O14931 (NCTR3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 104.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Natural cytotoxicity triggering receptor 3 Alternative name(s): Activating natural killer receptor p30 Natural killer cell p30-related protein Short name=NK-p30 Short name=NKp30 CD_antigen=CD337 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 201 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Cytotoxicity-activating receptor that contributes to the increased efficiency of activated natural killer (NK) cells to mediate tumor cell lysis. Engagement of NCR3 by BAG6 also promotes dendritic cell (DC) maturation, both through killing those DCs that did not properly acquire a mature phenotype, and inducing NK cells to release TNFA and IFNG, which promotes DC maturation. Ref.1 Ref.10 Ref.13 |
| Subunit structure | Homodimer in the unliganted form. Interacts with CD3Z. Interacts with and is activated by binding to B7H6. Interacts with and is activated by binding to BAG6. Ref.1 Ref.2 Ref.11 Ref.13 Ref.14 Ref.15 Ref.16 |
| Subcellular location | |
| Tissue specificity | Selectively expressed by all resting and activated NK cells and weakly expressed in spleen. Ref.1 Ref.2 |
| Polymorphism | A genetic variation in NCR3 is associated with mild malaria suceptibility [MIM:609148]. |
| Sequence similarities | Belongs to the natural cytotoxicity receptor (NCR) family. Contains 1 Ig-like (immunoglobulin-like) domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Immunoglobulin domain Signal Transmembrane Transmembrane helix |
| Molecular function | Receptor |
| PTM | Disulfide bond Glycoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | cell recognition Traceable author statement. Source: BHF-UCL immune responseNon-traceable author statement. Source: UniProtKB inflammatory responseNon-traceable author statement. Source: UniProtKB positive regulation of natural killer cell mediated cytotoxicityInferred from mutant phenotype. Source: BHF-UCL |
| Cellular component | integral to plasma membrane Traceable author statement. Source: ProtInc |
| Molecular function | receptor activity Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 6 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O14931-1) Also known as: 1C7a; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O14931-2) Also known as: 1C7c; The sequence of this isoform differs from the canonical sequence as follows: 167-201: LTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG → HCHMGTHCHSSDGPRGVIPEPRCP | ||||||
| Isoform 3 (identifier: O14931-3) Also known as: 1C7b; The sequence of this isoform differs from the canonical sequence as follows: 166-201: CLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG → YAKSTLSGFPQL | ||||||
| Isoform 4 (identifier: O14931-4) Also known as: 1C7e; The sequence of this isoform differs from the canonical sequence as follows: 66-90: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 5 (identifier: O14931-5) Also known as: 1C7f; The sequence of this isoform differs from the canonical sequence as follows: 66-90: Missing. 167-201: LTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG → HCHMGTHCHSSDGPRGVIPEPRCP | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 6 (identifier: O14931-6) Also known as: 1C7d; The sequence of this isoform differs from the canonical sequence as follows: 66-90: Missing. 166-201: CLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG → YAKSTLSGFPQL | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 18 | 18 | Potential | ||||||||||||||||||||||
| Chain | 19 – 201 | 183 | Natural cytotoxicity triggering receptor 3 | PRO_0000015032 | |||||||||||||||||||||
Regions | |||||||||||||||||||||||||
| Topological domain | 19 – 135 | 117 | Extracellular Potential | ||||||||||||||||||||||
| Transmembrane | 136 – 156 | 21 | Helical; Potential | ||||||||||||||||||||||
| Topological domain | 157 – 201 | 45 | Cytoplasmic Potential | ||||||||||||||||||||||
| Domain | 19 – 126 | 108 | Ig-like | ||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||
| Glycosylation | 42 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||
| Glycosylation | 121 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||
| Disulfide bond | 39 ↔ 108 | Ref.15 Ref.16 | |||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||
| Alternative sequence | 66 – 90 | 25 | Missing in isoform 4, isoform 5 and isoform 6. | VSP_010411 | |||||||||||||||||||||
| Alternative sequence | 166 – 201 | 36 | CLTWK…PVPGG → YAKSTLSGFPQL in isoform 3 and isoform 6. | VSP_010412 | |||||||||||||||||||||
| Alternative sequence | 167 – 201 | 35 | LTWKG…PVPGG → HCHMGTHCHSSDGPRGVIPE PRCP in isoform 2 and isoform 5. | VSP_010413 | |||||||||||||||||||||
| Natural variant | 103 | 1 | A → T. Corresponds to variant rs11575840 [ dbSNP | Ensembl ]. | VAR_044114 | |||||||||||||||||||||
| Natural variant | 174 | 1 | R → S. Corresponds to variant rs3179003 [ dbSNP | Ensembl ]. | VAR_044115 | |||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||
| Beta strand | 25 – 30 | 6 | |||||||||||||||||||||||
| Beta strand | 35 – 37 | 3 | |||||||||||||||||||||||
| Beta strand | 53 – 59 | 7 | |||||||||||||||||||||||
| Turn | 71 – 73 | 3 | |||||||||||||||||||||||
| Helix | 82 – 86 | 5 | |||||||||||||||||||||||
| Beta strand | 93 – 97 | 5 | |||||||||||||||||||||||
| Beta strand | 104 – 110 | 7 | |||||||||||||||||||||||
| Beta strand | 124 – 128 | 5 | |||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification and molecular characterization of NKp30, a novel triggering receptor involved in natural cytotoxicity mediated by human natural killer cells." Pende D., Parolini S., Pessino A., Sivori S., Augugliaro R., Morelli L., Marcenaro E., Accame L., Malaspina A., Biassoni R., Bottino C., Moretta L., Moretta A. J. Exp. Med. 190:1505-1516(1999) [PubMed: 10562324] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, INTERACTION WITH CD3Z, FUNCTION. Tissue: Lymphoid tissue. |
| [2] | "Identificastion of two novel single nucleotide polymorphisms in the NKp30 gene in human natural killer cells." Sato M., Yabe T., Ohashi J., Tsuchiya N., Hanaoka K., Tokunaga K., Juji T. Submitted (FEB-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY, INTERACTION WITH CD3Z. Tissue: Peripheral blood. |
| [3] | "A new member of the Ig superfamily and a V-ATPase G subunit are among the predicted products of novel genes close to the TNF locus in the human MHC." Neville M.J., Campbell R.D. J. Immunol. 162:4745-4754(1999) [PubMed: 10202016] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5 AND 6). |
| [4] | "Genes in a 220-kb region spanning the TNF cluster in human MHC." Nalabolu S.R., Shukla H., Nallur G., Parimoo S., Weissman S.M. Genomics 31:215-222(1996) [PubMed: 8824804] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3). Tissue: Spleen. |
| [5] | "Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse." Xie T., Rowen L., Aguado B., Ahearn M.E., Madan A., Qin S., Campbell R.D., Hood L. Genome Res. 13:2621-2636(2003) [PubMed: 14656967] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "Homo sapiens 2,229,817bp genomic DNA of 6p21.3 HLA class I region." Shiina S., Tamiya G., Oka A., Inoko H. Submitted (SEP-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The DNA sequence and analysis of human chromosome 6." Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. Beck S.Nature 425:805-811(2003) [PubMed: 14574404] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Blood. |
| [10] | "NK-dependent DC maturation is mediated by TNFalpha and IFNgamma released upon engagement of the NKp30 triggering receptor." Vitale M., Della Chiesa M., Carlomagno S., Pende D., Arico M., Moretta L., Moretta A. Blood 106:566-571(2005) [PubMed: 15784725] [Abstract] Cited for: FUNCTION IN DENDRITIC CELLS MATURATION. |
| [11] | "Human leukocyte antigen-B-associated transcript 3 is released from tumor cells and engages the NKp30 receptor on natural killer cells." Pogge von Strandmann E., Simhadri V.R., von Tresckow B., Sasse S., Reiners K.S., Hansen H.P., Rothe A., Boll B., Simhadri V.L., Borchmann P., McKinnon P.J., Hallek M., Engert A. Immunity 27:965-974(2007) [PubMed: 18055229] [Abstract] Cited for: INTERACTION WITH BAG6. |
| [12] | "Association analyses of NCR3 polymorphisms with P. falciparum mild malaria." Delahaye N.F., Barbier M., Fumoux F., Rihet P. Microbes Infect. 9:160-166(2007) [PubMed: 17208487] [Abstract] Cited for: INVOLVEMENT IN MILD MALARIA SUSCEPTIBILITY. |
| [13] | "Dendritic cells release HLA-B-associated transcript-3 positive exosomes to regulate natural killer function." Simhadri V.R., Reiners K.S., Hansen H.P., Topolar D., Simhadri V.L., Nohroudi K., Kufer T.A., Engert A., Pogge von Strandmann E. PLoS ONE 3:E3377-E3377(2008) [PubMed: 18852879] [Abstract] Cited for: FUNCTION IN DENDRITIC CELLS MATURATION, INTERACTION WITH BAG6. |
| [14] | "The B7 family member B7-H6 is a tumor cell ligand for the activating natural killer cell receptor NKp30 in humans." Brandt C.S., Baratin M., Yi E.C., Kennedy J., Gao Z., Fox B., Haldeman B., Ostrander C.D., Kaifu T., Chabannon C., Moretta A., West R., Xu W., Vivier E., Levin S.D. J. Exp. Med. 206:1495-1503(2009) [PubMed: 19528259] [Abstract] Cited for: INTERACTION WITH B7H6. |
| [15] | "Structure of the human activating natural cytotoxicity receptor NKp30 bound to its tumor cell ligand B7-H6." Li Y., Wang Q., Mariuzza R.A. J. Exp. Med. 208:703-714(2011) [PubMed: 21422170] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.3 ANGSTROMS) OF 19-135 IN COMPLEX WITH B7H6, SUBUNIT, DISULFIDE BOND. |
| [16] | "Crystal structure of human natural cytotoxicity receptor NKp30 and identification of its ligand binding site." Joyce M.G., Tran P., Zhuravleva M.A., Jaw J., Colonna M., Sun P.D. Proc. Natl. Acad. Sci. U.S.A. 108:6223-6228(2011) [PubMed: 21444796] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.84 ANGSTROMS) OF 18-130, INTERACTION WITH B7H6, SUBUNIT, DISULFIDE BOND. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AJ223153 mRNA. Translation: CAB54004.1. AB055881 mRNA. Translation: BAB78472.1. Y14768 Genomic DNA. Translation: CAA75063.1. Y14768 Genomic DNA. Translation: CAA75064.1. Y14768 Genomic DNA. Translation: CAA75065.1. Y14768 Genomic DNA. Translation: CAA75066.1. Y14768 Genomic DNA. Translation: CAA75067.1. Y14768 Genomic DNA. Translation: CAA75068.1. AF031136 mRNA. Translation: AAB86578.1. AF031137 mRNA. Translation: AAB86579.1. AF031138 mRNA. Translation: AAB86580.1. AF129756 Genomic DNA. Translation: AAD18088.1. BA000025 Genomic DNA. Translation: BAB63393.1. AL662847 Genomic DNA. Translation: CAI17688.1. AL662847 Genomic DNA. Translation: CAI17689.1. AL662847 Genomic DNA. Translation: CAI17690.1. AL662847 Genomic DNA. Translation: CAI17691.1. AL662801 Genomic DNA. Translation: CAI18302.1. AL662801 Genomic DNA. Translation: CAI18303.1. AL662801 Genomic DNA. Translation: CAI18304.1. AL662801 Genomic DNA. Translation: CAI18305.1. AL929587 Genomic DNA. Translation: CAI18660.1. AL929587 Genomic DNA. Translation: CAI18661.1. AL929587 Genomic DNA. Translation: CAI18662.1. AL929587 Genomic DNA. Translation: CAI18663.1. BX248519 Genomic DNA. Translation: CAI41953.1. BX248519 Genomic DNA. Translation: CAI41954.1. BX248519 Genomic DNA. Translation: CAI41955.1. BX248519 Genomic DNA. Translation: CAI41956.1. CR753892 Genomic DNA. Translation: CAQ06951.1. CR753892 Genomic DNA. Translation: CAQ06953.1. CR753892 Genomic DNA. Translation: CAQ06954.1. CR759886, CR759905 Genomic DNA. Translation: CAQ07224.1. CR759886, CR759905 Genomic DNA. Translation: CAQ07226.1. CR759886, CR759905 Genomic DNA. Translation: CAQ07227.1. CR942185 Genomic DNA. Translation: CAQ07727.1. CR942185 Genomic DNA. Translation: CAQ07729.1. CR942185 Genomic DNA. Translation: CAQ07730.1. CR759905, CR759886 Genomic DNA. Translation: CAQ08772.1. CR759905, CR759886 Genomic DNA. Translation: CAQ08774.1. CR759905, CR759886 Genomic DNA. Translation: CAQ08775.1. BX927320 Genomic DNA. Translation: CAQ10009.1. BX927320 Genomic DNA. Translation: CAQ10011.1. BX927320 Genomic DNA. Translation: CAQ10012.1. CH471081 Genomic DNA. Translation: EAX03439.1. CH471081 Genomic DNA. Translation: EAX03440.1. BC052582 mRNA. Translation: AAH52582.1. | ||||||||||||||||||
| IPI | IPI00011558. IPI00013125. IPI00032121. IPI00383788. IPI00384964. IPI00411498. | ||||||||||||||||||
| RefSeq | NP_001138938.1. NM_001145466.1. NP_001138939.1. NM_001145467.1. NP_667341.1. NM_147130.2. | ||||||||||||||||||
| UniGene | Hs.509513. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | O14931. | ||||||||||||||||||
| SMR | O14931. Positions 18-166. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PRIDE | O14931. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000340027; ENSP00000342156; ENSG00000204475. ENST00000383477; ENSP00000372969; ENSG00000206430. ENST00000415123; ENSP00000416944; ENSG00000237103. ENST00000420556; ENSP00000405306; ENSG00000236315. ENST00000430599; ENSP00000416035; ENSG00000236979. ENST00000435674; ENSP00000390131; ENSG00000225211. ENST00000437517; ENSP00000398313; ENSG00000223833. ENST00000447248; ENSP00000389071; ENSG00000237808. | ||||||||||||||||||
| GeneID | 259197. | ||||||||||||||||||
| KEGG | hsa:259197. | ||||||||||||||||||
| UCSC | uc003nuv.1. human. uc003nux.1. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 259197. | ||||||||||||||||||
| GeneCards | GC06M031557. | ||||||||||||||||||
| HGNC | HGNC:19077. NCR3. | ||||||||||||||||||
| MIM | 609148. phenotype. 611550. gene. | ||||||||||||||||||
| neXtProt | NX_O14931. | ||||||||||||||||||
| PharmGKB | PA134883693. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | prNOG11796. | ||||||||||||||||||
| GeneTree | ENSGT00390000006603. | ||||||||||||||||||
| HOVERGEN | HBG052590. | ||||||||||||||||||
| InParanoid | O14931. | ||||||||||||||||||
| OMA | IGSVTWY. | ||||||||||||||||||
| OrthoDB | EOG4NKBWQ. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| Genevestigator | O14931. | ||||||||||||||||||
| GermOnline | ENSG00000204475. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR007110. Ig-like. IPR013783. Ig-like_fold. IPR003599. Ig_sub. IPR013106. Ig_V-set. [Graphical view] | ||||||||||||||||||
| Gene3D | G3DSA:2.60.40.10. Ig-like_fold. 1 hit. | ||||||||||||||||||
| KO | K06743. | ||||||||||||||||||
| Pfam | PF07686. V-set. 1 hit. [Graphical view] | ||||||||||||||||||
| SMART | SM00409. IG. 1 hit. [Graphical view] | ||||||||||||||||||
| PROSITE | PS50835. IG_LIKE. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| NextBio | 93046. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | NCTR3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O14931 Secondary accession number(s): B0S8F2 Q5STA3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human cell differentiation molecules CD nomenclature of surface proteins of human leucocytes and list of entries |
| Human chromosome 6 Human chromosome 6: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with