Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

O14986 (PI51B_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 104. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Phosphatidylinositol 4-phosphate 5-kinase type-1 beta

Short name=PIP5K1-beta
Short name=PtdIns(4)P-5-kinase 1 beta
EC=2.7.1.68
Alternative name(s):
Phosphatidylinositol 4-phosphate 5-kinase type I beta
Short name=PIP5KIbeta
Protein STM-7
Type I phosphatidylinositol 4-phosphate 5-kinase beta
Gene names
Name:PIP5K1B
Synonyms:STM7
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length540 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Participates in the biosynthesis of phosphatidylinositol 4,5-bisphosphate. Mediates RAC1-dependent reorganization of actin filaments. Contributes to the activation of PLD2. Together with PIP5K1A is required after stimulation of G-protein coupled receptors for stable platelet adhesion By similarity.

Catalytic activity

ATP + 1-phosphatidyl-1D-myo-inositol 4-phosphate = ADP + 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate.

Subunit structure

Interacts with RAC1, AJUBA, PLD1, PLD2 and ARF1 By similarity.

Subcellular location

Endomembrane system By similarity. Note: Associated with membranes By similarity.

Tissue specificity

Detected in heart, pancreas, brain, kidney, skeletal muscle and lung. Ref.7

Sequence similarities

Contains 1 PIPK domain.

Caution

There is confusion in the literature with phosphatidylinositol 4-phosphate 5-kinase type I nomenclature due to the fact that frequently mouse PIP5K1B is named Phosphatidylinositol 4-phosphate 5-kinase type I alpha.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: O14986-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: O14986-2)

Also known as: Isoform 1;

The sequence of this isoform differs from the canonical sequence as follows:
     24-24: T → TQVKNQILSRLPKIPCTFIQAWTNTEMITLLACYYFRSVST
     501-540: SKGLPSSSTFTLEEGTIYLTAEPNTLEVQDDNASVLDVYL → RFKMATSEH
Isoform 3 (identifier: O14986-3)

The sequence of this isoform differs from the canonical sequence as follows:
     503-540: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 540540Phosphatidylinositol 4-phosphate 5-kinase type-1 beta
PRO_0000185458

Regions

Domain25 – 395371PIPK

Natural variations

Alternative sequence241T → TQVKNQILSRLPKIPCTFIQ AWTNTEMITLLACYYFRSVS T in isoform 2.
VSP_016010
Alternative sequence501 – 54040SKGLP…LDVYL → RFKMATSEH in isoform 2.
VSP_016011
Alternative sequence503 – 54038Missing in isoform 3.
VSP_054771
Natural variant4151A → T. Ref.2
Corresponds to variant rs55897616 [ dbSNP | Ensembl ].
VAR_023712

Experimental info

Sequence conflict3461M → T in AAH30587. Ref.6

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified October 25, 2005. Version 2.
Checksum: 7A683794A39A20B6

FASTA54061,036
        10         20         30         40         50         60 
MSSAAENGEA APGKQNEEKT YKKTASSAIK GAIQLGIGYT VGNLTSKPER DVLMQDFYVV 

        70         80         90        100        110        120 
ESVFLPSEGS NLTPAHHYPD FRFKTYAPLA FRYFRELFGI KPDDYLYSIC SEPLIELSNP 

       130        140        150        160        170        180 
GASGSLFFVT SDDEFIIKTV QHKEAEFLQK LLPGYYMNLN QNPRTLLPKF YGLYCMQSGG 

       190        200        210        220        230        240 
INIRIVVMNN VLPRSMRMHF TYDLKGSTYK RRASRKEREK SNPTFKDLDF LQDMHEGLYF 

       250        260        270        280        290        300 
DTETYNALMK TLQRDCRVLE SFKIMDYSLL LGIHFLDHSL KEKEEETPQN VPDAKRTGMQ 

       310        320        330        340        350        360 
KVLYSTAMES IQGPGKSGDG IITENPDTMG GIPAKSHRGE KLLLFMGIID ILQSYRLMKK 

       370        380        390        400        410        420 
LEHSWKALVY DGDTVSVHRP SFYADRFLKF MNSRVFKKIQ ALKASPSKKR CNSIAALKAT 

       430        440        450        460        470        480 
SQEIVSSISQ EWKDEKRDLL TEGQSFSSLD EEALGSRHRP DLVPSTPSLF EAASLATTIS 

       490        500        510        520        530        540 
SSSLYVNEHY PHDRPTLYSN SKGLPSSSTF TLEEGTIYLT AEPNTLEVQD DNASVLDVYL 

« Hide

Isoform 2 (Isoform 1) [UniParc].

Checksum: B12247947FAAB6B1
Show »

FASTA54962,485
Isoform 3 [UniParc].

Checksum: CC7A35788CB772F2
Show »

FASTA50256,951

References

« Hide 'large scale' references
[1]"The Friedreich's ataxia gene encodes a novel phosphatidylinositol-4-phosphate 5-kinase."
Carvajal J.J., Pook M.A., dos Santos M., Doudney K., Hillermann R., Minogue S., Williamson R., Hsuan J.J., Chamberlain S.
Nat. Genet. 14:157-162(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Brain.
[2]"Exon-intron structure of a 2.7-kb transcript of the STM7 gene with phosphatidylinositol-4-phosphate 5-kinase activity."
Pook M.A., Carvajal J.J., Doudney K., Hillermann R., Chamberlain S.
Genomics 42:170-172(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT THR-415, ALTERNATIVE SPLICING.
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
Tissue: Kidney.
[4]"DNA sequence and analysis of human chromosome 9."
Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L. expand/collapse author list , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Testis.
[7]"Type I phosphatidylinositol-4-phosphate 5-kinases are distinct members of this novel lipid kinase family."
Loijens J.C., Anderson R.A.
J. Biol. Chem. 271:32937-32943(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 340-540 (ISOFORM 1), TISSUE SPECIFICITY.
Tissue: Fetal brain.
[8]"Large-scale proteomics analysis of the human kinome."
Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G., Mann M., Daub H.
Mol. Cell. Proteomics 8:1751-1764(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
X92493 mRNA. Translation: CAA63224.1.
U52387 expand/collapse EMBL AC list , U52376, U52377, U52378, U52379, U52380, U52381, U52382, U52383, U52384, U52385, U52386 Genomic DNA. Translation: AAC51327.1.
AK292734 mRNA. Translation: BAF85423.1.
AK295587 mRNA. Translation: BAG58479.1.
AL162730, AL354794, AL356219 Genomic DNA. Translation: CAH71831.1.
AL354794, AL356219 Genomic DNA. Translation: CAI12622.1.
AL354794, AL356219 Genomic DNA. Translation: CAI12623.1.
AL354794, AL356219 Genomic DNA. Translation: CAI12624.1.
AL354794, AL162730, AL356219 Genomic DNA. Translation: CAI12625.1.
AL356219, AL354794 Genomic DNA. Translation: CAI14092.1.
AL356219, AL354794 Genomic DNA. Translation: CAI14093.1.
AL356219, AL354794 Genomic DNA. Translation: CAI14094.1.
AL356219, AL162730, AL354794 Genomic DNA. Translation: CAI14095.1.
CH471089 Genomic DNA. Translation: EAW62465.1.
BC030587 mRNA. Translation: AAH30587.1.
U78580 mRNA. Translation: AAC50915.1.
CCDSCCDS6624.1. [O14986-1]
RefSeqNP_001265182.1. NM_001278253.1. [O14986-3]
NP_003549.1. NM_003558.3. [O14986-1]
XP_005252318.1. XM_005252261.2. [O14986-1]
XP_005252319.1. XM_005252262.2. [O14986-1]
XP_006717363.1. XM_006717300.1. [O14986-1]
XP_006717364.1. XM_006717301.1. [O14986-3]
UniGeneHs.534371.

3D structure databases

ProteinModelPortalO14986.
SMRO14986. Positions 25-279.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid113984. 4 interactions.

PTM databases

PhosphoSiteO14986.

Proteomic databases

MaxQBO14986.
PaxDbO14986.
PRIDEO14986.

Protocols and materials databases

DNASU8395.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000265382; ENSP00000265382; ENSG00000107242. [O14986-1]
ENST00000478500; ENSP00000435778; ENSG00000107242. [O14986-2]
ENST00000541509; ENSP00000438082; ENSG00000107242.
GeneID8395.
KEGGhsa:8395.
UCSCuc004agu.4. human. [O14986-1]

Organism-specific databases

CTD8395.
GeneCardsGC09P071320.
HGNCHGNC:8995. PIP5K1B.
HPAHPA009687.
MIM602745. gene.
neXtProtNX_O14986.
PharmGKBPA33328.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG5253.
HOVERGENHBG052818.
KOK00889.
OMAEHYPHDR.
OrthoDBEOG70W3DM.
PhylomeDBO14986.
TreeFamTF319618.

Enzyme and pathway databases

BioCycMetaCyc:HS02982-MONOMER.
ReactomeREACT_111102. Signal Transduction.
REACT_111217. Metabolism.
SABIO-RKO14986.

Gene expression databases

ArrayExpressO14986.
BgeeO14986.
GenevestigatorO14986.

Family and domain databases

Gene3D3.30.800.10. 1 hit.
3.30.810.10. 1 hit.
InterProIPR023610. PInositol-4-P-5-kinase.
IPR027483. PInositol-4-P-5-kinase_C.
IPR002498. PInositol-4-P-5-kinase_core.
IPR027484. PInositol-4-P-5-kinase_N.
IPR016034. PInositol-4P-5-kinase_core_sub.
[Graphical view]
PANTHERPTHR23086. PTHR23086. 1 hit.
PfamPF01504. PIP5K. 1 hit.
[Graphical view]
SMARTSM00330. PIPKc. 1 hit.
[Graphical view]
PROSITEPS51455. PIPK. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiPIP5K1B.
GenomeRNAi8395.
NextBio31420.
PROO14986.
SOURCESearch...

Entry information

Entry namePI51B_HUMAN
AccessionPrimary (citable) accession number: O14986
Secondary accession number(s): A8K9L9 expand/collapse secondary AC list , B4DIG7, P78518, P78519, Q5T5K6, Q5T5K8, Q5T5K9, Q5VZ00, Q7KYT5, Q8NHQ5, Q92749
Entry history
Integrated into UniProtKB/Swiss-Prot: October 25, 2005
Last sequence update: October 25, 2005
Last modified: July 9, 2014
This is version 104 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 9

Human chromosome 9: entries, gene names and cross-references to MIM