SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O15021

- MAST4_HUMAN

UniProt

O15021 - MAST4_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Microtubule-associated serine/threonine-protein kinase 4

Gene
MAST4, KIAA0303
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.

Cofactori

Magnesium By similarity.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei602 – 6021ATP By similarity
Active sitei696 – 6961Proton acceptor By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi579 – 5879ATP By similarity

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. magnesium ion binding Source: InterPro
  3. protein serine/threonine kinase activity Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Kinase, Serine/threonine-protein kinase, Transferase

Keywords - Ligandi

ATP-binding, Magnesium, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

SignaLinkiO15021.

Names & Taxonomyi

Protein namesi
Recommended name:
Microtubule-associated serine/threonine-protein kinase 4 (EC:2.7.11.1)
Gene namesi
Name:MAST4
Synonyms:KIAA0303
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 5

Organism-specific databases

HGNCiHGNC:19037. MAST4.

Subcellular locationi

Cytoplasm Reviewed prediction

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134920494.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 26262626Microtubule-associated serine/threonine-protein kinase 4PRO_0000252256Add
BLAST

Proteomic databases

MaxQBiO15021.
PaxDbiO15021.
PRIDEiO15021.

PTM databases

PhosphoSiteiO15021.

Expressioni

Tissue specificityi

Highly expressed in most normal human tissues, with an exception of in testis, small intestine, colon and peripheral blood leukocyte.1 Publication

Gene expression databases

ArrayExpressiO15021.
BgeeiO15021.
CleanExiHS_MAST4.
GenevestigatoriO15021.

Organism-specific databases

HPAiHPA000544.

Interactioni

Protein-protein interaction databases

BioGridi131980. 1 interaction.
IntActiO15021. 2 interactions.
MINTiMINT-1184694.
STRINGi9606.ENSP00000384313.

Structurei

Secondary structure

1
2626
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi1145 – 11484
Beta strandi1156 – 11649
Beta strandi1171 – 118010
Helixi1185 – 11895
Beta strandi1196 – 12005
Helixi1210 – 12189
Turni1219 – 12224
Beta strandi1223 – 12297

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2W7RX-ray1.60A/B1143-1234[»]
ProteinModelPortaliO15021.
SMRiO15021. Positions 384-484, 1143-1234.

Miscellaneous databases

EvolutionaryTraceiO15021.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini573 – 846274Protein kinaseAdd
BLAST
Domaini847 – 91973AGC-kinase C-terminalAdd
BLAST
Domaini1144 – 123289PDZAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi1026 – 1140115Ser-richAdd
BLAST
Compositional biasi1284 – 134663Ser-richAdd
BLAST
Compositional biasi2128 – 221184Pro-richAdd
BLAST

Sequence similaritiesi

Contains 1 PDZ (DHR) domain.

Phylogenomic databases

eggNOGiCOG0515.
HOGENOMiHOG000074100.
HOVERGENiHBG108118.
KOiK08789.
PhylomeDBiO15021.

Family and domain databases

Gene3Di1.20.1480.20. 1 hit.
2.30.42.10. 1 hit.
InterProiIPR000961. AGC-kinase_C.
IPR011009. Kinase-like_dom.
IPR015022. MA_Ser/Thr_Kinase_dom.
IPR023142. MAST_pre-PK_dom.
IPR001478. PDZ.
IPR000719. Prot_kinase_dom.
IPR002290. Ser/Thr_dual-sp_kinase_dom.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamiPF08926. DUF1908. 1 hit.
PF00595. PDZ. 1 hit.
PF00069. Pkinase. 1 hit.
[Graphical view]
SMARTiSM00228. PDZ. 1 hit.
SM00133. S_TK_X. 1 hit.
SM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMiSSF140482. SSF140482. 1 hit.
SSF50156. SSF50156. 1 hit.
SSF56112. SSF56112. 1 hit.
PROSITEiPS51285. AGC_KINASE_CTER. 1 hit.
PS50106. PDZ. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O15021-5) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MGEKVSEAPE PVPRGCSGHG SRTPASALVA ASSPGASSAE SSSGSETLSE     50
EGEPGGFSRE HQPPPPPPLG GTLGARAPAA WAPASVLLER GVLALPPPLP 100
GGAVPPAPRG SSASQEEQDE ELDHILSPPP MPFRKCSNPD VASGPGKSLK 150
YKRQLSEDGR QLRRGSLGGA LTGRYLLPNP VAGQAWPASA ETSNLVRMRS 200
QALGQSAPSL TASLKELSLP RRGSLCRTSN RKSLIGNGQS PALPRPHSPL 250
SAHAGNSPQD SPRNFSPSAS AHFSFARSLN RTDGRRWSLA SLPSSGYGTN 300
TPSSTVSSSC SSQEKLHQLP YQPTPDELHF LSKHFCTTES IATENRCRNT 350
PMRPRSRSLS PGRSPACCDH EIIMMNHVYK ERFPKATAQM EERLKEIITS 400
YSPDNVLPLA DGVLSFTHHQ IIELARDCLD KSHQGLITSR YFLELQHKLD 450
KLLQEAHDRS ESGELAFIKQ LVRKILIVIA RPARLLECLE FDPEEFYYLL 500
EAAEGHAKEG QGIKTDIPRY IISQLGLNKD PLEEMAHLGN YDSGTAETPE 550
TDESVSSSNA SLKLRRKPRE SDFETIKLIS NGAYGAVYFV RHKESRQRFA 600
MKKINKQNLI LRNQIQQAFV ERDILTFAEN PFVVSMYCSF ETRRHLCMVM 650
EYVEGGDCAT LMKNMGPLPV DMARMYFAET VLALEYLHNY GIVHRDLKPD 700
NLLVTSMGHI KLTDFGLSKV GLMSMTTNLY EGHIEKDARE FLDKQVCGTP 750
EYIAPEVILR QGYGKPVDWW AMGIILYEFL VGCVPFFGDT PEELFGQVIS 800
DEINWPEKDE APPPDAQDLI TLLLRQNPLE RLGTGGAYEV KQHRFFRSLD 850
WNSLLRQKAE FIPQLESEDD TSYFDTRSEK YHHMETEEED DTNDEDFNVE 900
IRQFSSCSHR FSKVFSSIDR ITQNSAEEKE DSVDKTKSTT LPSTETLSWS 950
SEYSEMQQLS TSNSSDTESN RHKLSSGLLP KLAISTEGEQ DEAASCPGDP 1000
HEEPGKPALP PEECAQEEPE VTTPASTISS STLSVGSFSE HLDQINGRSE 1050
CVDSTDNSSK PSSEPASHMA RQRLESTEKK KISGKVTKSL SASALSLMIP 1100
GDMFAVSPLG SPMSPHSLSS DPSSSRDSSP SRDSSAASAS PHQPIVIHSS 1150
GKNYGFTIRA IRVYVGDSDI YTVHHIVWNV EEGSPACQAG LKAGDLITHI 1200
NGEPVHGLVH TEVIELLLKS GNKVSITTTP FENTSIKTGP ARRNSYKSRM 1250
VRRSKKSKKK ESLERRRSLF KKLAKQPSPL LHTSRSFSCL NRSLSSGESL 1300
PGSPTHSLSP RSPTPSYRST PDFPSGTNSS QSSSPSSSAP NSPAGSGHIR 1350
PSTLHGLAPK LGGQRYRSGR RKSAGNIPLS PLARTPSPTP QPTSPQRSPS 1400
PLLGHSLGNS KIAQAFPSKM HSPPTIVRHI VRPKSAEPPR SPLLKRVQSE 1450
EKLSPSYGSD KKHLCSRKHS LEVTQEEVQR EQSQREAPLQ SLDENVCDVP 1500
PLSRARPVEQ GCLKRPVSRK VGRQESVDDL DRDKLKAKVV VKKADGFPEK 1550
QESHQKSHGP GSDLENFALF KLEEREKKVY PKAVERSSTF ENKASMQEAP 1600
PLGSLLKDAL HKQASVRASE GAMSDGRVPA EHRQGGGDFR RAPAPGTLQD 1650
GLCHSLDRGI SGKGEGTEKS SQAKELLRCE KLDSKLANID YLRKKMSLED 1700
KEDNLCPVLK PKMTAGSHEC LPGNPVRPTG GQQEPPPASE SRAFVSSTHA 1750
AQMSAVSFVP LKALTGRVDS GTEKPGLVAP ESPVRKSPSE YKLEGRSVSC 1800
LKPIEGTLDI ALLSGPQASK TELPSPESAQ SPSPSGDVRA SVPPVLPSSS 1850
GKKNDTTSAR ELSPSSLKMN KSYLLEPWFL PPSRGLQNSP AVSLPDPEFK 1900
RDRKGPHPTA RSPGTVMESN PQQREGSSPK HQDHTTDPKL LTCLGQNLHS 1950
PDLARPRCPL PPEASPSREK PGLRESSERG PPTARSERSA ARADTCREPS 2000
MELCFPETAK TSDNSKNLLS VGRTHPDFYT QTQAMEKAWA PGGKTNHKDG 2050
PGEARPPPRD NSSLHSAGIP CEKELGKVRR GVEPKPEALL ARRSLQPPGI 2100
ESEKSEKLSS FPSLQKDGAK EPERKEQPLQ RHPSSIPPPP LTAKDLSSPA 2150
ARQHCSSPSH ASGREPGAKP STAEPSSSPQ DPPKPVAAHS ESSSHKPRPG 2200
PDPGPPKTKH PDRSLSSQKP SVGATKGKEP ATQSLGGSSR EGKGHSKSGP 2250
DVFPATPGSQ NKASDGIGQG EGGPSVPLHT DRAPLDAKPQ PTSGGRPLEV 2300
LEKPVHLPRP GHPGPSEPAD QKLSAVGEKQ TLSPKHPKPS TVKDCPTLCK 2350
QTDNRQTDKS PSQPAANTDR RAEGKKCTEA LYAPAEGDKL EAGLSFVHSE 2400
NRLKGAERPA AGVGKGFPEA RGKGPGPQKP PTEADKPNGM KRSPSATGQS 2450
SFRSTALPEK SLSCSSSFPE TRAGVREASA ASSDTSSAKA AGGMLELPAP 2500
SNRDHRKAQP AGEGRTHMTK SDSLPSFRVS TLPLESHHPD PNTMGGASHR 2550
DRALSVTATV GETKGKDPAP AQPPPARKQN VGRDVTKPSP APNTDRPISL 2600
SNEKDFVVRQ RRGKESLRSS PHKKAL 2626
Length:2,626
Mass (Da):284,378
Last modified:November 25, 2008 - v3
Checksum:i74198B02E112789B
GO
Isoform 2 (identifier: O15021-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-225: MGEKVSEAPE...ELSLPRRGSL → MDMSDPNFWTVLSNFTLPHLRSGNRLRRTQS
     278-280: Missing.

Note: No experimental confirmation available.

Show »
Length:2,429
Mass (Da):264,762
Checksum:i522EC091B431DA62
GO
Isoform 4 (identifier: O15021-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     226-250: CRTSNRKSLIGNGQSPALPRPHSPL → IDSQKWNCLVKRPVCPNAGRTSPLG
     251-2626: Missing.

Note: No experimental confirmation available.

Show »
Length:250
Mass (Da):25,702
Checksum:i8CAF56901F60C75F
GO
Isoform 5 (identifier: O15021-1) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-225: MGEKVSEAPE...ELSLPRRGSL → MKAQRERLQI...SPLLAFHFWS

Show »
Length:2,444
Mass (Da):266,119
Checksum:i63BEFB8FEAC67DDB
GO
Isoform 3 (identifier: O15021-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-225: MGEKVSEAPE...ELSLPRRGSL → MDESSILRRR...SQKWNCLVKR
     278-280: Missing.

Note: No experimental confirmation available.

Show »
Length:2,434
Mass (Da):265,354
Checksum:i7BE938C15BAA4014
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti77 – 771A → P.
Corresponds to variant rs6867856 [ dbSNP | Ensembl ].
VAR_059768
Natural varianti923 – 9231Q → R.1 Publication
VAR_040787
Natural varianti1957 – 19571R → W.1 Publication
VAR_040788
Natural varianti2201 – 22011P → L.1 Publication
VAR_040789
Natural varianti2293 – 22931S → C.1 Publication
VAR_040790
Natural varianti2470 – 24701E → D in a lung squamous cell carcinoma sample; somatic mutation. 1 Publication
VAR_040791

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 225225MGEKV…RRGSL → MDMSDPNFWTVLSNFTLPHL RSGNRLRRTQS in isoform 2. VSP_020888Add
BLAST
Alternative sequencei1 – 225225MGEKV…RRGSL → MDESSILRRRGLQKELSLPR RGSLIDSQKWNCLVKR in isoform 3. VSP_023109Add
BLAST
Alternative sequencei1 – 225225MGEKV…RRGSL → MKAQRERLQIPGLTLDLTPR SLSPTPSSPGSPCSPLLAFH FWS in isoform 5. VSP_035851Add
BLAST
Alternative sequencei226 – 25025CRTSN…PHSPL → IDSQKWNCLVKRPVCPNAGR TSPLG in isoform 4. VSP_035852Add
BLAST
Alternative sequencei251 – 26262376Missing in isoform 4. VSP_035853Add
BLAST
Alternative sequencei278 – 2803Missing in isoform 2 and isoform 3. VSP_023110

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti665 – 6651M → T in AK131421. 1 Publication
Sequence conflicti677 – 6815FAETV → YIVKL in BAB71532. 1 Publication
Sequence conflicti1627 – 16271R → P in AAW52510. 1 Publication
Sequence conflicti1627 – 16271R → P in BAA20762. 1 Publication
Sequence conflicti1802 – 18021K → E in AAW52510. 1 Publication
Sequence conflicti1802 – 18021K → E in BAA20762. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY830839 mRNA. Translation: AAW52510.1.
AC008872 Genomic DNA. No translation available.
AC008920 Genomic DNA. No translation available.
AC016634 Genomic DNA. No translation available.
AC034208 Genomic DNA. No translation available.
AC044799 Genomic DNA. No translation available.
AC092349 Genomic DNA. No translation available.
AC092373 Genomic DNA. No translation available.
AC113365 Genomic DNA. No translation available.
BC033215 mRNA. Translation: AAH33215.1.
AK057601 mRNA. Translation: BAB71532.1.
AK131421 mRNA. No translation available.
AB002301 mRNA. Translation: BAA20762.1.
CCDSiCCDS47224.1. [O15021-4]
CCDS47225.1. [O15021-3]
RefSeqiNP_001277155.1. NM_001290226.1.
NP_001277157.1. NM_001290228.1.
NP_055998.1. NM_015183.2. [O15021-3]
NP_942123.1. NM_198828.2. [O15021-4]
XP_006714668.1. XM_006714605.1. [O15021-2]
XP_006714669.1. XM_006714606.1. [O15021-2]
UniGeneiHs.595458.
Hs.732793.

Genome annotation databases

EnsembliENST00000261569; ENSP00000261569; ENSG00000069020. [O15021-2]
ENST00000403666; ENSP00000384313; ENSG00000069020. [O15021-3]
ENST00000406374; ENSP00000385088; ENSG00000069020. [O15021-4]
GeneIDi375449.
KEGGihsa:375449.
UCSCiuc003jur.4. human. [O15021-4]
uc003jut.2. human. [O15021-3]
uc003juw.3. human. [O15021-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY830839 mRNA. Translation: AAW52510.1 .
AC008872 Genomic DNA. No translation available.
AC008920 Genomic DNA. No translation available.
AC016634 Genomic DNA. No translation available.
AC034208 Genomic DNA. No translation available.
AC044799 Genomic DNA. No translation available.
AC092349 Genomic DNA. No translation available.
AC092373 Genomic DNA. No translation available.
AC113365 Genomic DNA. No translation available.
BC033215 mRNA. Translation: AAH33215.1 .
AK057601 mRNA. Translation: BAB71532.1 .
AK131421 mRNA. No translation available.
AB002301 mRNA. Translation: BAA20762.1 .
CCDSi CCDS47224.1. [O15021-4 ]
CCDS47225.1. [O15021-3 ]
RefSeqi NP_001277155.1. NM_001290226.1.
NP_001277157.1. NM_001290228.1.
NP_055998.1. NM_015183.2. [O15021-3 ]
NP_942123.1. NM_198828.2. [O15021-4 ]
XP_006714668.1. XM_006714605.1. [O15021-2 ]
XP_006714669.1. XM_006714606.1. [O15021-2 ]
UniGenei Hs.595458.
Hs.732793.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2W7R X-ray 1.60 A/B 1143-1234 [» ]
ProteinModelPortali O15021.
SMRi O15021. Positions 384-484, 1143-1234.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 131980. 1 interaction.
IntActi O15021. 2 interactions.
MINTi MINT-1184694.
STRINGi 9606.ENSP00000384313.

Chemistry

ChEMBLi CHEMBL2417351.

PTM databases

PhosphoSitei O15021.

Proteomic databases

MaxQBi O15021.
PaxDbi O15021.
PRIDEi O15021.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000261569 ; ENSP00000261569 ; ENSG00000069020 . [O15021-2 ]
ENST00000403666 ; ENSP00000384313 ; ENSG00000069020 . [O15021-3 ]
ENST00000406374 ; ENSP00000385088 ; ENSG00000069020 . [O15021-4 ]
GeneIDi 375449.
KEGGi hsa:375449.
UCSCi uc003jur.4. human. [O15021-4 ]
uc003jut.2. human. [O15021-3 ]
uc003juw.3. human. [O15021-2 ]

Organism-specific databases

CTDi 375449.
GeneCardsi GC05P065892.
H-InvDB HIX0004913.
HIX0164541.
HGNCi HGNC:19037. MAST4.
HPAi HPA000544.
neXtProti NX_O15021.
PharmGKBi PA134920494.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0515.
HOGENOMi HOG000074100.
HOVERGENi HBG108118.
KOi K08789.
PhylomeDBi O15021.

Enzyme and pathway databases

SignaLinki O15021.

Miscellaneous databases

ChiTaRSi MAST4. human.
EvolutionaryTracei O15021.
GenomeRNAii 375449.
NextBioi 100512.
PROi O15021.

Gene expression databases

ArrayExpressi O15021.
Bgeei O15021.
CleanExi HS_MAST4.
Genevestigatori O15021.

Family and domain databases

Gene3Di 1.20.1480.20. 1 hit.
2.30.42.10. 1 hit.
InterProi IPR000961. AGC-kinase_C.
IPR011009. Kinase-like_dom.
IPR015022. MA_Ser/Thr_Kinase_dom.
IPR023142. MAST_pre-PK_dom.
IPR001478. PDZ.
IPR000719. Prot_kinase_dom.
IPR002290. Ser/Thr_dual-sp_kinase_dom.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view ]
Pfami PF08926. DUF1908. 1 hit.
PF00595. PDZ. 1 hit.
PF00069. Pkinase. 1 hit.
[Graphical view ]
SMARTi SM00228. PDZ. 1 hit.
SM00133. S_TK_X. 1 hit.
SM00220. S_TKc. 1 hit.
[Graphical view ]
SUPFAMi SSF140482. SSF140482. 1 hit.
SSF50156. SSF50156. 1 hit.
SSF56112. SSF56112. 1 hit.
PROSITEi PS51285. AGC_KINASE_CTER. 1 hit.
PS50106. PDZ. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of a novel human MAST4 gene, a new member of the microtubule associated serine-threonine kinase family."
    Sun L., Gu S., Li X., Sun Y., Zheng D., Yu K., Ji C., Tang R., Xie Y., Mao Y.
    Mol. Biol. (Mosk.) 40:808-815(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), TISSUE SPECIFICITY.
  2. "The DNA sequence and comparative analysis of human chromosome 5."
    Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.
    , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
    Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Lung.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-681 (ISOFORM 5), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-666 (ISOFORM 2).
    Tissue: Brain and Thymus.
  5. "Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro."
    Nagase T., Ishikawa K., Nakajima D., Ohira M., Seki N., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
    DNA Res. 4:141-150(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 490-2626 (ISOFORM 1).
    Tissue: Brain.
  6. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  7. "Structure of the Pdz domain of human Microtubule Associated Serine-Threonine Kinase 4."
    Structural genomics consortium (SGC)
    Submitted (MAY-2009) to the PDB data bank
    Cited for: X-RAY CRYSTALLOGRAPHY (1.60 ANGSTROMS) OF 1143-1234.
  8. "Patterns of somatic mutation in human cancer genomes."
    Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G.
    , Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.
    Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS [LARGE SCALE ANALYSIS] ARG-923; TRP-1957; LEU-2201; CYS-2293 AND ASP-2470.

Entry informationi

Entry nameiMAST4_HUMAN
AccessioniPrimary (citable) accession number: O15021
Secondary accession number(s): A6NL49
, B5ME48, Q05EE6, Q6ZN07, Q8N4X4, Q96LY3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 3, 2006
Last sequence update: November 25, 2008
Last modified: July 9, 2014
This is version 121 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi