRFILC KRPGSNSYSS PQRPNEAKKE ETDHQIDVSD VIRLVQDTPE
60 70 80 90 100
ATAMATDEIM HQDIVPLCAA DIQDQLKKRF AYLSGGRGQD GSPVITFPDY
110 120 130 140 150
PAFSEIPDKE FQNVMTYLTS IPSLQDAGIG FILVIDRRRD KWTSVKASVL
160 170 180 190 200
RIAASFPANL QLVLVLRPTG FFQRTLSDIA FKFNRDDFKM KVPVIMLSSV
210 220 230 240 250
PDLHGYIDKS QLTEDLGGTL DYCHSRWLCQ RTAIESFALM VKQTAQMLQS
260 270 280 290 300
FGTELAETEL PNDVQSTSSV LCAHTEKKDK AKEDLRLALK EGHSVLESLR
310 320 330 340 350
ELQAEGSEPS VNQDQLDNQA TVQRLLAQLN ETEAAFDEFW AKHQQKLEQC
360 370 380 390 400
LQLRHFEQGF REVKAILDAA SQKIATFTDI GNSLAHVEHL LRDLASFEEK
410 420 430 440 450
SGVAVERARA LSLDGEQLIG NKHYAVDSIR PKCQELRHLC DQFSAEIARR
460 470 480 490 500
RGLLSKSLEL HRRLETSMKW CDEGIYLLAS QPVDKCQSQD GAEAALQEIE
510 520 530 540 550
KFLETGAENK IQELNAIYKE YESILNQDLM EHVRKVFQKQ ASMEEVFHRR
560 570 580 590 600
QASLKKLAAR QTRPVQPVAP RPEALAKSPC PSPGIRRGSE NSSSEGGALR
610 620 630 640 650
RGPYRRAKSE MSESRQGRGS AGEEEESLAI LRRHVMSELL DTERAYVEEL
660 670 680 690 700
LCVLEGYAAE MDNPLMAHLL STGLHNKKDV LFGNMEEIYH FHNRIFLREL
710 720 730 740 750
ENYTDCPELV GRCFLERMED FQIYEKYCQN KPRSESLWRQ CSDCPFFQEC
760 770 780 790 800
QRKLDHKLSL DSYLLKPVQR ITKYQLLLKE MLKYSRNCEG AEDLQEALSS
810 820 830 840 850
ILGILKAVND SMHLIAITGY DGNLGDLGKL LMQGSFSVWT DHKRGHTKVK
860 870 880 890 900
ELARFKPMQR HLFLHEKAVL FCKKREENGE GYEKAPSYSY KQSLNMAAVG
910 920 930 940 950
ITENVKGDAK KFEIWYNARE EVYIVQAPTP EIKAAWVNEI RKVLTSQLQA
960 970 980 990 1000
CREASQHRAL EQSQSLPLPA PTSTSPSRGN SRNIKKLEER KTDPLSLEGY
1010 1020 1030 1040 1050
VSSAPLTKPP EKGKGWSKTS HSLEAPEDDG GWSSAEEQIN SSDAEEDGGL
1060 1070 1080 1090 1100
GPKKLVPGKY TVVADHEKGG PDALRVRSGD VVELVQEGDE GLWYVRDPTT
1110 1120 1130
GKEGWVPASS LSVRLGPSGS AQCLSSSGKA HVPRAHP
Note: Gene prediction based on similarity to mouse ortholog.
Length:1,137
Mass (Da):128,109
Last modified:June 12, 2007 - v2
Checksum:iB2830890A69C8377
GO
Isoform 2 (identifier: O15068-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-56: MFDCWRFILC...DTPEATAMAT → MPLRGGAGPS...SFYTCHGAAG
     1094-1137: Missing.

Show »
Length:1,096
Mass (Da):122,895
Checksum:i31D641D6773111D8
GO
Isoform 3 (identifier: O15068-3) [UniParc]FASTAAdd to basket

Also known as: Ost-II1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-56: MFDCWRFILC...DTPEATAMAT → MAEKGASRGTLRRLWSLPRRRRGTAGRSRP
     1094-1137: Missing.

Show »
Length:1,067
Mass (Da):120,618
Checksum:i2F3F56C9605F5065
GO
Isoform 4 (identifier: O15068-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-56: MFDCWRFILC...DTPEATAMAT → MTVRRLSLLCRDLWALWLLLKAGA
     1015-1016: GW → EP
     1017-1137: Missing.

Show »
Length:984
Mass (Da):111,862
Checksum:i50B50DCB7CCF0AE1
GO
Isoform 5 (identifier: O15068-5) [UniParc]FASTAAdd to basket

Also known as: Ost-I1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-189: Missing.
     1094-1137: Missing.

Show »
Length:904
Mass (Da):102,175
Checksum:i563456F50829E587
GO
Isoform 6 (identifier: O15068-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-56: MFDCWRFILC...DTPEATAMAT → MRFWLRTEEMALEEMVQRLNAVSKHT

Show »
Length:1,107
Mass (Da):124,902
Checksum:iEA759E18895EA8A7
GO
Isoform 7 (identifier: O15068-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-56: MFDCWRFILC...DTPEATAMAT → MRFWLRTEEMALEEMVQRLNAVSKHT
     1128-1137: GKAHVPRAHP → ESSPGSAVLSNSSSCSEGGQAPFSDLQG

Note: No experimental confirmation available.
Show »
Length:1,125
Mass (Da):126,518
Checksum:iAE637064E50647B0
GO
Isoform 8 (identifier: O15068-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-56: MFDCWRFILC...DTPEATAMAT → MGDGKAVRISVAEMKSYYLYSEWCSWLLSVAE

Show »
Length:1,113
Mass (Da):125,368
Checksum:i9AE182A51542CDE4
GO
Isoform 9 (identifier: O15068-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-56: MFDCWRFILC...DTPEATAMAT → MTVRRLSLLCRDLWALWLLLKAGA
     1128-1137: GKAHVPRAHP → ESSPGSAVLSNSSSCSEGGQAPFSDLQG

Note: No experimental confirmation available.
Show »
Length:1,123
Mass (Da):126,111
Checksum:i3BB27FD875BF70B5
GO

Sequence cautioni

The sequence BAA20817.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti580 – 5801C → S in BAG58097 (PubMed:14702039).Curated
Sequence conflicti660 – 6601E → G in BAG58097 (PubMed:14702039).Curated
Sequence conflicti721 – 7211F → L in BAG58528 (PubMed:14702039).Curated
Sequence conflicti1052 – 10521P → L in BAG58528 (PubMed:14702039).Curated
Sequence conflicti1123 – 11231C → R in BAG58097 (PubMed:14702039).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 189189Missing in isoform 5. 1 PublicationVSP_026119Add
BLAST
Alternative sequencei1 – 5656MFDCW…TAMAT → MPLRGGAGPSPASHGPTHGP SDPRTCLPGRGAGGMRPHGR GALGCCGLCSFYTCHGAAG in isoform 2. 1 PublicationVSP_026120Add
BLAST
Alternative sequencei1 – 5656MFDCW…TAMAT → MAEKGASRGTLRRLWSLPRR RRGTAGRSRP in isoform 3. 1 PublicationVSP_026121Add
BLAST
Alternative sequencei1 – 5656MFDCW…TAMAT → MTVRRLSLLCRDLWALWLLL KAGA in isoform 4 and isoform 9. 2 PublicationsVSP_026122Add
BLAST
Alternative sequencei1 – 5656MFDCW…TAMAT → MRFWLRTEEMALEEMVQRLN AVSKHT in isoform 6 and isoform 7. 1 PublicationVSP_026123Add
BLAST
Alternative sequencei1 – 5656MFDCW…TAMAT → MGDGKAVRISVAEMKSYYLY SEWCSWLLSVAE in isoform 8. CuratedVSP_026124Add
BLAST
Alternative sequencei1015 – 10162GW → EP in isoform 4. 1 PublicationVSP_026126
Alternative sequencei1017 – 1137121Missing in isoform 4. 1 PublicationVSP_026127Add
BLAST
Alternative sequencei1094 – 113744Missing in isoform 2, isoform 3 and isoform 5. 2 PublicationsVSP_026128Add
BLAST
Alternative sequencei1128 – 113710GKAHVPRAHP → ESSPGSAVLSNSSSCSEGGQ APFSDLQG in isoform 7 and isoform 9. 1 PublicationVSP_039037

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB116074 mRNA. Translation: BAD08351.1.
AB116075 mRNA. Translation: BAD08352.1.
AB002360 mRNA. Translation: BAA20817.1. Different initiation.
AK295047 mRNA. Translation: BAG58097.1.
AK295670 mRNA. Translation: BAG58528.1.
AL356740 Genomic DNA. No translation available.
AL596093 Genomic DNA. No translation available.
AL162454 Genomic DNA. No translation available.
AL137002 Genomic DNA. No translation available.
BC011853 mRNA. Translation: AAH11853.1.
BC020208 mRNA. Translation: AAH20208.1.
CCDSiCCDS45070.2. [O15068-9]
CCDS9527.3. [O15068-10]
RefSeqiNP_001106203.2. NM_001112732.2. [O15068-9]
NP_001307744.1. NM_001320815.1.
NP_001307745.1. NM_001320816.1.
NP_001307746.1. NM_001320817.1. [O15068-4]
NP_079255.4. NM_024979.4. [O15068-10]
XP_005268371.1. XM_005268314.2. [O15068-3]
UniGeneiHs.170422.

Genome annotation databases

EnsembliENST00000375597; ENSP00000364747; ENSG00000126217. [O15068-4]
ENST00000375604; ENSP00000364754; ENSG00000126217. [O15068-10]
ENST00000375608; ENSP00000364758; ENSG00000126217. [O15068-1]
ENST00000397030; ENSP00000380225; ENSG00000126217. [O15068-2]
ENST00000421756; ENSP00000397285; ENSG00000126217. [O15068-3]
ENST00000535094; ENSP00000440374; ENSG00000126217. [O15068-9]
GeneIDi23263.
KEGGihsa:23263.
UCSCiuc001vss.5. human. [O15068-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB116074 mRNA. Translation: BAD08351.1.
AB116075 mRNA. Translation: BAD08352.1.
AB002360 mRNA. Translation: BAA20817.1. Different initiation.
AK295047 mRNA. Translation: BAG58097.1.
AK295670 mRNA. Translation: BAG58528.1.
AL356740 Genomic DNA. No translation available.
AL596093 Genomic DNA. No translation available.
AL162454 Genomic DNA. No translation available.
AL137002 Genomic DNA. No translation available.
BC011853 mRNA. Translation: AAH11853.1.
BC020208 mRNA. Translation: AAH20208.1.
CCDSiCCDS45070.2. [O15068-9]
CCDS9527.3. [O15068-10]
RefSeqiNP_001106203.2. NM_001112732.2. [O15068-9]
NP_001307744.1. NM_001320815.1.
NP_001307745.1. NM_001320816.1.
NP_001307746.1. NM_001320817.1. [O15068-4]
NP_079255.4. NM_024979.4. [O15068-10]
XP_005268371.1. XM_005268314.2. [O15068-3]
UniGeneiHs.170422.

3D structure databases

ProteinModelPortaliO15068.
SMRiO15068. Positions 623-964.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116865. 8 interactions.
IntActiO15068. 6 interactions.
STRINGi9606.ENSP00000440374.

Chemistry

SwissLipidsiSLP:000001547.

PTM databases

iPTMnetiO15068.
PhosphoSiteiO15068.

Polymorphism and mutation databases

BioMutaiMCF2L.

Proteomic databases

MaxQBiO15068.
PaxDbiO15068.
PRIDEiO15068.

Protocols and materials databases

DNASUi23263.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000375597; ENSP00000364747; ENSG00000126217. [O15068-4]
ENST00000375604; ENSP00000364754; ENSG00000126217. [O15068-10]
ENST00000375608; ENSP00000364758; ENSG00000126217. [O15068-1]
ENST00000397030; ENSP00000380225; ENSG00000126217. [O15068-2]
ENST00000421756; ENSP00000397285; ENSG00000126217. [O15068-3]
ENST00000535094; ENSP00000440374; ENSG00000126217. [O15068-9]
GeneIDi23263.
KEGGihsa:23263.
UCSCiuc001vss.5. human. [O15068-1]

Organism-specific databases

CTDi23263.
GeneCardsiMCF2L.
HGNCiHGNC:14576. MCF2L.
HPAiHPA008614.
MIMi609499. gene.
neXtProtiNX_O15068.
PharmGKBiPA30685.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IPNH. Eukaryota.
ENOG410XNYV. LUCA.
GeneTreeiENSGT00760000119030.
HOGENOMiHOG000231361.
HOVERGENiHBG062385.
InParanoidiO15068.
OMAiERMEDFQ.
OrthoDBiEOG7KQ210.
PhylomeDBiO15068.
TreeFamiTF318080.

Enzyme and pathway databases

ReactomeiR-HSA-193648. NRAGE signals death through JNK.
R-HSA-194840. Rho GTPase cycle.
R-HSA-416482. G alpha (12/13) signalling events.

Miscellaneous databases

ChiTaRSiMCF2L. human.
GeneWikiiMCF2L.
GenomeRNAii23263.
PROiO15068.
SOURCEiSearch...

Gene expression databases

BgeeiO15068.
ExpressionAtlasiO15068. baseline and differential.
GenevisibleiO15068. HS.

Family and domain databases

Gene3Di1.20.900.10. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR001251. CRAL-TRIO_dom.
IPR000219. DH-domain.
IPR001331. GDS_CDC24_CS.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR011511. SH3_2.
IPR001452. SH3_domain.
IPR018159. Spectrin/alpha-actinin.
IPR002017. Spectrin_repeat.
[Graphical view]
PfamiPF13716. CRAL_TRIO_2. 1 hit.
PF00169. PH. 1 hit.
PF00621. RhoGEF. 1 hit.
PF07653. SH3_2. 1 hit.
PF00435. Spectrin. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
SM00325. RhoGEF. 1 hit.
SM00516. SEC14. 1 hit.
SM00326. SH3. 1 hit.
SM00150. SPEC. 1 hit.
[Graphical view]
SUPFAMiSSF48065. SSF48065. 1 hit.
SSF50044. SSF50044. 1 hit.
SSF50729. SSF50729. 1 hit.
SSF52087. SSF52087. 1 hit.
PROSITEiPS50191. CRAL_TRIO. 1 hit.
PS00741. DH_1. 1 hit.
PS50010. DH_2. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
PS50002. SH3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Role of the Sec14-like domain of Dbl family exchange factors in the regulation of Rho family GTPases in different subcellular sites."
    Ueda S., Kataoka T., Satoh T.
    Cell. Signal. 16:899-906(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3 AND 5), FUNCTION, SUBCELLULAR LOCATION, DOMAIN, INTERACTION WITH CDC42 AND INOSITOL PHOSPHOLIPIDS.
  2. "Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro."
    Nagase T., Ishikawa K., Nakajima D., Ohira M., Seki N., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
    DNA Res. 4:141-150(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 7 AND 9).
    Tissue: Brain and Hippocampus.
  4. "The DNA sequence and analysis of human chromosome 13."
    Dunham A., Matthews L.H., Burton J., Ashurst J.L., Howe K.L., Ashcroft K.J., Beare D.M., Burford D.C., Hunt S.E., Griffiths-Jones S., Jones M.C., Keenan S.J., Oliver K., Scott C.E., Ainscough R., Almeida J.P., Ambrose K.D., Andrews D.T.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Bannerjee R., Barlow K.F., Bates K., Beasley H., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burrill W., Carder C., Carter N.P., Chapman J.C., Clamp M.E., Clark S.Y., Clarke G., Clee C.M., Clegg S.C., Cobley V., Collins J.E., Corby N., Coville G.J., Deloukas P., Dhami P., Dunham I., Dunn M., Earthrowl M.E., Ellington A.G., Faulkner L., Frankish A.G., Frankland J., French L., Garner P., Garnett J., Gilbert J.G.R., Gilson C.J., Ghori J., Grafham D.V., Gribble S.M., Griffiths C., Hall R.E., Hammond S., Harley J.L., Hart E.A., Heath P.D., Howden P.J., Huckle E.J., Hunt P.J., Hunt A.R., Johnson C., Johnson D., Kay M., Kimberley A.M., King A., Laird G.K., Langford C.J., Lawlor S., Leongamornlert D.A., Lloyd D.M., Lloyd C., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., McLaren S.J., McMurray A., Milne S., Moore M.J.F., Nickerson T., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K.M., Rice C.M., Searle S., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Steward C.A., Sycamore N., Tester J., Thomas D.W., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Wilming L., Wray P.W., Wright M.W., Young L., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Beck S., Bentley D.R., Rogers J., Ross M.T.
    Nature 428:522-528(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Muscle.

Entry informationi

Entry nameiMCF2L_HUMAN
AccessioniPrimary (citable) accession number: O15068
Secondary accession number(s): A2A2X1
, A2A2X2, A2A3G6, A2A3G8, B4DHD6, B4DIL6, E9PDN8, Q5JU56, Q5VXT1, Q6ZWD4, Q765G8, Q765G9, Q8N679
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: June 12, 2007
Last modified: June 8, 2016
This is version 156 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 13
    Human chromosome 13: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.