Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein 646

Gene

ZNF646

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May be involved in transcriptional regulation.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri8 – 3124C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri48 – 7023C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri75 – 9723C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri239 – 26123C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri266 – 28823C2H2-type 5PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri294 – 31623C2H2-type 6PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri374 – 39623C2H2-type 7PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri401 – 42424C2H2-type 8PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri465 – 48723C2H2-type 9PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri492 – 51423C2H2-type 10PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri575 – 59723C2H2-type 11PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri617 – 63923C2H2-type 12PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri644 – 66623C2H2-type 13PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri821 – 84323C2H2-type 14PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri848 – 87023C2H2-type 15PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri881 – 90424C2H2-type 16PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri958 – 98023C2H2-type 17; degeneratePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1052 – 107423C2H2-type 18PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1079 – 110123C2H2-type 19PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1203 – 122523C2H2-type 20PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1230 – 125223C2H2-type 21PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1258 – 128023C2H2-type 22PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1299 – 132123C2H2-type 23PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1326 – 134823C2H2-type 24PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1364 – 138623C2H2-type 25PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1557 – 157923C2H2-type 26PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1585 – 160723C2H2-type 27PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1677 – 169923C2H2-type 28PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1704 – 172623C2H2-type 29PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1732 – 175423C2H2-type 30PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1761 – 178323C2H2-type 31PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 646
Gene namesi
Name:ZNF646
Synonyms:KIAA0296
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

HGNCiHGNC:29004. ZNF646.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134955953.

Polymorphism and mutation databases

BioMutaiZNF646.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 18291829Zinc finger protein 646PRO_0000047699Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Cross-linki1157 – 1157Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki1168 – 1168Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki1178 – 1178Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Isopeptide bond, Ubl conjugation

Proteomic databases

EPDiO15015.
MaxQBiO15015.
PaxDbiO15015.
PRIDEiO15015.

PTM databases

PhosphoSiteiO15015.

Miscellaneous databases

PMAP-CutDBO15015.

Expressioni

Gene expression databases

BgeeiO15015.
CleanExiHS_ZNF646.
ExpressionAtlasiO15015. baseline and differential.
GenevisibleiO15015. HS.

Organism-specific databases

HPAiHPA042364.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
EMSYQ7Z5893EBI-745608,EBI-6598631
MDFIQ997503EBI-745608,EBI-724076
PRKG1Q139763EBI-745608,EBI-3952014

Protein-protein interaction databases

BioGridi115075. 12 interactions.
IntActiO15015. 11 interactions.
MINTiMINT-7034568.
STRINGi9606.ENSP00000300850.

Structurei

3D structure databases

ProteinModelPortaliO15015.
SMRiO15015. Positions 42-71, 236-514, 1199-1386, 1533-1785.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Contains 31 C2H2-type zinc fingers.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri8 – 3124C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri48 – 7023C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri75 – 9723C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri239 – 26123C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri266 – 28823C2H2-type 5PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri294 – 31623C2H2-type 6PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri374 – 39623C2H2-type 7PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri401 – 42424C2H2-type 8PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri465 – 48723C2H2-type 9PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri492 – 51423C2H2-type 10PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri575 – 59723C2H2-type 11PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri617 – 63923C2H2-type 12PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri644 – 66623C2H2-type 13PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri821 – 84323C2H2-type 14PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri848 – 87023C2H2-type 15PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri881 – 90424C2H2-type 16PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri958 – 98023C2H2-type 17; degeneratePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1052 – 107423C2H2-type 18PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1079 – 110123C2H2-type 19PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1203 – 122523C2H2-type 20PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1230 – 125223C2H2-type 21PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1258 – 128023C2H2-type 22PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1299 – 132123C2H2-type 23PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1326 – 134823C2H2-type 24PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1364 – 138623C2H2-type 25PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1557 – 157923C2H2-type 26PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1585 – 160723C2H2-type 27PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1677 – 169923C2H2-type 28PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1704 – 172623C2H2-type 29PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1732 – 175423C2H2-type 30PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1761 – 178323C2H2-type 31PROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00780000122031.
HOGENOMiHOG000143374.
HOVERGENiHBG067847.
InParanoidiO15015.
OMAiVRVHCKA.
OrthoDBiEOG7GTT3B.
PhylomeDBiO15015.
TreeFamiTF350868.

Family and domain databases

Gene3Di3.30.160.60. 17 hits.
InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF00096. zf-C2H2. 1 hit.
PF13912. zf-C2H2_6. 3 hits.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 32 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 30 hits.
PS50157. ZINC_FINGER_C2H2_2. 29 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O15015-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEDTPPSLSC SDCQRHFPSL PELSRHRELL HPSPNQDSEE ADSIPRPYRC
60 70 80 90 100
QQCGRGYRHP GSLVNHRRTH ETGLFPCTTC GKDFSNPMAL KSHMRTHAPE
110 120 130 140 150
GRRRHRPPRP KEATPHLQGE TVSTDSWGQR LGSSEGWENQ TKHTEETPDC
160 170 180 190 200
ESVPDPRAAS GTWEDLPTRQ REGLASHPGP EDGADGWGPS TNSARAPPLP
210 220 230 240 250
IPASSLLSNL EQYLAESVVN FTGGQEPTQS PPAEEERRYK CSQCGKTYKH
260 270 280 290 300
AGSLTNHRQS HTLGIYPCAI CFKEFSNLMA LKNHSRLHAQ YRPYHCPHCP
310 320 330 340 350
RVFRLPRELL EHQQSHEGER QEPRWEEKGM PTTNGHTDES SQDQLPSAQM
360 370 380 390 400
LNGSAELSTS GELEDSGLEE YRPFRCGDCG RTYRHAGSLI NHRKSHQTGV
410 420 430 440 450
YPCSLCSKQL FNAAALKNHV RAHHRPRQGV GENGQPSVPP APLLLAETTH
460 470 480 490 500
KEEEDPTTTL DHRPYKCSEC GRAYRHRGSL VNHRHSHRTG EYQCSLCPRK
510 520 530 540 550
YPNLMALRNH VRVHCKAARR SADIGAEGAP SHLKVELPPD PVEAEAAPHT
560 570 580 590 600
DQDHVCKHEE EATDITPAAD KTAAHICSIC GLLFEDAESL ERHGLTHGAG
610 620 630 640 650
EKENSRTETT MSPPRAFACR DCGKSYRHSG SLINHRQTHQ TGDFSCGACA
660 670 680 690 700
KHFHTMAAMK NHLRRHSRRR SRRHRKRAGG ASGGREAKLL AAESWTRELE
710 720 730 740 750
DNEGLESPQD PSGESPHGAE GNLESDGDCL QAESEGDKCG LERDETHFQG
760 770 780 790 800
DKESGGTGEG LERKDASLLD NLDIPGEEGG GTHFCDSLTG VDEDQKPATG
810 820 830 840 850
QPNSSSHSAN AVTGWQAGAA HTCSDCGHSF PHATGLLSHR PCHPPGIYQC
860 870 880 890 900
SLCPKEFDSL PALRSHFQNH RPGEATSAQP FLCCLCGMIF PGRAGYRLHR
910 920 930 940 950
RQAHSSSGMT EGSEEEGEEE GVAEAAPARS PPLQLSEAEL LNQLQREVEA
960 970 980 990 1000
LDSAGYGHIC GCCGQTYDDL GSLERHHQSQ SSGTTADKAP SPLGVAGDAM
1010 1020 1030 1040 1050
EMVVDSVLED IVNSVSGEGG DAKSQEGAGT PLGDSLCIQG GESLLEAQPR
1060 1070 1080 1090 1100
PFRCNQCGKT YRHGGSLVNH RKIHQTGDFL CPVCSRCYPN LAAYRNHLRN
1110 1120 1130 1140 1150
HPRCKGSEPQ VGPIPEAAGS SELQVGPIPE GGSNKPQHMA EEGPGQAEVE
1160 1170 1180 1190 1200
KLQEELKVEP LEEVARVKEE VWEETTVKGE EIEPRLETAE KGCQTEASSE
1210 1220 1230 1240 1250
RPFSCEVCGR SYKHAGSLIN HRQSHQTGHF GCQACSKGFS NLMSLKNHRR
1260 1270 1280 1290 1300
IHADPRRFRC SECGKAFRLR KQLASHQRVH MERRGGGGTR KATREDRPFR
1310 1320 1330 1340 1350
CGQCGRTYRH AGSLLNHRRS HETGQYSCPT CPKTYSNRMA LKDHQRLHSE
1360 1370 1380 1390 1400
NRRRRAGRSR RTAVRCALCG RSFPGRGSLE RHLREHEETE REPANGQGGL
1410 1420 1430 1440 1450
DGTAASEANL TGSQGLETQL GGAEPVPHLE DGVPRPGERS QSPIRAASSE
1460 1470 1480 1490 1500
APEPLSWGAG KAGGWPVGGG LGNHSGGWVP QFLTRSEEPE DSVHRSPCHA
1510 1520 1530 1540 1550
GDCQLNGPTL SHMDSWDNRD NSSQLQPGSH SSCSQCGKTY CQSGSLLNHN
1560 1570 1580 1590 1600
TNKTDRHYCL LCSKEFLNPV ATKSHSHNHI DAQTFACPDC GKAFESHQEL
1610 1620 1630 1640 1650
ASHLQAHARG HSQVPAQMEE ARDPKAGTGE DQVVLPGQGK AQEAPSETPR
1660 1670 1680 1690 1700
GPGESVERAR GGQAVTSMAA EDKERPFRCT QCGRSYRHAG SLLNHQKAHT
1710 1720 1730 1740 1750
TGLYPCSLCP KLLPNLLSLK NHSRTHTDPK RHCCSICGKA FRTAARLEGH
1760 1770 1780 1790 1800
GRVHAPREGP FTCPHCPRHF RRRISFVQHQ QQHQEEWTVA GSGRGHEGSQ
1810 1820
EEVGTQWRGK SSPKVGGGAR SERREPRGF
Length:1,829
Mass (Da):200,762
Last modified:January 1, 1998 - v1
Checksum:iB20C482B38684895
GO
Isoform 2 (identifier: O15015-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1794-1829: RGHEGSQEEVGTQWRGKSSPKVGGGARSERREPRGF → APVAPVTGRGDLPLPPPPTPTTPLLDPSPQWPADLSFSL

Show »
Length:1,832
Mass (Da):200,825
Checksum:iA93549B71745C803
GO

Sequence cautioni

The sequence BAA20756.2 differs from that shown. Reason: Erroneous initiation. Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti98 – 981A → V.
Corresponds to variant rs28407985 [ dbSNP | Ensembl ].
VAR_057430
Natural varianti327 – 3271E → G.2 Publications
Corresponds to variant rs749670 [ dbSNP | Ensembl ].
VAR_057431
Natural varianti774 – 7741I → M.
Corresponds to variant rs17641067 [ dbSNP | Ensembl ].
VAR_057432
Natural varianti921 – 9211G → A.
Corresponds to variant rs35713203 [ dbSNP | Ensembl ].
VAR_057433
Natural varianti1249 – 12491R → W.
Corresponds to variant rs35376811 [ dbSNP | Ensembl ].
VAR_057434
Natural varianti1318 – 13181R → Q.
Corresponds to variant rs3751856 [ dbSNP | Ensembl ].
VAR_057435
Natural varianti1337 – 13371N → I in a breast cancer sample; somatic mutation. 1 Publication
VAR_035594
Natural varianti1477 – 14771G → D.
Corresponds to variant rs7196726 [ dbSNP | Ensembl ].
VAR_057436
Natural varianti1788 – 17881T → M.
Corresponds to variant rs34259949 [ dbSNP | Ensembl ].
VAR_057437

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1794 – 182936RGHEG…EPRGF → APVAPVTGRGDLPLPPPPTP TTPLLDPSPQWPADLSFSL in isoform 2. 1 PublicationVSP_039873Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB002294 mRNA. Translation: BAA20756.2. Different initiation.
AC135050 Genomic DNA. No translation available.
CH471192 Genomic DNA. Translation: EAW52170.1.
BC035589 mRNA. Translation: AAH35589.1.
CCDSiCCDS10702.1. [O15015-2]
RefSeqiNP_055514.3. NM_014699.3. [O15015-2]
XP_005255767.1. XM_005255710.2. [O15015-2]
XP_005255768.1. XM_005255711.2. [O15015-2]
XP_011544292.1. XM_011545990.1. [O15015-2]
UniGeneiHs.119273.

Genome annotation databases

EnsembliENST00000300850; ENSP00000300850; ENSG00000167395. [O15015-2]
ENST00000394979; ENSP00000378429; ENSG00000167395. [O15015-1]
GeneIDi9726.
KEGGihsa:9726.
UCSCiuc002eap.4. human. [O15015-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB002294 mRNA. Translation: BAA20756.2. Different initiation.
AC135050 Genomic DNA. No translation available.
CH471192 Genomic DNA. Translation: EAW52170.1.
BC035589 mRNA. Translation: AAH35589.1.
CCDSiCCDS10702.1. [O15015-2]
RefSeqiNP_055514.3. NM_014699.3. [O15015-2]
XP_005255767.1. XM_005255710.2. [O15015-2]
XP_005255768.1. XM_005255711.2. [O15015-2]
XP_011544292.1. XM_011545990.1. [O15015-2]
UniGeneiHs.119273.

3D structure databases

ProteinModelPortaliO15015.
SMRiO15015. Positions 42-71, 236-514, 1199-1386, 1533-1785.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115075. 12 interactions.
IntActiO15015. 11 interactions.
MINTiMINT-7034568.
STRINGi9606.ENSP00000300850.

PTM databases

PhosphoSiteiO15015.

Polymorphism and mutation databases

BioMutaiZNF646.

Proteomic databases

EPDiO15015.
MaxQBiO15015.
PaxDbiO15015.
PRIDEiO15015.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000300850; ENSP00000300850; ENSG00000167395. [O15015-2]
ENST00000394979; ENSP00000378429; ENSG00000167395. [O15015-1]
GeneIDi9726.
KEGGihsa:9726.
UCSCiuc002eap.4. human. [O15015-1]

Organism-specific databases

CTDi9726.
GeneCardsiZNF646.
HGNCiHGNC:29004. ZNF646.
HPAiHPA042364.
neXtProtiNX_O15015.
PharmGKBiPA134955953.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00780000122031.
HOGENOMiHOG000143374.
HOVERGENiHBG067847.
InParanoidiO15015.
OMAiVRVHCKA.
OrthoDBiEOG7GTT3B.
PhylomeDBiO15015.
TreeFamiTF350868.

Miscellaneous databases

ChiTaRSiZNF646. human.
GenomeRNAii9726.
NextBioi36589.
PMAP-CutDBO15015.
PROiO15015.

Gene expression databases

BgeeiO15015.
CleanExiHS_ZNF646.
ExpressionAtlasiO15015. baseline and differential.
GenevisibleiO15015. HS.

Family and domain databases

Gene3Di3.30.160.60. 17 hits.
InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF00096. zf-C2H2. 1 hit.
PF13912. zf-C2H2_6. 3 hits.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 32 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 30 hits.
PS50157. ZINC_FINGER_C2H2_2. 29 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro."
    Nagase T., Ishikawa K., Nakajima D., Ohira M., Seki N., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
    DNA Res. 4:141-150(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. "The sequence and analysis of duplication-rich human chromosome 16."
    Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.
    , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
    Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT GLY-327.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT GLY-327.
    Tissue: Uterus.
  5. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  6. "Uncovering global SUMOylation signaling networks in a site-specific manner."
    Hendriks I.A., D'Souza R.C., Yang B., Verlaan-de Vries M., Mann M., Vertegaal A.C.
    Nat. Struct. Mol. Biol. 21:927-936(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUMOYLATION [LARGE SCALE ANALYSIS] AT LYS-1157; LYS-1168 AND LYS-1178, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  7. "SUMO-2 orchestrates chromatin modifiers in response to DNA damage."
    Hendriks I.A., Treffers L.W., Verlaan-de Vries M., Olsen J.V., Vertegaal A.C.
    Cell Rep. 10:1778-1791(2015) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUMOYLATION [LARGE SCALE ANALYSIS] AT LYS-1157 AND LYS-1168, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  8. "System-wide analysis of SUMOylation dynamics in response to replication stress reveals novel small ubiquitin-like modified target proteins and acceptor lysines relevant for genome stability."
    Xiao Z., Chang J.G., Hendriks I.A., Sigurdsson J.O., Olsen J.V., Vertegaal A.C.
    Mol. Cell. Proteomics 14:1419-1434(2015) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUMOYLATION [LARGE SCALE ANALYSIS] AT LYS-1157 AND LYS-1168, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  9. Cited for: VARIANT [LARGE SCALE ANALYSIS] ILE-1337.

Entry informationi

Entry nameiZN646_HUMAN
AccessioniPrimary (citable) accession number: O15015
Secondary accession number(s): Q8IVD8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 20, 2001
Last sequence update: January 1, 1998
Last modified: April 13, 2016
This is version 140 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.