Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

O15021 (MAST4_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 121. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Microtubule-associated serine/threonine-protein kinase 4

EC=2.7.11.1
Gene names
Name:MAST4
Synonyms:KIAA0303
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length2626 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Catalytic activity

ATP + a protein = ADP + a phosphoprotein.

Cofactor

Magnesium By similarity.

Subcellular location

Cytoplasm Potential.

Tissue specificity

Highly expressed in most normal human tissues, with an exception of in testis, small intestine, colon and peripheral blood leukocyte. Ref.1

Sequence similarities

Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family.

Contains 1 AGC-kinase C-terminal domain.

Contains 1 PDZ (DHR) domain.

Contains 1 protein kinase domain.

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: O15021-5)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: O15021-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-225: MGEKVSEAPE...ELSLPRRGSL → MDMSDPNFWTVLSNFTLPHLRSGNRLRRTQS
     278-280: Missing.
Note: No experimental confirmation available.
Isoform 4 (identifier: O15021-4)

The sequence of this isoform differs from the canonical sequence as follows:
     226-250: CRTSNRKSLIGNGQSPALPRPHSPL → IDSQKWNCLVKRPVCPNAGRTSPLG
     251-2626: Missing.
Note: No experimental confirmation available.
Isoform 5 (identifier: O15021-1)

The sequence of this isoform differs from the canonical sequence as follows:
     1-225: MGEKVSEAPE...ELSLPRRGSL → MKAQRERLQI...SPLLAFHFWS
Isoform 3 (identifier: O15021-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-225: MGEKVSEAPE...ELSLPRRGSL → MDESSILRRR...SQKWNCLVKR
     278-280: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 26262626Microtubule-associated serine/threonine-protein kinase 4
PRO_0000252256

Regions

Domain573 – 846274Protein kinase
Domain847 – 91973AGC-kinase C-terminal
Domain1144 – 123289PDZ
Nucleotide binding579 – 5879ATP By similarity
Compositional bias1026 – 1140115Ser-rich
Compositional bias1284 – 134663Ser-rich
Compositional bias2128 – 221184Pro-rich

Sites

Active site6961Proton acceptor By similarity
Binding site6021ATP By similarity

Natural variations

Alternative sequence1 – 225225MGEKV…RRGSL → MDMSDPNFWTVLSNFTLPHL RSGNRLRRTQS in isoform 2.
VSP_020888
Alternative sequence1 – 225225MGEKV…RRGSL → MDESSILRRRGLQKELSLPR RGSLIDSQKWNCLVKR in isoform 3.
VSP_023109
Alternative sequence1 – 225225MGEKV…RRGSL → MKAQRERLQIPGLTLDLTPR SLSPTPSSPGSPCSPLLAFH FWS in isoform 5.
VSP_035851
Alternative sequence226 – 25025CRTSN…PHSPL → IDSQKWNCLVKRPVCPNAGR TSPLG in isoform 4.
VSP_035852
Alternative sequence251 – 26262376Missing in isoform 4.
VSP_035853
Alternative sequence278 – 2803Missing in isoform 2 and isoform 3.
VSP_023110
Natural variant771A → P.
Corresponds to variant rs6867856 [ dbSNP | Ensembl ].
VAR_059768
Natural variant9231Q → R. Ref.8
VAR_040787
Natural variant19571R → W. Ref.8
VAR_040788
Natural variant22011P → L. Ref.8
VAR_040789
Natural variant22931S → C. Ref.8
VAR_040790
Natural variant24701E → D in a lung squamous cell carcinoma sample; somatic mutation. Ref.8
VAR_040791

Experimental info

Sequence conflict6651M → T in AK131421. Ref.4
Sequence conflict677 – 6815FAETV → YIVKL in BAB71532. Ref.4
Sequence conflict16271R → P in AAW52510. Ref.1
Sequence conflict16271R → P in BAA20762. Ref.5
Sequence conflict18021K → E in AAW52510. Ref.1
Sequence conflict18021K → E in BAA20762. Ref.5

Secondary structure

............... 2626
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified November 25, 2008. Version 3.
Checksum: 74198B02E112789B

FASTA2,626284,378
        10         20         30         40         50         60 
MGEKVSEAPE PVPRGCSGHG SRTPASALVA ASSPGASSAE SSSGSETLSE EGEPGGFSRE 

        70         80         90        100        110        120 
HQPPPPPPLG GTLGARAPAA WAPASVLLER GVLALPPPLP GGAVPPAPRG SSASQEEQDE 

       130        140        150        160        170        180 
ELDHILSPPP MPFRKCSNPD VASGPGKSLK YKRQLSEDGR QLRRGSLGGA LTGRYLLPNP 

       190        200        210        220        230        240 
VAGQAWPASA ETSNLVRMRS QALGQSAPSL TASLKELSLP RRGSLCRTSN RKSLIGNGQS 

       250        260        270        280        290        300 
PALPRPHSPL SAHAGNSPQD SPRNFSPSAS AHFSFARSLN RTDGRRWSLA SLPSSGYGTN 

       310        320        330        340        350        360 
TPSSTVSSSC SSQEKLHQLP YQPTPDELHF LSKHFCTTES IATENRCRNT PMRPRSRSLS 

       370        380        390        400        410        420 
PGRSPACCDH EIIMMNHVYK ERFPKATAQM EERLKEIITS YSPDNVLPLA DGVLSFTHHQ 

       430        440        450        460        470        480 
IIELARDCLD KSHQGLITSR YFLELQHKLD KLLQEAHDRS ESGELAFIKQ LVRKILIVIA 

       490        500        510        520        530        540 
RPARLLECLE FDPEEFYYLL EAAEGHAKEG QGIKTDIPRY IISQLGLNKD PLEEMAHLGN 

       550        560        570        580        590        600 
YDSGTAETPE TDESVSSSNA SLKLRRKPRE SDFETIKLIS NGAYGAVYFV RHKESRQRFA 

       610        620        630        640        650        660 
MKKINKQNLI LRNQIQQAFV ERDILTFAEN PFVVSMYCSF ETRRHLCMVM EYVEGGDCAT 

       670        680        690        700        710        720 
LMKNMGPLPV DMARMYFAET VLALEYLHNY GIVHRDLKPD NLLVTSMGHI KLTDFGLSKV 

       730        740        750        760        770        780 
GLMSMTTNLY EGHIEKDARE FLDKQVCGTP EYIAPEVILR QGYGKPVDWW AMGIILYEFL 

       790        800        810        820        830        840 
VGCVPFFGDT PEELFGQVIS DEINWPEKDE APPPDAQDLI TLLLRQNPLE RLGTGGAYEV 

       850        860        870        880        890        900 
KQHRFFRSLD WNSLLRQKAE FIPQLESEDD TSYFDTRSEK YHHMETEEED DTNDEDFNVE 

       910        920        930        940        950        960 
IRQFSSCSHR FSKVFSSIDR ITQNSAEEKE DSVDKTKSTT LPSTETLSWS SEYSEMQQLS 

       970        980        990       1000       1010       1020 
TSNSSDTESN RHKLSSGLLP KLAISTEGEQ DEAASCPGDP HEEPGKPALP PEECAQEEPE 

      1030       1040       1050       1060       1070       1080 
VTTPASTISS STLSVGSFSE HLDQINGRSE CVDSTDNSSK PSSEPASHMA RQRLESTEKK 

      1090       1100       1110       1120       1130       1140 
KISGKVTKSL SASALSLMIP GDMFAVSPLG SPMSPHSLSS DPSSSRDSSP SRDSSAASAS 

      1150       1160       1170       1180       1190       1200 
PHQPIVIHSS GKNYGFTIRA IRVYVGDSDI YTVHHIVWNV EEGSPACQAG LKAGDLITHI 

      1210       1220       1230       1240       1250       1260 
NGEPVHGLVH TEVIELLLKS GNKVSITTTP FENTSIKTGP ARRNSYKSRM VRRSKKSKKK 

      1270       1280       1290       1300       1310       1320 
ESLERRRSLF KKLAKQPSPL LHTSRSFSCL NRSLSSGESL PGSPTHSLSP RSPTPSYRST 

      1330       1340       1350       1360       1370       1380 
PDFPSGTNSS QSSSPSSSAP NSPAGSGHIR PSTLHGLAPK LGGQRYRSGR RKSAGNIPLS 

      1390       1400       1410       1420       1430       1440 
PLARTPSPTP QPTSPQRSPS PLLGHSLGNS KIAQAFPSKM HSPPTIVRHI VRPKSAEPPR 

      1450       1460       1470       1480       1490       1500 
SPLLKRVQSE EKLSPSYGSD KKHLCSRKHS LEVTQEEVQR EQSQREAPLQ SLDENVCDVP 

      1510       1520       1530       1540       1550       1560 
PLSRARPVEQ GCLKRPVSRK VGRQESVDDL DRDKLKAKVV VKKADGFPEK QESHQKSHGP 

      1570       1580       1590       1600       1610       1620 
GSDLENFALF KLEEREKKVY PKAVERSSTF ENKASMQEAP PLGSLLKDAL HKQASVRASE 

      1630       1640       1650       1660       1670       1680 
GAMSDGRVPA EHRQGGGDFR RAPAPGTLQD GLCHSLDRGI SGKGEGTEKS SQAKELLRCE 

      1690       1700       1710       1720       1730       1740 
KLDSKLANID YLRKKMSLED KEDNLCPVLK PKMTAGSHEC LPGNPVRPTG GQQEPPPASE 

      1750       1760       1770       1780       1790       1800 
SRAFVSSTHA AQMSAVSFVP LKALTGRVDS GTEKPGLVAP ESPVRKSPSE YKLEGRSVSC 

      1810       1820       1830       1840       1850       1860 
LKPIEGTLDI ALLSGPQASK TELPSPESAQ SPSPSGDVRA SVPPVLPSSS GKKNDTTSAR 

      1870       1880       1890       1900       1910       1920 
ELSPSSLKMN KSYLLEPWFL PPSRGLQNSP AVSLPDPEFK RDRKGPHPTA RSPGTVMESN 

      1930       1940       1950       1960       1970       1980 
PQQREGSSPK HQDHTTDPKL LTCLGQNLHS PDLARPRCPL PPEASPSREK PGLRESSERG 

      1990       2000       2010       2020       2030       2040 
PPTARSERSA ARADTCREPS MELCFPETAK TSDNSKNLLS VGRTHPDFYT QTQAMEKAWA 

      2050       2060       2070       2080       2090       2100 
PGGKTNHKDG PGEARPPPRD NSSLHSAGIP CEKELGKVRR GVEPKPEALL ARRSLQPPGI 

      2110       2120       2130       2140       2150       2160 
ESEKSEKLSS FPSLQKDGAK EPERKEQPLQ RHPSSIPPPP LTAKDLSSPA ARQHCSSPSH 

      2170       2180       2190       2200       2210       2220 
ASGREPGAKP STAEPSSSPQ DPPKPVAAHS ESSSHKPRPG PDPGPPKTKH PDRSLSSQKP 

      2230       2240       2250       2260       2270       2280 
SVGATKGKEP ATQSLGGSSR EGKGHSKSGP DVFPATPGSQ NKASDGIGQG EGGPSVPLHT 

      2290       2300       2310       2320       2330       2340 
DRAPLDAKPQ PTSGGRPLEV LEKPVHLPRP GHPGPSEPAD QKLSAVGEKQ TLSPKHPKPS 

      2350       2360       2370       2380       2390       2400 
TVKDCPTLCK QTDNRQTDKS PSQPAANTDR RAEGKKCTEA LYAPAEGDKL EAGLSFVHSE 

      2410       2420       2430       2440       2450       2460 
NRLKGAERPA AGVGKGFPEA RGKGPGPQKP PTEADKPNGM KRSPSATGQS SFRSTALPEK 

      2470       2480       2490       2500       2510       2520 
SLSCSSSFPE TRAGVREASA ASSDTSSAKA AGGMLELPAP SNRDHRKAQP AGEGRTHMTK 

      2530       2540       2550       2560       2570       2580 
SDSLPSFRVS TLPLESHHPD PNTMGGASHR DRALSVTATV GETKGKDPAP AQPPPARKQN 

      2590       2600       2610       2620 
VGRDVTKPSP APNTDRPISL SNEKDFVVRQ RRGKESLRSS PHKKAL 

« Hide

Isoform 2 [UniParc].

Checksum: 522EC091B431DA62
Show »

FASTA2,429264,762
Isoform 4 [UniParc].

Checksum: 8CAF56901F60C75F
Show »

FASTA25025,702
Isoform 5 [UniParc].

Checksum: 63BEFB8FEAC67DDB
Show »

FASTA2,444266,119
Isoform 3 [UniParc].

Checksum: 7BE938C15BAA4014
Show »

FASTA2,434265,354

References

« Hide 'large scale' references
[1]"Identification of a novel human MAST4 gene, a new member of the microtubule associated serine-threonine kinase family."
Sun L., Gu S., Li X., Sun Y., Zheng D., Yu K., Ji C., Tang R., Xie Y., Mao Y.
Mol. Biol. (Mosk.) 40:808-815(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), TISSUE SPECIFICITY.
[2]"The DNA sequence and comparative analysis of human chromosome 5."
Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S. expand/collapse author list , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
Tissue: Lung.
[4]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-681 (ISOFORM 5), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-666 (ISOFORM 2).
Tissue: Brain and Thymus.
[5]"Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro."
Nagase T., Ishikawa K., Nakajima D., Ohira M., Seki N., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
DNA Res. 4:141-150(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 490-2626 (ISOFORM 1).
Tissue: Brain.
[6]"N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB."
Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A., Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E., Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K., Aldabe R.
Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[7]"Structure of the Pdz domain of human Microtubule Associated Serine-Threonine Kinase 4."
Structural genomics consortium (SGC)
Submitted (MAY-2009) to the PDB data bank
Cited for: X-RAY CRYSTALLOGRAPHY (1.60 ANGSTROMS) OF 1143-1234.
[8]"Patterns of somatic mutation in human cancer genomes."
Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. expand/collapse author list , Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.
Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANTS [LARGE SCALE ANALYSIS] ARG-923; TRP-1957; LEU-2201; CYS-2293 AND ASP-2470.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY830839 mRNA. Translation: AAW52510.1.
AC008872 Genomic DNA. No translation available.
AC008920 Genomic DNA. No translation available.
AC016634 Genomic DNA. No translation available.
AC034208 Genomic DNA. No translation available.
AC044799 Genomic DNA. No translation available.
AC092349 Genomic DNA. No translation available.
AC092373 Genomic DNA. No translation available.
AC113365 Genomic DNA. No translation available.
BC033215 mRNA. Translation: AAH33215.1.
AK057601 mRNA. Translation: BAB71532.1.
AK131421 mRNA. No translation available.
AB002301 mRNA. Translation: BAA20762.1.
CCDSCCDS47224.1. [O15021-4]
CCDS47225.1. [O15021-3]
RefSeqNP_001277155.1. NM_001290226.1.
NP_001277157.1. NM_001290228.1.
NP_055998.1. NM_015183.2. [O15021-3]
NP_942123.1. NM_198828.2. [O15021-4]
XP_006714668.1. XM_006714605.1. [O15021-2]
XP_006714669.1. XM_006714606.1. [O15021-2]
UniGeneHs.595458.
Hs.732793.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
2W7RX-ray1.60A/B1143-1234[»]
ProteinModelPortalO15021.
SMRO15021. Positions 384-484, 1143-1234.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid131980. 1 interaction.
IntActO15021. 2 interactions.
MINTMINT-1184694.
STRING9606.ENSP00000384313.

Chemistry

ChEMBLCHEMBL2417351.

PTM databases

PhosphoSiteO15021.

Proteomic databases

MaxQBO15021.
PaxDbO15021.
PRIDEO15021.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000261569; ENSP00000261569; ENSG00000069020. [O15021-2]
ENST00000403666; ENSP00000384313; ENSG00000069020. [O15021-3]
ENST00000406374; ENSP00000385088; ENSG00000069020. [O15021-4]
GeneID375449.
KEGGhsa:375449.
UCSCuc003jur.4. human. [O15021-4]
uc003jut.2. human. [O15021-3]
uc003juw.3. human. [O15021-2]

Organism-specific databases

CTD375449.
GeneCardsGC05P065892.
H-InvDBHIX0004913.
HIX0164541.
HGNCHGNC:19037. MAST4.
HPAHPA000544.
neXtProtNX_O15021.
PharmGKBPA134920494.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG0515.
HOGENOMHOG000074100.
HOVERGENHBG108118.
KOK08789.
PhylomeDBO15021.

Enzyme and pathway databases

SignaLinkO15021.

Gene expression databases

ArrayExpressO15021.
BgeeO15021.
CleanExHS_MAST4.
GenevestigatorO15021.

Family and domain databases

Gene3D1.20.1480.20. 1 hit.
2.30.42.10. 1 hit.
InterProIPR000961. AGC-kinase_C.
IPR011009. Kinase-like_dom.
IPR015022. MA_Ser/Thr_Kinase_dom.
IPR023142. MAST_pre-PK_dom.
IPR001478. PDZ.
IPR000719. Prot_kinase_dom.
IPR002290. Ser/Thr_dual-sp_kinase_dom.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamPF08926. DUF1908. 1 hit.
PF00595. PDZ. 1 hit.
PF00069. Pkinase. 1 hit.
[Graphical view]
SMARTSM00228. PDZ. 1 hit.
SM00133. S_TK_X. 1 hit.
SM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMSSF140482. SSF140482. 1 hit.
SSF50156. SSF50156. 1 hit.
SSF56112. SSF56112. 1 hit.
PROSITEPS51285. AGC_KINASE_CTER. 1 hit.
PS50106. PDZ. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSMAST4. human.
EvolutionaryTraceO15021.
GenomeRNAi375449.
NextBio100512.
PROO15021.

Entry information

Entry nameMAST4_HUMAN
AccessionPrimary (citable) accession number: O15021
Secondary accession number(s): A6NL49 expand/collapse secondary AC list , B5ME48, Q05EE6, Q6ZN07, Q8N4X4, Q96LY3
Entry history
Integrated into UniProtKB/Swiss-Prot: October 3, 2006
Last sequence update: November 25, 2008
Last modified: July 9, 2014
This is version 121 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human and mouse protein kinases

Human and mouse protein kinases: classification and index

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 5

Human chromosome 5: entries, gene names and cross-references to MIM