O15021 (MAST4_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 109.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Microtubule-associated serine/threonine-protein kinase 4 EC=2.7.11.1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 2626 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. |
| Cofactor | Magnesium By similarity. |
| Subcellular location | Cytoplasm Potential. |
| Tissue specificity | Highly expressed in most normal human tissues, with an exception of in testis, small intestine, colon and peripheral blood leukocyte. Ref.1 |
| Sequence similarities | Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. Contains 1 AGC-kinase C-terminal domain. Contains 1 PDZ (DHR) domain. Contains 1 protein kinase domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | ATP-binding Magnesium Metal-binding Nucleotide-binding |
| Molecular function | Kinase Serine/threonine-protein kinase Transferase |
| PTM | Phosphoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW magnesium ion bindingInferred from electronic annotation. Source: InterPro protein serine/threonine kinase activityInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O15021-5) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O15021-2) The sequence of this isoform differs from the canonical sequence as follows: 1-225: MGEKVSEAPE...ELSLPRRGSL → MDMSDPNFWTVLSNFTLPHLRSGNRLRRTQS 278-280: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: O15021-4) The sequence of this isoform differs from the canonical sequence as follows: 226-250: CRTSNRKSLIGNGQSPALPRPHSPL → IDSQKWNCLVKRPVCPNAGRTSPLG 251-2626: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 5 (identifier: O15021-1) The sequence of this isoform differs from the canonical sequence as follows: 1-225: MGEKVSEAPE...ELSLPRRGSL → MKAQRERLQI...SPLLAFHFWS | ||||||
| Isoform 3 (identifier: O15021-3) The sequence of this isoform differs from the canonical sequence as follows: 1-225: MGEKVSEAPE...ELSLPRRGSL → MDESSILRRR...SQKWNCLVKR 278-280: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||
Molecule processing | |||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 2626 | 2626 | Microtubule-associated serine/threonine-protein kinase 4 | PRO_0000252256 | |||||||||||||||||||
Regions | |||||||||||||||||||||||
| Domain | 573 – 846 | 274 | Protein kinase | ||||||||||||||||||||
| Domain | 847 – 919 | 73 | AGC-kinase C-terminal | ||||||||||||||||||||
| Domain | 1144 – 1232 | 89 | PDZ | ||||||||||||||||||||
| Nucleotide binding | 579 – 587 | 9 | ATP By similarity | ||||||||||||||||||||
| Compositional bias | 1026 – 1140 | 115 | Ser-rich | ||||||||||||||||||||
| Compositional bias | 1284 – 1346 | 63 | Ser-rich | ||||||||||||||||||||
| Compositional bias | 2128 – 2211 | 84 | Pro-rich | ||||||||||||||||||||
Sites | |||||||||||||||||||||||
| Active site | 696 | 1 | Proton acceptor By similarity | ||||||||||||||||||||
| Binding site | 602 | 1 | ATP By similarity | ||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||
| Modified residue | 1526 | 1 | Phosphoserine By similarity | ||||||||||||||||||||
Natural variations | |||||||||||||||||||||||
| Alternative sequence | 1 – 225 | 225 | MGEKV…RRGSL → MDMSDPNFWTVLSNFTLPHL RSGNRLRRTQS in isoform 2. | VSP_020888 | |||||||||||||||||||
| Alternative sequence | 1 – 225 | 225 | MGEKV…RRGSL → MDESSILRRRGLQKELSLPR RGSLIDSQKWNCLVKR in isoform 3. | VSP_023109 | |||||||||||||||||||
| Alternative sequence | 1 – 225 | 225 | MGEKV…RRGSL → MKAQRERLQIPGLTLDLTPR SLSPTPSSPGSPCSPLLAFH FWS in isoform 5. | VSP_035851 | |||||||||||||||||||
| Alternative sequence | 226 – 250 | 25 | CRTSN…PHSPL → IDSQKWNCLVKRPVCPNAGR TSPLG in isoform 4. | VSP_035852 | |||||||||||||||||||
| Alternative sequence | 251 – 2626 | 2376 | Missing in isoform 4. | VSP_035853 | |||||||||||||||||||
| Alternative sequence | 278 – 280 | 3 | Missing in isoform 2 and isoform 3. | VSP_023110 | |||||||||||||||||||
| Natural variant | 77 | 1 | A → P. Corresponds to variant rs6867856 [ dbSNP | Ensembl ]. | VAR_059768 | |||||||||||||||||||
| Natural variant | 923 | 1 | Q → R. Ref.6 | VAR_040787 | |||||||||||||||||||
| Natural variant | 1957 | 1 | R → W. Ref.6 | VAR_040788 | |||||||||||||||||||
| Natural variant | 2201 | 1 | P → L. Ref.6 | VAR_040789 | |||||||||||||||||||
| Natural variant | 2293 | 1 | S → C. Ref.6 | VAR_040790 | |||||||||||||||||||
| Natural variant | 2470 | 1 | E → D in a lung squamous cell carcinoma sample; somatic mutation. Ref.6 | VAR_040791 | |||||||||||||||||||
Experimental info | |||||||||||||||||||||||
| Sequence conflict | 665 | 1 | M → T in AK131421. Ref.4 | ||||||||||||||||||||
| Sequence conflict | 677 – 681 | 5 | FAETV → YIVKL in BAB71532. Ref.4 | ||||||||||||||||||||
| Sequence conflict | 1627 | 1 | R → P in AAW52510. Ref.1 | ||||||||||||||||||||
| Sequence conflict | 1627 | 1 | R → P in BAA20762. Ref.5 | ||||||||||||||||||||
| Sequence conflict | 1802 | 1 | K → E in AAW52510. Ref.1 | ||||||||||||||||||||
| Sequence conflict | 1802 | 1 | K → E in BAA20762. Ref.5 | ||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||
| Beta strand | 1145 – 1148 | 4 | |||||||||||||||||||||
| Beta strand | 1156 – 1164 | 9 | |||||||||||||||||||||
| Beta strand | 1171 – 1180 | 10 | |||||||||||||||||||||
| Helix | 1185 – 1189 | 5 | |||||||||||||||||||||
| Beta strand | 1196 – 1200 | 5 | |||||||||||||||||||||
| Helix | 1210 – 1218 | 9 | |||||||||||||||||||||
| Turn | 1219 – 1222 | 4 | |||||||||||||||||||||
| Beta strand | 1223 – 1229 | 7 | |||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of a novel human MAST4 gene, a new member of the microtubule associated serine-threonine kinase family." Sun L., Gu S., Li X., Sun Y., Zheng D., Yu K., Ji C., Tang R., Xie Y., Mao Y. Mol. Biol. (Mosk.) 40:808-815(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), TISSUE SPECIFICITY. |
| [2] | "The DNA sequence and comparative analysis of human chromosome 5." Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S. Rubin E.M.Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Lung. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-681 (ISOFORM 5), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-666 (ISOFORM 2). Tissue: Brain and Thymus. |
| [5] | "Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro." Nagase T., Ishikawa K., Nakajima D., Ohira M., Seki N., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 4:141-150(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 490-2626 (ISOFORM 1). Tissue: Brain. |
| [6] | "Patterns of somatic mutation in human cancer genomes." Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. Stratton M.R.Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] ARG-923; TRP-1957; LEU-2201; CYS-2293 AND ASP-2470. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AY830839 mRNA. Translation: AAW52510.1. AC008872 Genomic DNA. No translation available. AC008920 Genomic DNA. No translation available. AC016634 Genomic DNA. No translation available. AC034208 Genomic DNA. No translation available. AC044799 Genomic DNA. No translation available. AC092349 Genomic DNA. No translation available. AC092373 Genomic DNA. No translation available. AC113365 Genomic DNA. No translation available. BC033215 mRNA. Translation: AAH33215.1. AK057601 mRNA. Translation: BAB71532.1. AK131421 mRNA. No translation available. AB002301 mRNA. Translation: BAA20762.1. | ||||||||||||
| IPI | IPI00788168. IPI00827896. IPI00893655. IPI00894093. IPI00914890. | ||||||||||||
| RefSeq | NP_055998.1. NM_015183.2. NP_942123.1. NM_198828.2. | ||||||||||||
| UniGene | Hs.595458. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | O15021. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | O15021. 1 interaction. | ||||||||||||
| MINT | MINT-1184694. | ||||||||||||
| STRING | 9606.ENSP00000384313. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | O15021. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | O15021. | ||||||||||||
| PRIDE | O15021. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000261569; ENSP00000261569; ENSG00000069020. ENST00000403666; ENSP00000384313; ENSG00000069020. ENST00000406374; ENSP00000385088; ENSG00000069020. | ||||||||||||
| GeneID | 375449. | ||||||||||||
| KEGG | hsa:375449. | ||||||||||||
| UCSC | uc003jur.4. human. uc003jut.2. human. uc003juw.3. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 375449. | ||||||||||||
| GeneCards | GC05P065892. | ||||||||||||
| H-InvDB | HIX0004913. HIX0164541. | ||||||||||||
| HGNC | HGNC:19037. MAST4. | ||||||||||||
| HPA | HPA000544. | ||||||||||||
| neXtProt | NX_O15021. | ||||||||||||
| PharmGKB | PA134920494. | ||||||||||||
| HUGE | Search... | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | COG0515. | ||||||||||||
| HOGENOM | HOG000074100. | ||||||||||||
| HOVERGEN | HBG108118. | ||||||||||||
| KO | K08789. | ||||||||||||
| OrthoDB | EOG4255S2. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | O15021. | ||||||||||||
| Bgee | O15021. | ||||||||||||
| CleanEx | HS_MAST4. | ||||||||||||
| Genevestigator | O15021. | ||||||||||||
| GermOnline | ENSG00000069020. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 1.20.1480.20. 1 hit. | ||||||||||||
| InterPro | IPR000961. AGC-kinase_C. IPR011009. Kinase-like_dom. IPR015022. MA_Ser/Thr_Kinase_dom. IPR023142. MAST_pre-PK_dom. IPR001478. PDZ. IPR000719. Prot_kinase_cat_dom. IPR002290. Ser/Thr_dual-sp_kinase_dom. IPR008271. Ser/Thr_kinase_AS. [Graphical view] | ||||||||||||
| Pfam | PF08926. DUF1908. 1 hit. PF00595. PDZ. 1 hit. PF00069. Pkinase. 1 hit. [Graphical view] | ||||||||||||
| SMART | SM00228. PDZ. 1 hit. SM00133. S_TK_X. 1 hit. SM00220. S_TKc. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF56112. Kinase_like. 1 hit. SSF50156. PDZ. 1 hit. SSF140482. SSF140482. 1 hit. | ||||||||||||
| PROSITE | PS51285. AGC_KINASE_CTER. 1 hit. PS50106. PDZ. 1 hit. PS00107. PROTEIN_KINASE_ATP. False negative. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| ChiTaRS | MAST4. human. | ||||||||||||
| EvolutionaryTrace | O15021. | ||||||||||||
| GenomeRNAi | 375449. | ||||||||||||
| NextBio | 100512. | ||||||||||||
Entry information
| Entry name | MAST4_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O15021 Secondary accession number(s): A6NL49 Q96LY3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| Human chromosome 5 Human chromosome 5: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
