Reviewed,
UniProtKB/Swiss-Prot O14986 (PI51B_HUMAN)
Last modified
October 13, 2009.
Version 65.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Phosphatidylinositol-4-phosphate 5-kinase type-1 beta EC=2.7.1.68 Alternative name(s): Phosphatidylinositol-4-phosphate 5-kinase type I beta Short name=PtdIns(4)P-5-kinase beta Short name=PIP5KIbeta Type I phosphatidylinositol-4-phosphate 5-kinase beta Protein STM-7 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 540 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Mediates RAC1-dependent reorganization of actin filaments By similarity. Participates in the biosynthesis of phosphatidylinositol-4,5-bisphosphate. |
| Catalytic activity | ATP + 1-phosphatidyl-1D-myo-inositol 4-phosphate = ADP + 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate. |
| Subunit structure | Interacts with RAC1 By similarity. |
| Subcellular location | Endomembrane system By similarity. Note: Associated with membranes By similarity. |
| Tissue specificity | Detected in heart, pancreas, brain, kidney, skeletal muscle and lung. Ref.7 |
| Sequence similarities | Contains 1 PIPK domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | ATP-binding Nucleotide-binding |
| Molecular function | Kinase Transferase |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | phosphatidylinositol metabolic process Inferred from electronic annotation. Source: InterPro phosphorylationNon-traceable author statement. Source: UniProtKB |
| Cellular component | endomembrane system Inferred from electronic annotation. Source: UniProtKB-SubCell membraneInferred from electronic annotation. Source: UniProtKB-KW |
| Molecular function | 1-phosphatidylinositol-4-phosphate 5-kinase activity Ref.7 Non-traceable author statement. Source: UniProtKB ATP bindingInferred from electronic annotation. Source: UniProtKB-KW protein bindingInferred from physical interaction. Source: IntAct |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O14986-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O14986-2) Also known as: Isoform 1; The sequence of this isoform differs from the canonical sequence as follows: 24-24: T → TQVKNQILSRLPKIPCTFIQAWTNTEMITLLACYYFRSVST 501-540: SKGLPSSSTFTLEEGTIYLTAEPNTLEVQDDNASVLDVYL → RFKMATSEH |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 540 | 540 | Phosphatidylinositol-4-phosphate 5-kinase type-1 beta | PRO_0000185458 | |||||
Regions | |||||||||
| Domain | 25 – 395 | 371 | PIPK | ||||||
Natural variations | |||||||||
| Alternative sequence | 24 | 1 | T → TQVKNQILSRLPKIPCTFIQ AWTNTEMITLLACYYFRSVS T in isoform 2. | VSP_016010 | |||||
| Alternative sequence | 501 – 540 | 40 | SKGLP…LDVYL → RFKMATSEH in isoform 2. | VSP_016011 | |||||
| Natural variant | 415 | 1 | A → T | VAR_023712 | |||||
Experimental info | |||||||||
| Sequence conflict | 346 | 1 | M → T in AAH30587. Ref.6 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The Friedreich's ataxia gene encodes a novel phosphatidylinositol-4-phosphate 5-kinase." Carvajal J.J., Pook M.A., dos Santos M., Doudney K., Hillermann R., Minogue S., Williamson R., Hsuan J.J., Chamberlain S. Nat. Genet. 14:157-162(1996) [PubMed: 8841185] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Brain. |
| [2] | "Exon-intron structure of a 2.7-kb transcript of the STM7 gene with phosphatidylinositol-4-phosphate 5-kinase activity." Pook M.A., Carvajal J.J., Doudney K., Hillermann R., Chamberlain S. Genomics 42:170-172(1997) [PubMed: 9177790] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT THR-415, ALTERNATIVE SPLICING. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Kidney. |
| [4] | "DNA sequence and analysis of human chromosome 9." Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L. Dunham I.Nature 429:369-374(2004) [PubMed: 15164053] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Testis. |
| [7] | "Type I phosphatidylinositol-4-phosphate 5-kinases are distinct members of this novel lipid kinase family." Loijens J.C., Anderson R.A. J. Biol. Chem. 271:32937-32943(1996) [PubMed: 8955136] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 340-540 (ISOFORM 1), TISSUE SPECIFICITY. Tissue: Fetal brain. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| X92493 mRNA. Translation: CAA63224.1. U52387 U52386 Genomic DNA. Translation: AAC51327.1. AK292734 mRNA. Translation: BAF85423.1. AL162730, AL354794, AL356219 Genomic DNA. Translation: CAH71831.1. AL354794, AL356219 Genomic DNA. Translation: CAI12622.1. AL354794, AL356219 Genomic DNA. Translation: CAI12623.1. AL354794, AL356219 Genomic DNA. Translation: CAI12624.1. AL354794, AL162730, AL356219 Genomic DNA. Translation: CAI12625.1. AL356219, AL354794 Genomic DNA. Translation: CAI14092.1. AL356219, AL354794 Genomic DNA. Translation: CAI14093.1. AL356219, AL354794 Genomic DNA. Translation: CAI14094.1. AL356219, AL162730, AL354794 Genomic DNA. Translation: CAI14095.1. CH471089 Genomic DNA. Translation: EAW62465.1. BC030587 mRNA. Translation: AAH30587.1. U78580 mRNA. Translation: AAC50915.1. | |
| IPI | IPI00304025. IPI00465236. |
| RefSeq | NP_003549.1. |
| UniGene | Hs.534371 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1BO1 based on UniProtKB P78356. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | O14986. 2 interactions. |
| STRING | O14986. |
PTM databases | |
| PhosphoSite | O14986. |
Proteomic databases | |
| PRIDE | O14986. |
Genome annotation databases | |
| Ensembl | ENST00000265382; ENSP00000265382; ENSG00000107242; Homo sapiens. [Genome view] ENST00000312722; ENSP00000322356; ENSG00000107242; Homo sapiens. [Genome view] ENST00000377284; ENSP00000366498; ENSG00000107242; Homo sapiens. [Genome view] ENST00000377290; ENSP00000366505; ENSG00000107242; Homo sapiens. [Genome view] ENST00000419747; ENSP00000391474; ENSG00000107242; Homo sapiens. [Genome view] ENST00000437200; ENSP00000398587; ENSG00000107242; Homo sapiens. [Genome view] ENST00000440050; ENSP00000411477; ENSG00000107242; Homo sapiens. [Genome view] |
| GeneID | 8395. |
| KEGG | hsa:8395. |
| UCSC | uc004agu.1. human. |
Organism-specific databases | |
| CTD | 8395. |
| GeneCards | GC09P070510. |
| H-InvDB | HIX0022058. |
| HGNC | HGNC:8995. PIP5K1B. |
| HPA | HPA009687. |
| MIM | 602745. gene. |
| PharmGKB | PA33328. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | O14986. |
Enzyme and pathway databases | |
| BRENDA | 2.7.1.68. 247. |
Gene expression databases | |
| ArrayExpress | O14986. |
| Bgee | O14986. |
| Genevestigator | O14986. |
Family and domain databases | |
| InterPro | IPR002498. PInositol-4-P-5-kinase_core. IPR016034. PInositol-4P-5-kinase_core_sub. [Graphical view] |
| PANTHER | PTHR23086. PIP5K. 1 hit. |
| Pfam | PF01504. PIP5K. 1 hit. [Graphical view] |
| SMART | SM00330. PIPKc. 1 hit. [Graphical view] |
| PROSITE | PS51455. PIPK. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 31420. |
| SOURCE | Search... |
Entry information
| Entry name | PI51B_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O14986 Secondary accession number(s): A8K9L9 Q92749 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 9 Human chromosome 9: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


