Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O14986

- PI51B_HUMAN

UniProt

O14986 - PI51B_HUMAN

Protein

Phosphatidylinositol 4-phosphate 5-kinase type-1 beta

Gene

PIP5K1B

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 106 (01 Oct 2014)
      Sequence version 2 (25 Oct 2005)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Participates in the biosynthesis of phosphatidylinositol 4,5-bisphosphate. Mediates RAC1-dependent reorganization of actin filaments. Contributes to the activation of PLD2. Together with PIP5K1A is required after stimulation of G-protein coupled receptors for stable platelet adhesion By similarity.By similarity

    Catalytic activityi

    ATP + 1-phosphatidyl-1D-myo-inositol 4-phosphate = ADP + 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate.

    GO - Molecular functioni

    1. 1-phosphatidylinositol-4-phosphate 5-kinase activity Source: UniProtKB
    2. ATP binding Source: UniProtKB-KW
    3. protein binding Source: UniProtKB

    GO - Biological processi

    1. phosphatidylinositol biosynthetic process Source: Reactome
    2. phosphatidylinositol phosphorylation Source: GOC
    3. phospholipid metabolic process Source: Reactome
    4. small molecule metabolic process Source: Reactome

    Keywords - Molecular functioni

    Kinase, Transferase

    Keywords - Ligandi

    ATP-binding, Nucleotide-binding

    Enzyme and pathway databases

    BioCyciMetaCyc:HS02982-MONOMER.
    ReactomeiREACT_121025. Synthesis of PIPs at the plasma membrane.
    REACT_200668. WNT mediated activation of DVL.
    SABIO-RKO14986.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Phosphatidylinositol 4-phosphate 5-kinase type-1 beta (EC:2.7.1.68)
    Short name:
    PIP5K1-beta
    Short name:
    PtdIns(4)P-5-kinase 1 beta
    Alternative name(s):
    Phosphatidylinositol 4-phosphate 5-kinase type I beta
    Short name:
    PIP5KIbeta
    Protein STM-7
    Type I phosphatidylinositol 4-phosphate 5-kinase beta
    Gene namesi
    Name:PIP5K1B
    Synonyms:STM7
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 9

    Organism-specific databases

    HGNCiHGNC:8995. PIP5K1B.

    Subcellular locationi

    Endomembrane system By similarity
    Note: Associated with membranes.By similarity

    GO - Cellular componenti

    1. cytosol Source: Reactome
    2. endomembrane system Source: UniProtKB-SubCell
    3. membrane Source: UniProtKB-KW
    4. uropod Source: UniProtKB

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA33328.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 540540Phosphatidylinositol 4-phosphate 5-kinase type-1 betaPRO_0000185458Add
    BLAST

    Proteomic databases

    MaxQBiO14986.
    PaxDbiO14986.
    PRIDEiO14986.

    PTM databases

    PhosphoSiteiO14986.

    Expressioni

    Tissue specificityi

    Detected in heart, pancreas, brain, kidney, skeletal muscle and lung.1 Publication

    Gene expression databases

    ArrayExpressiO14986.
    BgeeiO14986.
    GenevestigatoriO14986.

    Organism-specific databases

    HPAiHPA009687.

    Interactioni

    Subunit structurei

    Interacts with RAC1, AJUBA, PLD1, PLD2 and ARF1.By similarity

    Protein-protein interaction databases

    BioGridi113984. 4 interactions.

    Structurei

    3D structure databases

    ProteinModelPortaliO14986.
    SMRiO14986. Positions 25-279.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini25 – 395371PIPKPROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 1 PIPK domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiCOG5253.
    HOVERGENiHBG052818.
    KOiK00889.
    OMAiEHYPHDR.
    OrthoDBiEOG70W3DM.
    PhylomeDBiO14986.
    TreeFamiTF319618.

    Family and domain databases

    Gene3Di3.30.800.10. 1 hit.
    3.30.810.10. 1 hit.
    InterProiIPR023610. PInositol-4-P-5-kinase.
    IPR027483. PInositol-4-P-5-kinase_C.
    IPR002498. PInositol-4-P-5-kinase_core.
    IPR027484. PInositol-4-P-5-kinase_N.
    IPR016034. PInositol-4P-5-kinase_core_sub.
    [Graphical view]
    PANTHERiPTHR23086. PTHR23086. 1 hit.
    PfamiPF01504. PIP5K. 1 hit.
    [Graphical view]
    SMARTiSM00330. PIPKc. 1 hit.
    [Graphical view]
    PROSITEiPS51455. PIPK. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O14986-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSSAAENGEA APGKQNEEKT YKKTASSAIK GAIQLGIGYT VGNLTSKPER    50
    DVLMQDFYVV ESVFLPSEGS NLTPAHHYPD FRFKTYAPLA FRYFRELFGI 100
    KPDDYLYSIC SEPLIELSNP GASGSLFFVT SDDEFIIKTV QHKEAEFLQK 150
    LLPGYYMNLN QNPRTLLPKF YGLYCMQSGG INIRIVVMNN VLPRSMRMHF 200
    TYDLKGSTYK RRASRKEREK SNPTFKDLDF LQDMHEGLYF DTETYNALMK 250
    TLQRDCRVLE SFKIMDYSLL LGIHFLDHSL KEKEEETPQN VPDAKRTGMQ 300
    KVLYSTAMES IQGPGKSGDG IITENPDTMG GIPAKSHRGE KLLLFMGIID 350
    ILQSYRLMKK LEHSWKALVY DGDTVSVHRP SFYADRFLKF MNSRVFKKIQ 400
    ALKASPSKKR CNSIAALKAT SQEIVSSISQ EWKDEKRDLL TEGQSFSSLD 450
    EEALGSRHRP DLVPSTPSLF EAASLATTIS SSSLYVNEHY PHDRPTLYSN 500
    SKGLPSSSTF TLEEGTIYLT AEPNTLEVQD DNASVLDVYL 540
    Length:540
    Mass (Da):61,036
    Last modified:October 25, 2005 - v2
    Checksum:i7A683794A39A20B6
    GO
    Isoform 2 (identifier: O14986-2) [UniParc]FASTAAdd to Basket

    Also known as: Isoform 1

    The sequence of this isoform differs from the canonical sequence as follows:
         24-24: T → TQVKNQILSRLPKIPCTFIQAWTNTEMITLLACYYFRSVST
         501-540: SKGLPSSSTFTLEEGTIYLTAEPNTLEVQDDNASVLDVYL → RFKMATSEH

    Show »
    Length:549
    Mass (Da):62,485
    Checksum:iB12247947FAAB6B1
    GO
    Isoform 3 (identifier: O14986-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         503-540: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:502
    Mass (Da):56,951
    Checksum:iCC7A35788CB772F2
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti346 – 3461M → T in AAH30587. (PubMed:15489334)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti415 – 4151A → T.1 Publication
    Corresponds to variant rs55897616 [ dbSNP | Ensembl ].
    VAR_023712

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei24 – 241T → TQVKNQILSRLPKIPCTFIQ AWTNTEMITLLACYYFRSVS T in isoform 2. 1 PublicationVSP_016010
    Alternative sequencei501 – 54040SKGLP…LDVYL → RFKMATSEH in isoform 2. 1 PublicationVSP_016011Add
    BLAST
    Alternative sequencei503 – 54038Missing in isoform 3. 1 PublicationVSP_054771Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X92493 mRNA. Translation: CAA63224.1.
    U52387
    , U52376, U52377, U52378, U52379, U52380, U52381, U52382, U52383, U52384, U52385, U52386 Genomic DNA. Translation: AAC51327.1.
    AK292734 mRNA. Translation: BAF85423.1.
    AK295587 mRNA. Translation: BAG58479.1.
    AL162730, AL354794, AL356219 Genomic DNA. Translation: CAH71831.1.
    AL354794, AL356219 Genomic DNA. Translation: CAI12622.1.
    AL354794, AL356219 Genomic DNA. Translation: CAI12623.1.
    AL354794, AL356219 Genomic DNA. Translation: CAI12624.1.
    AL354794, AL162730, AL356219 Genomic DNA. Translation: CAI12625.1.
    AL356219, AL354794 Genomic DNA. Translation: CAI14092.1.
    AL356219, AL354794 Genomic DNA. Translation: CAI14093.1.
    AL356219, AL354794 Genomic DNA. Translation: CAI14094.1.
    AL356219, AL162730, AL354794 Genomic DNA. Translation: CAI14095.1.
    CH471089 Genomic DNA. Translation: EAW62465.1.
    BC030587 mRNA. Translation: AAH30587.1.
    U78580 mRNA. Translation: AAC50915.1.
    CCDSiCCDS65063.1. [O14986-3]
    CCDS6624.1. [O14986-1]
    RefSeqiNP_001265182.1. NM_001278253.1. [O14986-3]
    NP_003549.1. NM_003558.3. [O14986-1]
    XP_005252318.1. XM_005252261.2. [O14986-1]
    XP_005252319.1. XM_005252262.2. [O14986-1]
    XP_006717363.1. XM_006717300.1. [O14986-1]
    XP_006717364.1. XM_006717301.1. [O14986-3]
    UniGeneiHs.534371.

    Genome annotation databases

    EnsembliENST00000265382; ENSP00000265382; ENSG00000107242. [O14986-1]
    ENST00000478500; ENSP00000435778; ENSG00000107242. [O14986-2]
    ENST00000541509; ENSP00000438082; ENSG00000107242. [O14986-3]
    GeneIDi8395.
    KEGGihsa:8395.
    UCSCiuc004agu.4. human. [O14986-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X92493 mRNA. Translation: CAA63224.1 .
    U52387
    , U52376 , U52377 , U52378 , U52379 , U52380 , U52381 , U52382 , U52383 , U52384 , U52385 , U52386 Genomic DNA. Translation: AAC51327.1 .
    AK292734 mRNA. Translation: BAF85423.1 .
    AK295587 mRNA. Translation: BAG58479.1 .
    AL162730 , AL354794 , AL356219 Genomic DNA. Translation: CAH71831.1 .
    AL354794 , AL356219 Genomic DNA. Translation: CAI12622.1 .
    AL354794 , AL356219 Genomic DNA. Translation: CAI12623.1 .
    AL354794 , AL356219 Genomic DNA. Translation: CAI12624.1 .
    AL354794 , AL162730 , AL356219 Genomic DNA. Translation: CAI12625.1 .
    AL356219 , AL354794 Genomic DNA. Translation: CAI14092.1 .
    AL356219 , AL354794 Genomic DNA. Translation: CAI14093.1 .
    AL356219 , AL354794 Genomic DNA. Translation: CAI14094.1 .
    AL356219 , AL162730 , AL354794 Genomic DNA. Translation: CAI14095.1 .
    CH471089 Genomic DNA. Translation: EAW62465.1 .
    BC030587 mRNA. Translation: AAH30587.1 .
    U78580 mRNA. Translation: AAC50915.1 .
    CCDSi CCDS65063.1. [O14986-3 ]
    CCDS6624.1. [O14986-1 ]
    RefSeqi NP_001265182.1. NM_001278253.1. [O14986-3 ]
    NP_003549.1. NM_003558.3. [O14986-1 ]
    XP_005252318.1. XM_005252261.2. [O14986-1 ]
    XP_005252319.1. XM_005252262.2. [O14986-1 ]
    XP_006717363.1. XM_006717300.1. [O14986-1 ]
    XP_006717364.1. XM_006717301.1. [O14986-3 ]
    UniGenei Hs.534371.

    3D structure databases

    ProteinModelPortali O14986.
    SMRi O14986. Positions 25-279.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 113984. 4 interactions.

    PTM databases

    PhosphoSitei O14986.

    Proteomic databases

    MaxQBi O14986.
    PaxDbi O14986.
    PRIDEi O14986.

    Protocols and materials databases

    DNASUi 8395.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000265382 ; ENSP00000265382 ; ENSG00000107242 . [O14986-1 ]
    ENST00000478500 ; ENSP00000435778 ; ENSG00000107242 . [O14986-2 ]
    ENST00000541509 ; ENSP00000438082 ; ENSG00000107242 . [O14986-3 ]
    GeneIDi 8395.
    KEGGi hsa:8395.
    UCSCi uc004agu.4. human. [O14986-1 ]

    Organism-specific databases

    CTDi 8395.
    GeneCardsi GC09P071320.
    HGNCi HGNC:8995. PIP5K1B.
    HPAi HPA009687.
    MIMi 602745. gene.
    neXtProti NX_O14986.
    PharmGKBi PA33328.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5253.
    HOVERGENi HBG052818.
    KOi K00889.
    OMAi EHYPHDR.
    OrthoDBi EOG70W3DM.
    PhylomeDBi O14986.
    TreeFami TF319618.

    Enzyme and pathway databases

    BioCyci MetaCyc:HS02982-MONOMER.
    Reactomei REACT_121025. Synthesis of PIPs at the plasma membrane.
    REACT_200668. WNT mediated activation of DVL.
    SABIO-RK O14986.

    Miscellaneous databases

    GeneWikii PIP5K1B.
    GenomeRNAii 8395.
    NextBioi 31420.
    PROi O14986.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O14986.
    Bgeei O14986.
    Genevestigatori O14986.

    Family and domain databases

    Gene3Di 3.30.800.10. 1 hit.
    3.30.810.10. 1 hit.
    InterProi IPR023610. PInositol-4-P-5-kinase.
    IPR027483. PInositol-4-P-5-kinase_C.
    IPR002498. PInositol-4-P-5-kinase_core.
    IPR027484. PInositol-4-P-5-kinase_N.
    IPR016034. PInositol-4P-5-kinase_core_sub.
    [Graphical view ]
    PANTHERi PTHR23086. PTHR23086. 1 hit.
    Pfami PF01504. PIP5K. 1 hit.
    [Graphical view ]
    SMARTi SM00330. PIPKc. 1 hit.
    [Graphical view ]
    PROSITEi PS51455. PIPK. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The Friedreich's ataxia gene encodes a novel phosphatidylinositol-4-phosphate 5-kinase."
      Carvajal J.J., Pook M.A., dos Santos M., Doudney K., Hillermann R., Minogue S., Williamson R., Hsuan J.J., Chamberlain S.
      Nat. Genet. 14:157-162(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Brain.
    2. "Exon-intron structure of a 2.7-kb transcript of the STM7 gene with phosphatidylinositol-4-phosphate 5-kinase activity."
      Pook M.A., Carvajal J.J., Doudney K., Hillermann R., Chamberlain S.
      Genomics 42:170-172(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT THR-415, ALTERNATIVE SPLICING.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
      Tissue: Kidney.
    4. "DNA sequence and analysis of human chromosome 9."
      Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L.
      , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
      Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Testis.
    7. "Type I phosphatidylinositol-4-phosphate 5-kinases are distinct members of this novel lipid kinase family."
      Loijens J.C., Anderson R.A.
      J. Biol. Chem. 271:32937-32943(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 340-540 (ISOFORM 1), TISSUE SPECIFICITY.
      Tissue: Fetal brain.
    8. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiPI51B_HUMAN
    AccessioniPrimary (citable) accession number: O14986
    Secondary accession number(s): A8K9L9
    , B4DIG7, P78518, P78519, Q5T5K6, Q5T5K8, Q5T5K9, Q5VZ00, Q7KYT5, Q8NHQ5, Q92749
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 25, 2005
    Last sequence update: October 25, 2005
    Last modified: October 1, 2014
    This is version 106 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 9
      Human chromosome 9: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3