O14986 (PI51B_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 92.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Phosphatidylinositol 4-phosphate 5-kinase type-1 beta Short name=PIP5K1-beta Short name=PtdIns(4)P-5-kinase 1 beta EC=2.7.1.68 Alternative name(s): Phosphatidylinositol 4-phosphate 5-kinase type I beta Short name=PIP5KIbeta Protein STM-7 Type I phosphatidylinositol 4-phosphate 5-kinase beta | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 540 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Participates in the biosynthesis of phosphatidylinositol 4,5-bisphosphate. Mediates RAC1-dependent reorganization of actin filaments. Contributes to the activation of PLD2. Together with PIP5K1A is required after stimulation of G-protein coupled receptors for stable platelet adhesion By similarity. |
| Catalytic activity | ATP + 1-phosphatidyl-1D-myo-inositol 4-phosphate = ADP + 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate. |
| Subunit structure | Interacts with RAC1, AJUBA, PLD1, PLD2 and ARF1 By similarity. |
| Subcellular location | Endomembrane system By similarity. Note: Associated with membranes By similarity. |
| Tissue specificity | Detected in heart, pancreas, brain, kidney, skeletal muscle and lung. Ref.7 |
| Sequence similarities | Contains 1 PIPK domain. |
| Caution | There is confusion in the literature with phosphatidylinositol 4-phosphate 5-kinase type I nomenclature due to the fact that frequently mouse PIP5K1B is named Phosphatidylinositol 4-phosphate 5-kinase type I alpha. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | ATP-binding Nucleotide-binding |
| Molecular function | Kinase Transferase |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | phosphatidylinositol biosynthetic process Traceable author statement. Source: Reactome small molecule metabolic processTraceable author statement. Source: Reactome |
| Cellular_component | cytosol Traceable author statement. Source: Reactome endomembrane systemInferred from electronic annotation. Source: UniProtKB-SubCell membraneInferred from electronic annotation. Source: UniProtKB-KW uropodInferred from direct assay PubMed 20442317. Source: UniProtKB |
| Molecular_function | 1-phosphatidylinositol-4-phosphate 5-kinase activity Non-traceable author statement Ref.7. Source: UniProtKB ATP bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O14986-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O14986-2) Also known as: Isoform 1; The sequence of this isoform differs from the canonical sequence as follows: 24-24: T → TQVKNQILSRLPKIPCTFIQAWTNTEMITLLACYYFRSVST 501-540: SKGLPSSSTFTLEEGTIYLTAEPNTLEVQDDNASVLDVYL → RFKMATSEH |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 540 | 540 | Phosphatidylinositol 4-phosphate 5-kinase type-1 beta | PRO_0000185458 | |||||
Regions | |||||||||
| Domain | 25 – 395 | 371 | PIPK | ||||||
Natural variations | |||||||||
| Alternative sequence | 24 | 1 | T → TQVKNQILSRLPKIPCTFIQ AWTNTEMITLLACYYFRSVS T in isoform 2. | VSP_016010 | |||||
| Alternative sequence | 501 – 540 | 40 | SKGLP…LDVYL → RFKMATSEH in isoform 2. | VSP_016011 | |||||
| Natural variant | 415 | 1 | A → T. Ref.2 Corresponds to variant rs55897616 [ dbSNP | Ensembl ]. | VAR_023712 | |||||
Experimental info | |||||||||
| Sequence conflict | 346 | 1 | M → T in AAH30587. Ref.6 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The Friedreich's ataxia gene encodes a novel phosphatidylinositol-4-phosphate 5-kinase." Carvajal J.J., Pook M.A., dos Santos M., Doudney K., Hillermann R., Minogue S., Williamson R., Hsuan J.J., Chamberlain S. Nat. Genet. 14:157-162(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Brain. |
| [2] | "Exon-intron structure of a 2.7-kb transcript of the STM7 gene with phosphatidylinositol-4-phosphate 5-kinase activity." Pook M.A., Carvajal J.J., Doudney K., Hillermann R., Chamberlain S. Genomics 42:170-172(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT THR-415, ALTERNATIVE SPLICING. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Kidney. |
| [4] | "DNA sequence and analysis of human chromosome 9." Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L. Dunham I.Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Testis. |
| [7] | "Type I phosphatidylinositol-4-phosphate 5-kinases are distinct members of this novel lipid kinase family." Loijens J.C., Anderson R.A. J. Biol. Chem. 271:32937-32943(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 340-540 (ISOFORM 1), TISSUE SPECIFICITY. Tissue: Fetal brain. |
| [8] | "Large-scale proteomics analysis of the human kinome." Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G., Mann M., Daub H. Mol. Cell. Proteomics 8:1751-1764(2009) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X92493 mRNA. Translation: CAA63224.1. U52387 U52386 Genomic DNA. Translation: AAC51327.1.AK292734 mRNA. Translation: BAF85423.1. AL162730, AL354794, AL356219 Genomic DNA. Translation: CAH71831.1. AL354794, AL356219 Genomic DNA. Translation: CAI12622.1. AL354794, AL356219 Genomic DNA. Translation: CAI12623.1. AL354794, AL356219 Genomic DNA. Translation: CAI12624.1. AL354794, AL162730, AL356219 Genomic DNA. Translation: CAI12625.1. AL356219, AL354794 Genomic DNA. Translation: CAI14092.1. AL356219, AL354794 Genomic DNA. Translation: CAI14093.1. AL356219, AL354794 Genomic DNA. Translation: CAI14094.1. AL356219, AL162730, AL354794 Genomic DNA. Translation: CAI14095.1. CH471089 Genomic DNA. Translation: EAW62465.1. BC030587 mRNA. Translation: AAH30587.1. U78580 mRNA. Translation: AAC50915.1. |
| IPI | IPI00304025. IPI00465236. |
| RefSeq | NP_003549.1. NM_003558.2. |
| UniGene | Hs.534371. |
3D structure databases | |
| ProteinModelPortal | O14986. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | O14986. |
Proteomic databases | |
| PaxDb | O14986. |
| PRIDE | O14986. |
Protocols and materials databases | |
| DNASU | 8395. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000265382; ENSP00000265382; ENSG00000107242. ENST00000377284; ENSP00000366498; ENSG00000107242. ENST00000377290; ENSP00000366505; ENSG00000107242. ENST00000437200; ENSP00000398587; ENSG00000107242. ENST00000440050; ENSP00000411477; ENSG00000107242. ENST00000478500; ENSP00000435778; ENSG00000107242. |
| GeneID | 8395. |
| KEGG | hsa:8395. |
| UCSC | uc004agu.3. human. |
Organism-specific databases | |
| CTD | 8395. |
| GeneCards | GC09P071320. |
| HGNC | HGNC:8995. PIP5K1B. |
| HPA | HPA009687. |
| MIM | 602745. gene. |
| neXtProt | NX_O14986. |
| PharmGKB | PA33328. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG5253. |
| HOVERGEN | HBG052818. |
| KO | K00889. |
| OMA | EHYPHDR. |
Enzyme and pathway databases | |
| BioCyc | MetaCyc:HS02982-MONOMER. |
| Reactome | REACT_111217. Metabolism. |
| SABIO-RK | O14986. |
Gene expression databases | |
| ArrayExpress | O14986. |
| Bgee | O14986. |
| Genevestigator | O14986. |
Family and domain databases | |
| InterPro | IPR023610. PInositol-4-P-5-kinase. IPR002498. PInositol-4-P-5-kinase_core. IPR016034. PInositol-4P-5-kinase_core_sub. [Graphical view] |
| PANTHER | PTHR23086. PTHR23086. 1 hit. |
| Pfam | PF01504. PIP5K. 1 hit. [Graphical view] |
| SMART | SM00330. PIPKc. 1 hit. [Graphical view] |
| PROSITE | PS51455. PIPK. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 8395. |
| NextBio | 31420. |
| SOURCE | Search... |
Entry information
| Entry name | PI51B_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O14986 Secondary accession number(s): A8K9L9 Q92749 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 9 Human chromosome 9: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
