Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O15021

- MAST4_HUMAN

UniProt

O15021 - MAST4_HUMAN

Protein

Microtubule-associated serine/threonine-protein kinase 4

Gene

MAST4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 122 (01 Oct 2014)
      Sequence version 3 (25 Nov 2008)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Catalytic activityi

    ATP + a protein = ADP + a phosphoprotein.

    Cofactori

    Magnesium.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei602 – 6021ATPPROSITE-ProRule annotation
    Active sitei696 – 6961Proton acceptorPROSITE-ProRule annotation

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi579 – 5879ATPPROSITE-ProRule annotation

    GO - Molecular functioni

    1. ATP binding Source: UniProtKB-KW
    2. magnesium ion binding Source: InterPro
    3. protein serine/threonine kinase activity Source: UniProtKB-KW

    Keywords - Molecular functioni

    Kinase, Serine/threonine-protein kinase, Transferase

    Keywords - Ligandi

    ATP-binding, Magnesium, Metal-binding, Nucleotide-binding

    Enzyme and pathway databases

    SignaLinkiO15021.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Microtubule-associated serine/threonine-protein kinase 4 (EC:2.7.11.1)
    Gene namesi
    Name:MAST4
    Synonyms:KIAA0303
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 5

    Organism-specific databases

    HGNCiHGNC:19037. MAST4.

    Subcellular locationi

    Cytoplasm Curated

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cytoplasm

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134920494.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 26262626Microtubule-associated serine/threonine-protein kinase 4PRO_0000252256Add
    BLAST

    Proteomic databases

    MaxQBiO15021.
    PaxDbiO15021.
    PRIDEiO15021.

    PTM databases

    PhosphoSiteiO15021.

    Expressioni

    Tissue specificityi

    Highly expressed in most normal human tissues, with an exception of in testis, small intestine, colon and peripheral blood leukocyte.1 Publication

    Gene expression databases

    ArrayExpressiO15021.
    BgeeiO15021.
    CleanExiHS_MAST4.
    GenevestigatoriO15021.

    Organism-specific databases

    HPAiHPA000544.

    Interactioni

    Protein-protein interaction databases

    BioGridi131980. 1 interaction.
    IntActiO15021. 2 interactions.
    MINTiMINT-1184694.
    STRINGi9606.ENSP00000384313.

    Structurei

    Secondary structure

    1
    2626
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi1145 – 11484
    Beta strandi1156 – 11649
    Beta strandi1171 – 118010
    Helixi1185 – 11895
    Beta strandi1196 – 12005
    Helixi1210 – 12189
    Turni1219 – 12224
    Beta strandi1223 – 12297

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2W7RX-ray1.60A/B1143-1234[»]
    ProteinModelPortaliO15021.
    SMRiO15021. Positions 384-484, 1143-1234.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiO15021.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini573 – 846274Protein kinasePROSITE-ProRule annotationAdd
    BLAST
    Domaini847 – 91973AGC-kinase C-terminalAdd
    BLAST
    Domaini1144 – 123289PDZPROSITE-ProRule annotationAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi1026 – 1140115Ser-richAdd
    BLAST
    Compositional biasi1284 – 134663Ser-richAdd
    BLAST
    Compositional biasi2128 – 221184Pro-richAdd
    BLAST

    Sequence similaritiesi

    Contains 1 AGC-kinase C-terminal domain.Curated
    Contains 1 PDZ (DHR) domain.PROSITE-ProRule annotation
    Contains 1 protein kinase domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiCOG0515.
    HOGENOMiHOG000074100.
    HOVERGENiHBG108118.
    KOiK08789.
    PhylomeDBiO15021.

    Family and domain databases

    Gene3Di1.20.1480.20. 1 hit.
    2.30.42.10. 1 hit.
    InterProiIPR000961. AGC-kinase_C.
    IPR011009. Kinase-like_dom.
    IPR015022. MA_Ser/Thr_Kinase_dom.
    IPR023142. MAST_pre-PK_dom.
    IPR001478. PDZ.
    IPR000719. Prot_kinase_dom.
    IPR002290. Ser/Thr_dual-sp_kinase_dom.
    IPR008271. Ser/Thr_kinase_AS.
    [Graphical view]
    PfamiPF08926. DUF1908. 1 hit.
    PF00595. PDZ. 1 hit.
    PF00069. Pkinase. 1 hit.
    [Graphical view]
    SMARTiSM00228. PDZ. 1 hit.
    SM00133. S_TK_X. 1 hit.
    SM00220. S_TKc. 1 hit.
    [Graphical view]
    SUPFAMiSSF140482. SSF140482. 1 hit.
    SSF50156. SSF50156. 1 hit.
    SSF56112. SSF56112. 1 hit.
    PROSITEiPS51285. AGC_KINASE_CTER. 1 hit.
    PS50106. PDZ. 1 hit.
    PS50011. PROTEIN_KINASE_DOM. 1 hit.
    PS00108. PROTEIN_KINASE_ST. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O15021-5) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGEKVSEAPE PVPRGCSGHG SRTPASALVA ASSPGASSAE SSSGSETLSE     50
    EGEPGGFSRE HQPPPPPPLG GTLGARAPAA WAPASVLLER GVLALPPPLP 100
    GGAVPPAPRG SSASQEEQDE ELDHILSPPP MPFRKCSNPD VASGPGKSLK 150
    YKRQLSEDGR QLRRGSLGGA LTGRYLLPNP VAGQAWPASA ETSNLVRMRS 200
    QALGQSAPSL TASLKELSLP RRGSLCRTSN RKSLIGNGQS PALPRPHSPL 250
    SAHAGNSPQD SPRNFSPSAS AHFSFARSLN RTDGRRWSLA SLPSSGYGTN 300
    TPSSTVSSSC SSQEKLHQLP YQPTPDELHF LSKHFCTTES IATENRCRNT 350
    PMRPRSRSLS PGRSPACCDH EIIMMNHVYK ERFPKATAQM EERLKEIITS 400
    YSPDNVLPLA DGVLSFTHHQ IIELARDCLD KSHQGLITSR YFLELQHKLD 450
    KLLQEAHDRS ESGELAFIKQ LVRKILIVIA RPARLLECLE FDPEEFYYLL 500
    EAAEGHAKEG QGIKTDIPRY IISQLGLNKD PLEEMAHLGN YDSGTAETPE 550
    TDESVSSSNA SLKLRRKPRE SDFETIKLIS NGAYGAVYFV RHKESRQRFA 600
    MKKINKQNLI LRNQIQQAFV ERDILTFAEN PFVVSMYCSF ETRRHLCMVM 650
    EYVEGGDCAT LMKNMGPLPV DMARMYFAET VLALEYLHNY GIVHRDLKPD 700
    NLLVTSMGHI KLTDFGLSKV GLMSMTTNLY EGHIEKDARE FLDKQVCGTP 750
    EYIAPEVILR QGYGKPVDWW AMGIILYEFL VGCVPFFGDT PEELFGQVIS 800
    DEINWPEKDE APPPDAQDLI TLLLRQNPLE RLGTGGAYEV KQHRFFRSLD 850
    WNSLLRQKAE FIPQLESEDD TSYFDTRSEK YHHMETEEED DTNDEDFNVE 900
    IRQFSSCSHR FSKVFSSIDR ITQNSAEEKE DSVDKTKSTT LPSTETLSWS 950
    SEYSEMQQLS TSNSSDTESN RHKLSSGLLP KLAISTEGEQ DEAASCPGDP 1000
    HEEPGKPALP PEECAQEEPE VTTPASTISS STLSVGSFSE HLDQINGRSE 1050
    CVDSTDNSSK PSSEPASHMA RQRLESTEKK KISGKVTKSL SASALSLMIP 1100
    GDMFAVSPLG SPMSPHSLSS DPSSSRDSSP SRDSSAASAS PHQPIVIHSS 1150
    GKNYGFTIRA IRVYVGDSDI YTVHHIVWNV EEGSPACQAG LKAGDLITHI 1200
    NGEPVHGLVH TEVIELLLKS GNKVSITTTP FENTSIKTGP ARRNSYKSRM 1250
    VRRSKKSKKK ESLERRRSLF KKLAKQPSPL LHTSRSFSCL NRSLSSGESL 1300
    PGSPTHSLSP RSPTPSYRST PDFPSGTNSS QSSSPSSSAP NSPAGSGHIR 1350
    PSTLHGLAPK LGGQRYRSGR RKSAGNIPLS PLARTPSPTP QPTSPQRSPS 1400
    PLLGHSLGNS KIAQAFPSKM HSPPTIVRHI VRPKSAEPPR SPLLKRVQSE 1450
    EKLSPSYGSD KKHLCSRKHS LEVTQEEVQR EQSQREAPLQ SLDENVCDVP 1500
    PLSRARPVEQ GCLKRPVSRK VGRQESVDDL DRDKLKAKVV VKKADGFPEK 1550
    QESHQKSHGP GSDLENFALF KLEEREKKVY PKAVERSSTF ENKASMQEAP 1600
    PLGSLLKDAL HKQASVRASE GAMSDGRVPA EHRQGGGDFR RAPAPGTLQD 1650
    GLCHSLDRGI SGKGEGTEKS SQAKELLRCE KLDSKLANID YLRKKMSLED 1700
    KEDNLCPVLK PKMTAGSHEC LPGNPVRPTG GQQEPPPASE SRAFVSSTHA 1750
    AQMSAVSFVP LKALTGRVDS GTEKPGLVAP ESPVRKSPSE YKLEGRSVSC 1800
    LKPIEGTLDI ALLSGPQASK TELPSPESAQ SPSPSGDVRA SVPPVLPSSS 1850
    GKKNDTTSAR ELSPSSLKMN KSYLLEPWFL PPSRGLQNSP AVSLPDPEFK 1900
    RDRKGPHPTA RSPGTVMESN PQQREGSSPK HQDHTTDPKL LTCLGQNLHS 1950
    PDLARPRCPL PPEASPSREK PGLRESSERG PPTARSERSA ARADTCREPS 2000
    MELCFPETAK TSDNSKNLLS VGRTHPDFYT QTQAMEKAWA PGGKTNHKDG 2050
    PGEARPPPRD NSSLHSAGIP CEKELGKVRR GVEPKPEALL ARRSLQPPGI 2100
    ESEKSEKLSS FPSLQKDGAK EPERKEQPLQ RHPSSIPPPP LTAKDLSSPA 2150
    ARQHCSSPSH ASGREPGAKP STAEPSSSPQ DPPKPVAAHS ESSSHKPRPG 2200
    PDPGPPKTKH PDRSLSSQKP SVGATKGKEP ATQSLGGSSR EGKGHSKSGP 2250
    DVFPATPGSQ NKASDGIGQG EGGPSVPLHT DRAPLDAKPQ PTSGGRPLEV 2300
    LEKPVHLPRP GHPGPSEPAD QKLSAVGEKQ TLSPKHPKPS TVKDCPTLCK 2350
    QTDNRQTDKS PSQPAANTDR RAEGKKCTEA LYAPAEGDKL EAGLSFVHSE 2400
    NRLKGAERPA AGVGKGFPEA RGKGPGPQKP PTEADKPNGM KRSPSATGQS 2450
    SFRSTALPEK SLSCSSSFPE TRAGVREASA ASSDTSSAKA AGGMLELPAP 2500
    SNRDHRKAQP AGEGRTHMTK SDSLPSFRVS TLPLESHHPD PNTMGGASHR 2550
    DRALSVTATV GETKGKDPAP AQPPPARKQN VGRDVTKPSP APNTDRPISL 2600
    SNEKDFVVRQ RRGKESLRSS PHKKAL 2626
    Length:2,626
    Mass (Da):284,378
    Last modified:November 25, 2008 - v3
    Checksum:i74198B02E112789B
    GO
    Isoform 2 (identifier: O15021-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-225: MGEKVSEAPE...ELSLPRRGSL → MDMSDPNFWTVLSNFTLPHLRSGNRLRRTQS
         278-280: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:2,429
    Mass (Da):264,762
    Checksum:i522EC091B431DA62
    GO
    Isoform 4 (identifier: O15021-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         226-250: CRTSNRKSLIGNGQSPALPRPHSPL → IDSQKWNCLVKRPVCPNAGRTSPLG
         251-2626: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:250
    Mass (Da):25,702
    Checksum:i8CAF56901F60C75F
    GO
    Isoform 5 (identifier: O15021-1) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-225: MGEKVSEAPE...ELSLPRRGSL → MKAQRERLQI...SPLLAFHFWS

    Show »
    Length:2,444
    Mass (Da):266,119
    Checksum:i63BEFB8FEAC67DDB
    GO
    Isoform 3 (identifier: O15021-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-225: MGEKVSEAPE...ELSLPRRGSL → MDESSILRRR...SQKWNCLVKR
         278-280: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:2,434
    Mass (Da):265,354
    Checksum:i7BE938C15BAA4014
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti665 – 6651M → T in AK131421. (PubMed:14702039)Curated
    Sequence conflicti677 – 6815FAETV → YIVKL in BAB71532. (PubMed:14702039)Curated
    Sequence conflicti1627 – 16271R → P in AAW52510. (PubMed:17086981)Curated
    Sequence conflicti1627 – 16271R → P in BAA20762. (PubMed:9205841)Curated
    Sequence conflicti1802 – 18021K → E in AAW52510. (PubMed:17086981)Curated
    Sequence conflicti1802 – 18021K → E in BAA20762. (PubMed:9205841)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti77 – 771A → P.
    Corresponds to variant rs6867856 [ dbSNP | Ensembl ].
    VAR_059768
    Natural varianti923 – 9231Q → R.1 Publication
    VAR_040787
    Natural varianti1957 – 19571R → W.1 Publication
    VAR_040788
    Natural varianti2201 – 22011P → L.1 Publication
    VAR_040789
    Natural varianti2293 – 22931S → C.1 Publication
    VAR_040790
    Natural varianti2470 – 24701E → D in a lung squamous cell carcinoma sample; somatic mutation. 1 Publication
    VAR_040791

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 225225MGEKV…RRGSL → MDMSDPNFWTVLSNFTLPHL RSGNRLRRTQS in isoform 2. 1 PublicationVSP_020888Add
    BLAST
    Alternative sequencei1 – 225225MGEKV…RRGSL → MDESSILRRRGLQKELSLPR RGSLIDSQKWNCLVKR in isoform 3. 1 PublicationVSP_023109Add
    BLAST
    Alternative sequencei1 – 225225MGEKV…RRGSL → MKAQRERLQIPGLTLDLTPR SLSPTPSSPGSPCSPLLAFH FWS in isoform 5. 1 PublicationVSP_035851Add
    BLAST
    Alternative sequencei226 – 25025CRTSN…PHSPL → IDSQKWNCLVKRPVCPNAGR TSPLG in isoform 4. 1 PublicationVSP_035852Add
    BLAST
    Alternative sequencei251 – 26262376Missing in isoform 4. 1 PublicationVSP_035853Add
    BLAST
    Alternative sequencei278 – 2803Missing in isoform 2 and isoform 3. 2 PublicationsVSP_023110

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY830839 mRNA. Translation: AAW52510.1.
    AC008872 Genomic DNA. No translation available.
    AC008920 Genomic DNA. No translation available.
    AC016634 Genomic DNA. No translation available.
    AC034208 Genomic DNA. No translation available.
    AC044799 Genomic DNA. No translation available.
    AC092349 Genomic DNA. No translation available.
    AC092373 Genomic DNA. No translation available.
    AC113365 Genomic DNA. No translation available.
    BC033215 mRNA. Translation: AAH33215.1.
    AK057601 mRNA. Translation: BAB71532.1.
    AK131421 mRNA. No translation available.
    AB002301 mRNA. Translation: BAA20762.1.
    CCDSiCCDS47224.1. [O15021-4]
    CCDS47225.1. [O15021-3]
    RefSeqiNP_001277155.1. NM_001290226.1.
    NP_001277157.1. NM_001290228.1.
    NP_055998.1. NM_015183.2. [O15021-3]
    NP_942123.1. NM_198828.2. [O15021-4]
    XP_006714668.1. XM_006714605.1. [O15021-2]
    XP_006714669.1. XM_006714606.1. [O15021-2]
    UniGeneiHs.595458.
    Hs.732793.

    Genome annotation databases

    EnsembliENST00000261569; ENSP00000261569; ENSG00000069020. [O15021-2]
    ENST00000403666; ENSP00000384313; ENSG00000069020. [O15021-3]
    ENST00000406374; ENSP00000385088; ENSG00000069020. [O15021-4]
    GeneIDi375449.
    KEGGihsa:375449.
    UCSCiuc003jur.4. human. [O15021-4]
    uc003jut.2. human. [O15021-3]
    uc003juw.3. human. [O15021-2]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY830839 mRNA. Translation: AAW52510.1 .
    AC008872 Genomic DNA. No translation available.
    AC008920 Genomic DNA. No translation available.
    AC016634 Genomic DNA. No translation available.
    AC034208 Genomic DNA. No translation available.
    AC044799 Genomic DNA. No translation available.
    AC092349 Genomic DNA. No translation available.
    AC092373 Genomic DNA. No translation available.
    AC113365 Genomic DNA. No translation available.
    BC033215 mRNA. Translation: AAH33215.1 .
    AK057601 mRNA. Translation: BAB71532.1 .
    AK131421 mRNA. No translation available.
    AB002301 mRNA. Translation: BAA20762.1 .
    CCDSi CCDS47224.1. [O15021-4 ]
    CCDS47225.1. [O15021-3 ]
    RefSeqi NP_001277155.1. NM_001290226.1.
    NP_001277157.1. NM_001290228.1.
    NP_055998.1. NM_015183.2. [O15021-3 ]
    NP_942123.1. NM_198828.2. [O15021-4 ]
    XP_006714668.1. XM_006714605.1. [O15021-2 ]
    XP_006714669.1. XM_006714606.1. [O15021-2 ]
    UniGenei Hs.595458.
    Hs.732793.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2W7R X-ray 1.60 A/B 1143-1234 [» ]
    ProteinModelPortali O15021.
    SMRi O15021. Positions 384-484, 1143-1234.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 131980. 1 interaction.
    IntActi O15021. 2 interactions.
    MINTi MINT-1184694.
    STRINGi 9606.ENSP00000384313.

    Chemistry

    ChEMBLi CHEMBL2417351.

    PTM databases

    PhosphoSitei O15021.

    Proteomic databases

    MaxQBi O15021.
    PaxDbi O15021.
    PRIDEi O15021.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000261569 ; ENSP00000261569 ; ENSG00000069020 . [O15021-2 ]
    ENST00000403666 ; ENSP00000384313 ; ENSG00000069020 . [O15021-3 ]
    ENST00000406374 ; ENSP00000385088 ; ENSG00000069020 . [O15021-4 ]
    GeneIDi 375449.
    KEGGi hsa:375449.
    UCSCi uc003jur.4. human. [O15021-4 ]
    uc003jut.2. human. [O15021-3 ]
    uc003juw.3. human. [O15021-2 ]

    Organism-specific databases

    CTDi 375449.
    GeneCardsi GC05P065892.
    H-InvDB HIX0004913.
    HIX0164541.
    HGNCi HGNC:19037. MAST4.
    HPAi HPA000544.
    neXtProti NX_O15021.
    PharmGKBi PA134920494.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0515.
    HOGENOMi HOG000074100.
    HOVERGENi HBG108118.
    KOi K08789.
    PhylomeDBi O15021.

    Enzyme and pathway databases

    SignaLinki O15021.

    Miscellaneous databases

    ChiTaRSi MAST4. human.
    EvolutionaryTracei O15021.
    GenomeRNAii 375449.
    NextBioi 100512.
    PROi O15021.

    Gene expression databases

    ArrayExpressi O15021.
    Bgeei O15021.
    CleanExi HS_MAST4.
    Genevestigatori O15021.

    Family and domain databases

    Gene3Di 1.20.1480.20. 1 hit.
    2.30.42.10. 1 hit.
    InterProi IPR000961. AGC-kinase_C.
    IPR011009. Kinase-like_dom.
    IPR015022. MA_Ser/Thr_Kinase_dom.
    IPR023142. MAST_pre-PK_dom.
    IPR001478. PDZ.
    IPR000719. Prot_kinase_dom.
    IPR002290. Ser/Thr_dual-sp_kinase_dom.
    IPR008271. Ser/Thr_kinase_AS.
    [Graphical view ]
    Pfami PF08926. DUF1908. 1 hit.
    PF00595. PDZ. 1 hit.
    PF00069. Pkinase. 1 hit.
    [Graphical view ]
    SMARTi SM00228. PDZ. 1 hit.
    SM00133. S_TK_X. 1 hit.
    SM00220. S_TKc. 1 hit.
    [Graphical view ]
    SUPFAMi SSF140482. SSF140482. 1 hit.
    SSF50156. SSF50156. 1 hit.
    SSF56112. SSF56112. 1 hit.
    PROSITEi PS51285. AGC_KINASE_CTER. 1 hit.
    PS50106. PDZ. 1 hit.
    PS50011. PROTEIN_KINASE_DOM. 1 hit.
    PS00108. PROTEIN_KINASE_ST. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Identification of a novel human MAST4 gene, a new member of the microtubule associated serine-threonine kinase family."
      Sun L., Gu S., Li X., Sun Y., Zheng D., Yu K., Ji C., Tang R., Xie Y., Mao Y.
      Mol. Biol. (Mosk.) 40:808-815(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), TISSUE SPECIFICITY.
    2. "The DNA sequence and comparative analysis of human chromosome 5."
      Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.
      , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
      Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
      Tissue: Lung.
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-681 (ISOFORM 5), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-666 (ISOFORM 2).
      Tissue: Brain and Thymus.
    5. "Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro."
      Nagase T., Ishikawa K., Nakajima D., Ohira M., Seki N., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
      DNA Res. 4:141-150(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 490-2626 (ISOFORM 1).
      Tissue: Brain.
    6. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    7. "Structure of the Pdz domain of human Microtubule Associated Serine-Threonine Kinase 4."
      Structural genomics consortium (SGC)
      Submitted (MAY-2009) to the PDB data bank
      Cited for: X-RAY CRYSTALLOGRAPHY (1.60 ANGSTROMS) OF 1143-1234.
    8. "Patterns of somatic mutation in human cancer genomes."
      Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G.
      , Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.
      Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANTS [LARGE SCALE ANALYSIS] ARG-923; TRP-1957; LEU-2201; CYS-2293 AND ASP-2470.

    Entry informationi

    Entry nameiMAST4_HUMAN
    AccessioniPrimary (citable) accession number: O15021
    Secondary accession number(s): A6NL49
    , B5ME48, Q05EE6, Q6ZN07, Q8N4X4, Q96LY3
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 3, 2006
    Last sequence update: November 25, 2008
    Last modified: October 1, 2014
    This is version 122 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 5
      Human chromosome 5: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    5. Human and mouse protein kinases
      Human and mouse protein kinases: classification and index
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3