Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Microtubule-associated serine/threonine-protein kinase 4

Gene

MAST4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.

Cofactori

Mg2+By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei602ATPPROSITE-ProRule annotation1
Active sitei696Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi579 – 587ATPPROSITE-ProRule annotation9

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Kinase, Serine/threonine-protein kinase, Transferase

Keywords - Ligandi

ATP-binding, Magnesium, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyciZFISH:HS00954-MONOMER.
SignaLinkiO15021.

Names & Taxonomyi

Protein namesi
Recommended name:
Microtubule-associated serine/threonine-protein kinase 4 (EC:2.7.11.1)
Gene namesi
Name:MAST4
Synonyms:KIAA0303
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

HGNCiHGNC:19037. MAST4.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi375449.
OpenTargetsiENSG00000069020.
PharmGKBiPA134920494.

Chemistry databases

ChEMBLiCHEMBL2417351.

Polymorphism and mutation databases

BioMutaiMAST4.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002522561 – 2626Microtubule-associated serine/threonine-protein kinase 4Add BLAST2626

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei206PhosphoserineBy similarity1
Modified residuei213PhosphoserineBy similarity1
Modified residuei270PhosphoserineCombined sources1
Modified residuei917PhosphoserineCombined sources1
Modified residuei1295PhosphoserineBy similarity1
Modified residuei1373PhosphoserineCombined sources1
Modified residuei1387PhosphoserineCombined sources1
Modified residuei1400PhosphoserineBy similarity1
Modified residuei1422PhosphoserineCombined sources1
Modified residuei1470PhosphoserineCombined sources1
Modified residuei1526PhosphoserineCombined sources1
Modified residuei1782PhosphoserineCombined sources1
Modified residuei1825PhosphoserineCombined sources1
Modified residuei1912PhosphoserineCombined sources1
Modified residuei2445PhosphoserineCombined sources1
Modified residuei2523PhosphoserineCombined sources1
Modified residuei2555PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiO15021.
PeptideAtlasiO15021.
PRIDEiO15021.

PTM databases

iPTMnetiO15021.
PhosphoSitePlusiO15021.

Expressioni

Tissue specificityi

Highly expressed in most normal human tissues, with an exception of in testis, small intestine, colon and peripheral blood leukocyte.1 Publication

Gene expression databases

BgeeiENSG00000069020.
CleanExiHS_MAST4.
ExpressionAtlasiO15021. baseline and differential.
GenevisibleiO15021. HS.

Organism-specific databases

HPAiHPA000544.

Interactioni

Protein-protein interaction databases

BioGridi131980. 1 interactor.
IntActiO15021. 2 interactors.
MINTiMINT-1184694.
STRINGi9606.ENSP00000385727.

Structurei

Secondary structure

12626
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi1145 – 1148Combined sources4
Beta strandi1156 – 1164Combined sources9
Beta strandi1171 – 1180Combined sources10
Helixi1185 – 1189Combined sources5
Beta strandi1196 – 1200Combined sources5
Helixi1210 – 1218Combined sources9
Turni1219 – 1222Combined sources4
Beta strandi1223 – 1229Combined sources7

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2W7RX-ray1.60A/B1143-1234[»]
ProteinModelPortaliO15021.
SMRiO15021.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO15021.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini573 – 846Protein kinasePROSITE-ProRule annotationAdd BLAST274
Domaini847 – 919AGC-kinase C-terminalAdd BLAST73
Domaini1144 – 1232PDZPROSITE-ProRule annotationAdd BLAST89

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi1026 – 1140Ser-richAdd BLAST115
Compositional biasi1284 – 1346Ser-richAdd BLAST63
Compositional biasi2128 – 2211Pro-richAdd BLAST84

Sequence similaritiesi

Contains 1 AGC-kinase C-terminal domain.Curated
Contains 1 PDZ (DHR) domain.PROSITE-ProRule annotation
Contains 1 protein kinase domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG0606. Eukaryota.
ENOG410XPWX. LUCA.
GeneTreeiENSGT00530000063286.
HOGENOMiHOG000074100.
HOVERGENiHBG108118.
InParanoidiO15021.
KOiK08789.
PhylomeDBiO15021.

Family and domain databases

Gene3Di1.20.1480.20. 1 hit.
2.30.42.10. 1 hit.
InterProiIPR000961. AGC-kinase_C.
IPR011009. Kinase-like_dom.
IPR015022. MA_Ser/Thr_Kinase_dom.
IPR023142. MAST_pre-PK_dom.
IPR001478. PDZ.
IPR000719. Prot_kinase_dom.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamiPF08926. DUF1908. 1 hit.
PF00595. PDZ. 1 hit.
PF00069. Pkinase. 1 hit.
[Graphical view]
SMARTiSM00228. PDZ. 1 hit.
SM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMiSSF140482. SSF140482. 1 hit.
SSF50156. SSF50156. 1 hit.
SSF56112. SSF56112. 1 hit.
PROSITEiPS51285. AGC_KINASE_CTER. 1 hit.
PS50106. PDZ. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O15021-5) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGEKVSEAPE PVPRGCSGHG SRTPASALVA ASSPGASSAE SSSGSETLSE
60 70 80 90 100
EGEPGGFSRE HQPPPPPPLG GTLGARAPAA WAPASVLLER GVLALPPPLP
110 120 130 140 150
GGAVPPAPRG SSASQEEQDE ELDHILSPPP MPFRKCSNPD VASGPGKSLK
160 170 180 190 200
YKRQLSEDGR QLRRGSLGGA LTGRYLLPNP VAGQAWPASA ETSNLVRMRS
210 220 230 240 250
QALGQSAPSL TASLKELSLP RRGSLCRTSN RKSLIGNGQS PALPRPHSPL
260 270 280 290 300
SAHAGNSPQD SPRNFSPSAS AHFSFARSLN RTDGRRWSLA SLPSSGYGTN
310 320 330 340 350
TPSSTVSSSC SSQEKLHQLP YQPTPDELHF LSKHFCTTES IATENRCRNT
360 370 380 390 400
PMRPRSRSLS PGRSPACCDH EIIMMNHVYK ERFPKATAQM EERLKEIITS
410 420 430 440 450
YSPDNVLPLA DGVLSFTHHQ IIELARDCLD KSHQGLITSR YFLELQHKLD
460 470 480 490 500
KLLQEAHDRS ESGELAFIKQ LVRKILIVIA RPARLLECLE FDPEEFYYLL
510 520 530 540 550
EAAEGHAKEG QGIKTDIPRY IISQLGLNKD PLEEMAHLGN YDSGTAETPE
560 570 580 590 600
TDESVSSSNA SLKLRRKPRE SDFETIKLIS NGAYGAVYFV RHKESRQRFA
610 620 630 640 650
MKKINKQNLI LRNQIQQAFV ERDILTFAEN PFVVSMYCSF ETRRHLCMVM
660 670 680 690 700
EYVEGGDCAT LMKNMGPLPV DMARMYFAET VLALEYLHNY GIVHRDLKPD
710 720 730 740 750
NLLVTSMGHI KLTDFGLSKV GLMSMTTNLY EGHIEKDARE FLDKQVCGTP
760 770 780 790 800
EYIAPEVILR QGYGKPVDWW AMGIILYEFL VGCVPFFGDT PEELFGQVIS
810 820 830 840 850
DEINWPEKDE APPPDAQDLI TLLLRQNPLE RLGTGGAYEV KQHRFFRSLD
860 870 880 890 900
WNSLLRQKAE FIPQLESEDD TSYFDTRSEK YHHMETEEED DTNDEDFNVE
910 920 930 940 950
IRQFSSCSHR FSKVFSSIDR ITQNSAEEKE DSVDKTKSTT LPSTETLSWS
960 970 980 990 1000
SEYSEMQQLS TSNSSDTESN RHKLSSGLLP KLAISTEGEQ DEAASCPGDP
1010 1020 1030 1040 1050
HEEPGKPALP PEECAQEEPE VTTPASTISS STLSVGSFSE HLDQINGRSE
1060 1070 1080 1090 1100
CVDSTDNSSK PSSEPASHMA RQRLESTEKK KISGKVTKSL SASALSLMIP
1110 1120 1130 1140 1150
GDMFAVSPLG SPMSPHSLSS DPSSSRDSSP SRDSSAASAS PHQPIVIHSS
1160 1170 1180 1190 1200
GKNYGFTIRA IRVYVGDSDI YTVHHIVWNV EEGSPACQAG LKAGDLITHI
1210 1220 1230 1240 1250
NGEPVHGLVH TEVIELLLKS GNKVSITTTP FENTSIKTGP ARRNSYKSRM
1260 1270 1280 1290 1300
VRRSKKSKKK ESLERRRSLF KKLAKQPSPL LHTSRSFSCL NRSLSSGESL
1310 1320 1330 1340 1350
PGSPTHSLSP RSPTPSYRST PDFPSGTNSS QSSSPSSSAP NSPAGSGHIR
1360 1370 1380 1390 1400
PSTLHGLAPK LGGQRYRSGR RKSAGNIPLS PLARTPSPTP QPTSPQRSPS
1410 1420 1430 1440 1450
PLLGHSLGNS KIAQAFPSKM HSPPTIVRHI VRPKSAEPPR SPLLKRVQSE
1460 1470 1480 1490 1500
EKLSPSYGSD KKHLCSRKHS LEVTQEEVQR EQSQREAPLQ SLDENVCDVP
1510 1520 1530 1540 1550
PLSRARPVEQ GCLKRPVSRK VGRQESVDDL DRDKLKAKVV VKKADGFPEK
1560 1570 1580 1590 1600
QESHQKSHGP GSDLENFALF KLEEREKKVY PKAVERSSTF ENKASMQEAP
1610 1620 1630 1640 1650
PLGSLLKDAL HKQASVRASE GAMSDGRVPA EHRQGGGDFR RAPAPGTLQD
1660 1670 1680 1690 1700
GLCHSLDRGI SGKGEGTEKS SQAKELLRCE KLDSKLANID YLRKKMSLED
1710 1720 1730 1740 1750
KEDNLCPVLK PKMTAGSHEC LPGNPVRPTG GQQEPPPASE SRAFVSSTHA
1760 1770 1780 1790 1800
AQMSAVSFVP LKALTGRVDS GTEKPGLVAP ESPVRKSPSE YKLEGRSVSC
1810 1820 1830 1840 1850
LKPIEGTLDI ALLSGPQASK TELPSPESAQ SPSPSGDVRA SVPPVLPSSS
1860 1870 1880 1890 1900
GKKNDTTSAR ELSPSSLKMN KSYLLEPWFL PPSRGLQNSP AVSLPDPEFK
1910 1920 1930 1940 1950
RDRKGPHPTA RSPGTVMESN PQQREGSSPK HQDHTTDPKL LTCLGQNLHS
1960 1970 1980 1990 2000
PDLARPRCPL PPEASPSREK PGLRESSERG PPTARSERSA ARADTCREPS
2010 2020 2030 2040 2050
MELCFPETAK TSDNSKNLLS VGRTHPDFYT QTQAMEKAWA PGGKTNHKDG
2060 2070 2080 2090 2100
PGEARPPPRD NSSLHSAGIP CEKELGKVRR GVEPKPEALL ARRSLQPPGI
2110 2120 2130 2140 2150
ESEKSEKLSS FPSLQKDGAK EPERKEQPLQ RHPSSIPPPP LTAKDLSSPA
2160 2170 2180 2190 2200
ARQHCSSPSH ASGREPGAKP STAEPSSSPQ DPPKPVAAHS ESSSHKPRPG
2210 2220 2230 2240 2250
PDPGPPKTKH PDRSLSSQKP SVGATKGKEP ATQSLGGSSR EGKGHSKSGP
2260 2270 2280 2290 2300
DVFPATPGSQ NKASDGIGQG EGGPSVPLHT DRAPLDAKPQ PTSGGRPLEV
2310 2320 2330 2340 2350
LEKPVHLPRP GHPGPSEPAD QKLSAVGEKQ TLSPKHPKPS TVKDCPTLCK
2360 2370 2380 2390 2400
QTDNRQTDKS PSQPAANTDR RAEGKKCTEA LYAPAEGDKL EAGLSFVHSE
2410 2420 2430 2440 2450
NRLKGAERPA AGVGKGFPEA RGKGPGPQKP PTEADKPNGM KRSPSATGQS
2460 2470 2480 2490 2500
SFRSTALPEK SLSCSSSFPE TRAGVREASA ASSDTSSAKA AGGMLELPAP
2510 2520 2530 2540 2550
SNRDHRKAQP AGEGRTHMTK SDSLPSFRVS TLPLESHHPD PNTMGGASHR
2560 2570 2580 2590 2600
DRALSVTATV GETKGKDPAP AQPPPARKQN VGRDVTKPSP APNTDRPISL
2610 2620
SNEKDFVVRQ RRGKESLRSS PHKKAL
Length:2,626
Mass (Da):284,378
Last modified:November 25, 2008 - v3
Checksum:i74198B02E112789B
GO
Isoform 2 (identifier: O15021-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-225: MGEKVSEAPE...ELSLPRRGSL → MDMSDPNFWTVLSNFTLPHLRSGNRLRRTQS
     278-280: Missing.

Note: No experimental confirmation available.
Show »
Length:2,429
Mass (Da):264,762
Checksum:i522EC091B431DA62
GO
Isoform 4 (identifier: O15021-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     226-250: CRTSNRKSLIGNGQSPALPRPHSPL → IDSQKWNCLVKRPVCPNAGRTSPLG
     251-2626: Missing.

Note: No experimental confirmation available.
Show »
Length:250
Mass (Da):25,702
Checksum:i8CAF56901F60C75F
GO
Isoform 5 (identifier: O15021-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-225: MGEKVSEAPE...ELSLPRRGSL → MKAQRERLQI...SPLLAFHFWS

Show »
Length:2,444
Mass (Da):266,119
Checksum:i63BEFB8FEAC67DDB
GO
Isoform 3 (identifier: O15021-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-225: MGEKVSEAPE...ELSLPRRGSL → MDESSILRRR...SQKWNCLVKR
     278-280: Missing.

Note: No experimental confirmation available.
Show »
Length:2,434
Mass (Da):265,354
Checksum:i7BE938C15BAA4014
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti665M → T in AK131421 (PubMed:14702039).Curated1
Sequence conflicti677 – 681FAETV → YIVKL in BAB71532 (PubMed:14702039).Curated5
Sequence conflicti1627R → P in AAW52510 (PubMed:17086981).Curated1
Sequence conflicti1627R → P in BAA20762 (PubMed:9205841).Curated1
Sequence conflicti1802K → E in AAW52510 (PubMed:17086981).Curated1
Sequence conflicti1802K → E in BAA20762 (PubMed:9205841).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05976877A → P.Corresponds to variant rs6867856dbSNPEnsembl.1
Natural variantiVAR_040787923Q → R.1 Publication1
Natural variantiVAR_0407881957R → W.1 Publication1
Natural variantiVAR_0407892201P → L.1 Publication1
Natural variantiVAR_0407902293S → C.1 Publication1
Natural variantiVAR_0407912470E → D in a lung squamous cell carcinoma sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0208881 – 225MGEKV…RRGSL → MDMSDPNFWTVLSNFTLPHL RSGNRLRRTQS in isoform 2. 1 PublicationAdd BLAST225
Alternative sequenceiVSP_0231091 – 225MGEKV…RRGSL → MDESSILRRRGLQKELSLPR RGSLIDSQKWNCLVKR in isoform 3. 1 PublicationAdd BLAST225
Alternative sequenceiVSP_0358511 – 225MGEKV…RRGSL → MKAQRERLQIPGLTLDLTPR SLSPTPSSPGSPCSPLLAFH FWS in isoform 5. 1 PublicationAdd BLAST225
Alternative sequenceiVSP_035852226 – 250CRTSN…PHSPL → IDSQKWNCLVKRPVCPNAGR TSPLG in isoform 4. 1 PublicationAdd BLAST25
Alternative sequenceiVSP_035853251 – 2626Missing in isoform 4. 1 PublicationAdd BLAST2376
Alternative sequenceiVSP_023110278 – 280Missing in isoform 2 and isoform 3. 2 Publications3

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY830839 mRNA. Translation: AAW52510.1.
AC008872 Genomic DNA. No translation available.
AC008920 Genomic DNA. No translation available.
AC016634 Genomic DNA. No translation available.
AC034208 Genomic DNA. No translation available.
AC044799 Genomic DNA. No translation available.
AC092349 Genomic DNA. No translation available.
AC092373 Genomic DNA. No translation available.
AC113365 Genomic DNA. No translation available.
BC033215 mRNA. Translation: AAH33215.1.
AK057601 mRNA. Translation: BAB71532.1.
AK131421 mRNA. No translation available.
AB002301 mRNA. Translation: BAA20762.1.
CCDSiCCDS47224.1. [O15021-4]
CCDS47225.1. [O15021-3]
CCDS75254.1. [O15021-2]
RefSeqiNP_001277155.1. NM_001290226.1.
NP_001277157.1. NM_001290228.1.
NP_001284580.1. NM_001297651.1. [O15021-2]
NP_055998.1. NM_015183.2. [O15021-3]
NP_942123.1. NM_198828.2. [O15021-4]
XP_006714669.1. XM_006714606.3. [O15021-2]
UniGeneiHs.595458.
Hs.732793.

Genome annotation databases

EnsembliENST00000261569; ENSP00000261569; ENSG00000069020. [O15021-2]
ENST00000403666; ENSP00000384313; ENSG00000069020. [O15021-3]
ENST00000406374; ENSP00000385088; ENSG00000069020. [O15021-4]
GeneIDi375449.
KEGGihsa:375449.
UCSCiuc003jur.5. human. [O15021-5]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY830839 mRNA. Translation: AAW52510.1.
AC008872 Genomic DNA. No translation available.
AC008920 Genomic DNA. No translation available.
AC016634 Genomic DNA. No translation available.
AC034208 Genomic DNA. No translation available.
AC044799 Genomic DNA. No translation available.
AC092349 Genomic DNA. No translation available.
AC092373 Genomic DNA. No translation available.
AC113365 Genomic DNA. No translation available.
BC033215 mRNA. Translation: AAH33215.1.
AK057601 mRNA. Translation: BAB71532.1.
AK131421 mRNA. No translation available.
AB002301 mRNA. Translation: BAA20762.1.
CCDSiCCDS47224.1. [O15021-4]
CCDS47225.1. [O15021-3]
CCDS75254.1. [O15021-2]
RefSeqiNP_001277155.1. NM_001290226.1.
NP_001277157.1. NM_001290228.1.
NP_001284580.1. NM_001297651.1. [O15021-2]
NP_055998.1. NM_015183.2. [O15021-3]
NP_942123.1. NM_198828.2. [O15021-4]
XP_006714669.1. XM_006714606.3. [O15021-2]
UniGeneiHs.595458.
Hs.732793.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2W7RX-ray1.60A/B1143-1234[»]
ProteinModelPortaliO15021.
SMRiO15021.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi131980. 1 interactor.
IntActiO15021. 2 interactors.
MINTiMINT-1184694.
STRINGi9606.ENSP00000385727.

Chemistry databases

ChEMBLiCHEMBL2417351.

PTM databases

iPTMnetiO15021.
PhosphoSitePlusiO15021.

Polymorphism and mutation databases

BioMutaiMAST4.

Proteomic databases

PaxDbiO15021.
PeptideAtlasiO15021.
PRIDEiO15021.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000261569; ENSP00000261569; ENSG00000069020. [O15021-2]
ENST00000403666; ENSP00000384313; ENSG00000069020. [O15021-3]
ENST00000406374; ENSP00000385088; ENSG00000069020. [O15021-4]
GeneIDi375449.
KEGGihsa:375449.
UCSCiuc003jur.5. human. [O15021-5]

Organism-specific databases

CTDi375449.
DisGeNETi375449.
GeneCardsiMAST4.
H-InvDBHIX0004913.
HIX0164541.
HGNCiHGNC:19037. MAST4.
HPAiHPA000544.
neXtProtiNX_O15021.
OpenTargetsiENSG00000069020.
PharmGKBiPA134920494.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0606. Eukaryota.
ENOG410XPWX. LUCA.
GeneTreeiENSGT00530000063286.
HOGENOMiHOG000074100.
HOVERGENiHBG108118.
InParanoidiO15021.
KOiK08789.
PhylomeDBiO15021.

Enzyme and pathway databases

BioCyciZFISH:HS00954-MONOMER.
SignaLinkiO15021.

Miscellaneous databases

ChiTaRSiMAST4. human.
EvolutionaryTraceiO15021.
GenomeRNAii375449.
PROiO15021.

Gene expression databases

BgeeiENSG00000069020.
CleanExiHS_MAST4.
ExpressionAtlasiO15021. baseline and differential.
GenevisibleiO15021. HS.

Family and domain databases

Gene3Di1.20.1480.20. 1 hit.
2.30.42.10. 1 hit.
InterProiIPR000961. AGC-kinase_C.
IPR011009. Kinase-like_dom.
IPR015022. MA_Ser/Thr_Kinase_dom.
IPR023142. MAST_pre-PK_dom.
IPR001478. PDZ.
IPR000719. Prot_kinase_dom.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamiPF08926. DUF1908. 1 hit.
PF00595. PDZ. 1 hit.
PF00069. Pkinase. 1 hit.
[Graphical view]
SMARTiSM00228. PDZ. 1 hit.
SM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMiSSF140482. SSF140482. 1 hit.
SSF50156. SSF50156. 1 hit.
SSF56112. SSF56112. 1 hit.
PROSITEiPS51285. AGC_KINASE_CTER. 1 hit.
PS50106. PDZ. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiMAST4_HUMAN
AccessioniPrimary (citable) accession number: O15021
Secondary accession number(s): A6NL49
, B5ME48, Q05EE6, Q6ZN07, Q8N4X4, Q96LY3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 3, 2006
Last sequence update: November 25, 2008
Last modified: November 2, 2016
This is version 140 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.