Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O14986

- PI51B_HUMAN

UniProt

O14986 - PI51B_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Phosphatidylinositol 4-phosphate 5-kinase type-1 beta

Gene

PIP5K1B

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Participates in the biosynthesis of phosphatidylinositol 4,5-bisphosphate. Mediates RAC1-dependent reorganization of actin filaments. Contributes to the activation of PLD2. Together with PIP5K1A is required after stimulation of G-protein coupled receptors for stable platelet adhesion (By similarity).By similarity

Catalytic activityi

ATP + 1-phosphatidyl-1D-myo-inositol 4-phosphate = ADP + 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate.

GO - Molecular functioni

  1. 1-phosphatidylinositol-4-phosphate 5-kinase activity Source: UniProtKB
  2. ATP binding Source: UniProtKB-KW

GO - Biological processi

  1. phosphatidylinositol biosynthetic process Source: Reactome
  2. phosphatidylinositol phosphorylation Source: GOC
  3. phospholipid metabolic process Source: Reactome
  4. small molecule metabolic process Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Kinase, Transferase

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyciMetaCyc:HS02982-MONOMER.
ReactomeiREACT_121025. Synthesis of PIPs at the plasma membrane.
REACT_200668. WNT mediated activation of DVL.
SABIO-RKO14986.

Names & Taxonomyi

Protein namesi
Recommended name:
Phosphatidylinositol 4-phosphate 5-kinase type-1 beta (EC:2.7.1.68)
Short name:
PIP5K1-beta
Short name:
PtdIns(4)P-5-kinase 1 beta
Alternative name(s):
Phosphatidylinositol 4-phosphate 5-kinase type I beta
Short name:
PIP5KIbeta
Protein STM-7
Type I phosphatidylinositol 4-phosphate 5-kinase beta
Gene namesi
Name:PIP5K1B
Synonyms:STM7
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 9

Organism-specific databases

HGNCiHGNC:8995. PIP5K1B.

Subcellular locationi

Endomembrane system By similarity
Note: Associated with membranes.By similarity

GO - Cellular componenti

  1. cytosol Source: Reactome
  2. membrane Source: UniProtKB-KW
  3. uropod Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA33328.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 540540Phosphatidylinositol 4-phosphate 5-kinase type-1 betaPRO_0000185458Add
BLAST

Proteomic databases

MaxQBiO14986.
PaxDbiO14986.
PRIDEiO14986.

PTM databases

PhosphoSiteiO14986.

Expressioni

Tissue specificityi

Detected in heart, pancreas, brain, kidney, skeletal muscle and lung.1 Publication

Gene expression databases

BgeeiO14986.
ExpressionAtlasiO14986. baseline and differential.
GenevestigatoriO14986.

Organism-specific databases

HPAiHPA009687.

Interactioni

Subunit structurei

Interacts with RAC1, AJUBA, PLD1, PLD2 and ARF1.By similarity

Protein-protein interaction databases

BioGridi113984. 4 interactions.

Structurei

3D structure databases

ProteinModelPortaliO14986.
SMRiO14986. Positions 25-279.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini25 – 395371PIPKPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 PIPK domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiCOG5253.
GeneTreeiENSGT00760000119184.
HOVERGENiHBG052818.
InParanoidiO14986.
KOiK00889.
OMAiEHYPHDR.
OrthoDBiEOG70W3DM.
PhylomeDBiO14986.
TreeFamiTF319618.

Family and domain databases

Gene3Di3.30.800.10. 1 hit.
3.30.810.10. 1 hit.
InterProiIPR023610. PInositol-4-P-5-kinase.
IPR027483. PInositol-4-P-5-kinase_C.
IPR002498. PInositol-4-P-5-kinase_core.
IPR027484. PInositol-4-P-5-kinase_N.
IPR016034. PInositol-4P-5-kinase_core_sub.
[Graphical view]
PANTHERiPTHR23086. PTHR23086. 1 hit.
PfamiPF01504. PIP5K. 1 hit.
[Graphical view]
SMARTiSM00330. PIPKc. 1 hit.
[Graphical view]
PROSITEiPS51455. PIPK. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O14986-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSSAAENGEA APGKQNEEKT YKKTASSAIK GAIQLGIGYT VGNLTSKPER
60 70 80 90 100
DVLMQDFYVV ESVFLPSEGS NLTPAHHYPD FRFKTYAPLA FRYFRELFGI
110 120 130 140 150
KPDDYLYSIC SEPLIELSNP GASGSLFFVT SDDEFIIKTV QHKEAEFLQK
160 170 180 190 200
LLPGYYMNLN QNPRTLLPKF YGLYCMQSGG INIRIVVMNN VLPRSMRMHF
210 220 230 240 250
TYDLKGSTYK RRASRKEREK SNPTFKDLDF LQDMHEGLYF DTETYNALMK
260 270 280 290 300
TLQRDCRVLE SFKIMDYSLL LGIHFLDHSL KEKEEETPQN VPDAKRTGMQ
310 320 330 340 350
KVLYSTAMES IQGPGKSGDG IITENPDTMG GIPAKSHRGE KLLLFMGIID
360 370 380 390 400
ILQSYRLMKK LEHSWKALVY DGDTVSVHRP SFYADRFLKF MNSRVFKKIQ
410 420 430 440 450
ALKASPSKKR CNSIAALKAT SQEIVSSISQ EWKDEKRDLL TEGQSFSSLD
460 470 480 490 500
EEALGSRHRP DLVPSTPSLF EAASLATTIS SSSLYVNEHY PHDRPTLYSN
510 520 530 540
SKGLPSSSTF TLEEGTIYLT AEPNTLEVQD DNASVLDVYL
Length:540
Mass (Da):61,036
Last modified:October 25, 2005 - v2
Checksum:i7A683794A39A20B6
GO
Isoform 2 (identifier: O14986-2) [UniParc]FASTAAdd to Basket

Also known as: Isoform 1

The sequence of this isoform differs from the canonical sequence as follows:
     24-24: T → TQVKNQILSRLPKIPCTFIQAWTNTEMITLLACYYFRSVST
     501-540: SKGLPSSSTFTLEEGTIYLTAEPNTLEVQDDNASVLDVYL → RFKMATSEH

Show »
Length:549
Mass (Da):62,485
Checksum:iB12247947FAAB6B1
GO
Isoform 3 (identifier: O14986-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     503-540: Missing.

Note: No experimental confirmation available.

Show »
Length:502
Mass (Da):56,951
Checksum:iCC7A35788CB772F2
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti346 – 3461M → T in AAH30587. (PubMed:15489334)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti415 – 4151A → T.1 Publication
Corresponds to variant rs55897616 [ dbSNP | Ensembl ].
VAR_023712

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei24 – 241T → TQVKNQILSRLPKIPCTFIQ AWTNTEMITLLACYYFRSVS T in isoform 2. 1 PublicationVSP_016010
Alternative sequencei501 – 54040SKGLP…LDVYL → RFKMATSEH in isoform 2. 1 PublicationVSP_016011Add
BLAST
Alternative sequencei503 – 54038Missing in isoform 3. 1 PublicationVSP_054771Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X92493 mRNA. Translation: CAA63224.1.
U52387
, U52376, U52377, U52378, U52379, U52380, U52381, U52382, U52383, U52384, U52385, U52386 Genomic DNA. Translation: AAC51327.1.
AK292734 mRNA. Translation: BAF85423.1.
AK295587 mRNA. Translation: BAG58479.1.
AL162730, AL354794, AL356219 Genomic DNA. Translation: CAH71831.1.
AL354794, AL356219 Genomic DNA. Translation: CAI12622.1.
AL354794, AL356219 Genomic DNA. Translation: CAI12623.1.
AL354794, AL356219 Genomic DNA. Translation: CAI12624.1.
AL354794, AL162730, AL356219 Genomic DNA. Translation: CAI12625.1.
AL356219, AL354794 Genomic DNA. Translation: CAI14092.1.
AL356219, AL354794 Genomic DNA. Translation: CAI14093.1.
AL356219, AL354794 Genomic DNA. Translation: CAI14094.1.
AL356219, AL162730, AL354794 Genomic DNA. Translation: CAI14095.1.
CH471089 Genomic DNA. Translation: EAW62465.1.
BC030587 mRNA. Translation: AAH30587.1.
U78580 mRNA. Translation: AAC50915.1.
CCDSiCCDS65063.1. [O14986-3]
CCDS6624.1. [O14986-1]
RefSeqiNP_001265182.1. NM_001278253.1. [O14986-3]
NP_003549.1. NM_003558.3. [O14986-1]
XP_005252318.1. XM_005252261.2. [O14986-1]
XP_005252319.1. XM_005252262.2. [O14986-1]
XP_006717363.1. XM_006717300.1. [O14986-1]
XP_006717364.1. XM_006717301.1. [O14986-3]
UniGeneiHs.534371.

Genome annotation databases

EnsembliENST00000265382; ENSP00000265382; ENSG00000107242. [O14986-1]
ENST00000478500; ENSP00000435778; ENSG00000107242. [O14986-2]
ENST00000541509; ENSP00000438082; ENSG00000107242. [O14986-3]
GeneIDi8395.
KEGGihsa:8395.
UCSCiuc004agu.4. human. [O14986-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X92493 mRNA. Translation: CAA63224.1 .
U52387
, U52376 , U52377 , U52378 , U52379 , U52380 , U52381 , U52382 , U52383 , U52384 , U52385 , U52386 Genomic DNA. Translation: AAC51327.1 .
AK292734 mRNA. Translation: BAF85423.1 .
AK295587 mRNA. Translation: BAG58479.1 .
AL162730 , AL354794 , AL356219 Genomic DNA. Translation: CAH71831.1 .
AL354794 , AL356219 Genomic DNA. Translation: CAI12622.1 .
AL354794 , AL356219 Genomic DNA. Translation: CAI12623.1 .
AL354794 , AL356219 Genomic DNA. Translation: CAI12624.1 .
AL354794 , AL162730 , AL356219 Genomic DNA. Translation: CAI12625.1 .
AL356219 , AL354794 Genomic DNA. Translation: CAI14092.1 .
AL356219 , AL354794 Genomic DNA. Translation: CAI14093.1 .
AL356219 , AL354794 Genomic DNA. Translation: CAI14094.1 .
AL356219 , AL162730 , AL354794 Genomic DNA. Translation: CAI14095.1 .
CH471089 Genomic DNA. Translation: EAW62465.1 .
BC030587 mRNA. Translation: AAH30587.1 .
U78580 mRNA. Translation: AAC50915.1 .
CCDSi CCDS65063.1. [O14986-3 ]
CCDS6624.1. [O14986-1 ]
RefSeqi NP_001265182.1. NM_001278253.1. [O14986-3 ]
NP_003549.1. NM_003558.3. [O14986-1 ]
XP_005252318.1. XM_005252261.2. [O14986-1 ]
XP_005252319.1. XM_005252262.2. [O14986-1 ]
XP_006717363.1. XM_006717300.1. [O14986-1 ]
XP_006717364.1. XM_006717301.1. [O14986-3 ]
UniGenei Hs.534371.

3D structure databases

ProteinModelPortali O14986.
SMRi O14986. Positions 25-279.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 113984. 4 interactions.

PTM databases

PhosphoSitei O14986.

Proteomic databases

MaxQBi O14986.
PaxDbi O14986.
PRIDEi O14986.

Protocols and materials databases

DNASUi 8395.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000265382 ; ENSP00000265382 ; ENSG00000107242 . [O14986-1 ]
ENST00000478500 ; ENSP00000435778 ; ENSG00000107242 . [O14986-2 ]
ENST00000541509 ; ENSP00000438082 ; ENSG00000107242 . [O14986-3 ]
GeneIDi 8395.
KEGGi hsa:8395.
UCSCi uc004agu.4. human. [O14986-1 ]

Organism-specific databases

CTDi 8395.
GeneCardsi GC09P071320.
HGNCi HGNC:8995. PIP5K1B.
HPAi HPA009687.
MIMi 602745. gene.
neXtProti NX_O14986.
PharmGKBi PA33328.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5253.
GeneTreei ENSGT00760000119184.
HOVERGENi HBG052818.
InParanoidi O14986.
KOi K00889.
OMAi EHYPHDR.
OrthoDBi EOG70W3DM.
PhylomeDBi O14986.
TreeFami TF319618.

Enzyme and pathway databases

BioCyci MetaCyc:HS02982-MONOMER.
Reactomei REACT_121025. Synthesis of PIPs at the plasma membrane.
REACT_200668. WNT mediated activation of DVL.
SABIO-RK O14986.

Miscellaneous databases

ChiTaRSi PIP5K1B. human.
GeneWikii PIP5K1B.
GenomeRNAii 8395.
NextBioi 31420.
PROi O14986.
SOURCEi Search...

Gene expression databases

Bgeei O14986.
ExpressionAtlasi O14986. baseline and differential.
Genevestigatori O14986.

Family and domain databases

Gene3Di 3.30.800.10. 1 hit.
3.30.810.10. 1 hit.
InterProi IPR023610. PInositol-4-P-5-kinase.
IPR027483. PInositol-4-P-5-kinase_C.
IPR002498. PInositol-4-P-5-kinase_core.
IPR027484. PInositol-4-P-5-kinase_N.
IPR016034. PInositol-4P-5-kinase_core_sub.
[Graphical view ]
PANTHERi PTHR23086. PTHR23086. 1 hit.
Pfami PF01504. PIP5K. 1 hit.
[Graphical view ]
SMARTi SM00330. PIPKc. 1 hit.
[Graphical view ]
PROSITEi PS51455. PIPK. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The Friedreich's ataxia gene encodes a novel phosphatidylinositol-4-phosphate 5-kinase."
    Carvajal J.J., Pook M.A., dos Santos M., Doudney K., Hillermann R., Minogue S., Williamson R., Hsuan J.J., Chamberlain S.
    Nat. Genet. 14:157-162(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. "Exon-intron structure of a 2.7-kb transcript of the STM7 gene with phosphatidylinositol-4-phosphate 5-kinase activity."
    Pook M.A., Carvajal J.J., Doudney K., Hillermann R., Chamberlain S.
    Genomics 42:170-172(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT THR-415, ALTERNATIVE SPLICING.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
    Tissue: Kidney.
  4. "DNA sequence and analysis of human chromosome 9."
    Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L.
    , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
    Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Testis.
  7. "Type I phosphatidylinositol-4-phosphate 5-kinases are distinct members of this novel lipid kinase family."
    Loijens J.C., Anderson R.A.
    J. Biol. Chem. 271:32937-32943(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 340-540 (ISOFORM 1), TISSUE SPECIFICITY.
    Tissue: Fetal brain.
  8. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiPI51B_HUMAN
AccessioniPrimary (citable) accession number: O14986
Secondary accession number(s): A8K9L9
, B4DIG7, P78518, P78519, Q5T5K6, Q5T5K8, Q5T5K9, Q5VZ00, Q7KYT5, Q8NHQ5, Q92749
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 25, 2005
Last sequence update: October 25, 2005
Last modified: November 26, 2014
This is version 108 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3