Reviewed,
UniProtKB/Swiss-Prot O14931 (NCTR3_HUMAN)
Last modified
March 2, 2010.
Version 89.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Natural cytotoxicity triggering receptor 3 Alternative name(s): Natural killer cell p30-related protein Short name=NK-p30 Short name=NKp30 Activating natural killer receptor p30 CD_antigen=CD337 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 201 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Cytotoxicity-activating receptor that may contribute to the increased efficiency of activated natural killer (NK) cells to mediate tumor cell lysis. Ref.1 |
| Subunit structure | |
| Subcellular location | Cell membrane; Single-pass type I membrane protein Potential. |
| Tissue specificity | Selectively expressed by all resting and activated NK cells and weakly expressed in spleen. Ref.1 Ref.2 |
| Polymorphism | A genetic variation in NCR3 is associated with mild malaria suceptibility [MIM:609148]. |
| Sequence similarities | Belongs to the natural cytotoxicity receptor (NCR) family. Contains 1 Ig-like (immunoglobulin-like) domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Immunoglobulin domain Signal Transmembrane |
| Molecular function | Receptor |
| PTM | Disulfide bond Glycoprotein |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | cell recognition Traceable author statement. Source: UniProtKB immune responseNon-traceable author statement. Source: UniProtKB inflammatory responseNon-traceable author statement. Source: UniProtKB positive regulation of natural killer cell mediated cytotoxicityInferred from mutant phenotype. Source: UniProtKB |
| Cellular component | integral to plasma membrane Traceable author statement. Source: ProtInc |
| Molecular function | receptor activity Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 6 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O14931-1) Also known as: 1C7a; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O14931-2) Also known as: 1C7c; The sequence of this isoform differs from the canonical sequence as follows: 167-201: LTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG → HCHMGTHCHSSDGPRGVIPEPRCP | ||||||
| Isoform 3 (identifier: O14931-3) Also known as: 1C7b; The sequence of this isoform differs from the canonical sequence as follows: 166-201: CLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG → YAKSTLSGFPQL | ||||||
| Isoform 4 (identifier: O14931-4) Also known as: 1C7e; The sequence of this isoform differs from the canonical sequence as follows: 66-90: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 5 (identifier: O14931-5) Also known as: 1C7f; The sequence of this isoform differs from the canonical sequence as follows: 66-90: Missing. 167-201: LTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG → HCHMGTHCHSSDGPRGVIPEPRCP | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 6 (identifier: O14931-6) Also known as: 1C7d; The sequence of this isoform differs from the canonical sequence as follows: 66-90: Missing. 166-201: CLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG → YAKSTLSGFPQL | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 18 | 18 | Potential | ||||||||
| Chain | 19 – 201 | 183 | Natural cytotoxicity triggering receptor 3 | PRO_0000015032 | |||||||
Regions | |||||||||||
| Topological domain | 19 – 135 | 117 | Extracellular Potential | ||||||||
| Transmembrane | 136 – 156 | 21 | Potential | ||||||||
| Topological domain | 157 – 201 | 45 | Cytoplasmic Potential | ||||||||
| Domain | 19 – 126 | 108 | Ig-like | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 42 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 121 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 39 ↔ 108 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 66 – 90 | 25 | Missing in isoform 4, isoform 5 and isoform 6. | VSP_010411 | |||||||
| Alternative sequence | 166 – 201 | 36 | CLTWK…PVPGG → YAKSTLSGFPQL in isoform 3 and isoform 6. | VSP_010412 | |||||||
| Alternative sequence | 167 – 201 | 35 | LTWKG…PVPGG → HCHMGTHCHSSDGPRGVIPE PRCP in isoform 2 and isoform 5. | VSP_010413 | |||||||
| Natural variant | 103 | 1 | A → T: dbSNP rs11575840. | VAR_044114 | |||||||
| Natural variant | 174 | 1 | R → S: dbSNP rs3179003. | VAR_044115 | |||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification and molecular characterization of NKp30, a novel triggering receptor involved in natural cytotoxicity mediated by human natural killer cells." Pende D., Parolini S., Pessino A., Sivori S., Augugliaro R., Morelli L., Marcenaro E., Accame L., Malaspina A., Biassoni R., Bottino C., Moretta L., Moretta A. J. Exp. Med. 190:1505-1516(1999) [PubMed: 10562324] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY, INTERACTION WITH CD3Z, FUNCTION. Tissue: Lymphoid tissue. |
| [2] | "Identificastion of two novel single nucleotide polymorphisms in the NKp30 gene in human natural killer cells." Sato M., Yabe T., Ohashi J., Tsuchiya N., Hanaoka K., Tokunaga K., Juji T. Submitted (FEB-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY, INTERACTION WITH CD3Z. Tissue: Peripheral blood. |
| [3] | "A new member of the Ig superfamily and a V-ATPase G subunit are among the predicted products of novel genes close to the TNF locus in the human MHC." Neville M.J., Campbell R.D. J. Immunol. 162:4745-4754(1999) [PubMed: 10202016] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5 AND 6). |
| [4] | "Genes in a 220-kb region spanning the TNF cluster in human MHC." Nalabolu S.R., Shukla H., Nallur G., Parimoo S., Weissman S.M. Genomics 31:215-222(1996) [PubMed: 8824804] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3). Tissue: Spleen. |
| [5] | "Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse." Xie T., Rowen L., Aguado B., Ahearn M.E., Madan A., Qin S., Campbell R.D., Hood L. Genome Res. 13:2621-2636(2003) [PubMed: 14656967] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "Homo sapiens 2,229,817bp genomic DNA of 6p21.3 HLA class I region." Shiina S., Tamiya G., Oka A., Inoko H. Submitted (SEP-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The DNA sequence and analysis of human chromosome 6." Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. Beck S.Nature 425:805-811(2003) [PubMed: 14574404] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Blood. |
| [10] | "Association analyses of NCR3 polymorphisms with P. falciparum mild malaria." Delahaye N.F., Barbier M., Fumoux F., Rihet P. Microbes Infect. 9:160-166(2007) [PubMed: 17208487] [Abstract] Cited for: INVOLVEMENT IN MILD MALARIA SUSCEPTIBILITY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AJ223153 mRNA. Translation: CAB54004.1. AB055881 mRNA. Translation: BAB78472.1. Y14768 Genomic DNA. Translation: CAA75063.1. Y14768 Genomic DNA. Translation: CAA75064.1. Y14768 Genomic DNA. Translation: CAA75065.1. Y14768 Genomic DNA. Translation: CAA75066.1. Y14768 Genomic DNA. Translation: CAA75067.1. Y14768 Genomic DNA. Translation: CAA75068.1. AF031136 mRNA. Translation: AAB86578.1. AF031137 mRNA. Translation: AAB86579.1. AF031138 mRNA. Translation: AAB86580.1. AF129756 Genomic DNA. Translation: AAD18088.1. BA000025 Genomic DNA. Translation: BAB63393.1. AL662847 Genomic DNA. Translation: CAI17688.1. AL662847 Genomic DNA. Translation: CAI17689.1. AL662847 Genomic DNA. Translation: CAI17690.1. AL662847 Genomic DNA. Translation: CAI17691.1. AL662801 Genomic DNA. Translation: CAI18302.1. AL662801 Genomic DNA. Translation: CAI18303.1. AL662801 Genomic DNA. Translation: CAI18304.1. AL662801 Genomic DNA. Translation: CAI18305.1. AL929587 Genomic DNA. Translation: CAI18660.1. AL929587 Genomic DNA. Translation: CAI18661.1. AL929587 Genomic DNA. Translation: CAI18662.1. AL929587 Genomic DNA. Translation: CAI18663.1. BX248519 Genomic DNA. Translation: CAI41953.1. BX248519 Genomic DNA. Translation: CAI41954.1. BX248519 Genomic DNA. Translation: CAI41955.1. BX248519 Genomic DNA. Translation: CAI41956.1. CR753892 Genomic DNA. Translation: CAQ06951.1. CR753892 Genomic DNA. Translation: CAQ06953.1. CR753892 Genomic DNA. Translation: CAQ06954.1. CR759886, CR759905 Genomic DNA. Translation: CAQ07224.1. CR759886, CR759905 Genomic DNA. Translation: CAQ07226.1. CR759886, CR759905 Genomic DNA. Translation: CAQ07227.1. CR942185 Genomic DNA. Translation: CAQ07727.1. CR942185 Genomic DNA. Translation: CAQ07729.1. CR942185 Genomic DNA. Translation: CAQ07730.1. CR759905, CR759886 Genomic DNA. Translation: CAQ08772.1. CR759905, CR759886 Genomic DNA. Translation: CAQ08774.1. CR759905, CR759886 Genomic DNA. Translation: CAQ08775.1. BX927320 Genomic DNA. Translation: CAQ10009.1. BX927320 Genomic DNA. Translation: CAQ10011.1. BX927320 Genomic DNA. Translation: CAQ10012.1. CH471081 Genomic DNA. Translation: EAX03439.1. CH471081 Genomic DNA. Translation: EAX03440.1. BC052582 mRNA. Translation: AAH52582.1. |
| IPI | IPI00011558. IPI00013125. IPI00032121. IPI00383788. IPI00384964. IPI00411498. |
| RefSeq | NP_001138938.1. NP_001138939.1. NP_667341.1. |
| UniGene | Hs.509513 |
3D structure databases | |
| SMR | O14931. Positions 18-133, 21-166. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | O14931. |
Proteomic databases | |
| PRIDE | O14931. |
Genome annotation databases | |
| Ensembl | ENST00000340027; ENSP00000342156; ENSG00000204475; Homo sapiens. [Genome view] ENST00000383477; ENSP00000372969; ENSG00000206430; Homo sapiens. [Genome view] ENST00000415123; ENSP00000416944; ENSG00000237103; Homo sapiens. [Genome view] ENST00000420556; ENSP00000405306; ENSG00000236315; Homo sapiens. [Genome view] ENST00000430599; ENSP00000416035; ENSG00000236979; Homo sapiens. [Genome view] ENST00000435674; ENSP00000390131; ENSG00000225211; Homo sapiens. [Genome view] ENST00000437517; ENSP00000398313; ENSG00000223833; Homo sapiens. [Genome view] ENST00000447248; ENSP00000389071; ENSG00000237808; Homo sapiens. [Genome view] |
| GeneID | 259197. |
| KEGG | hsa:259197. |
| UCSC | uc003nuv.1. human. uc003nux.1. human. |
Organism-specific databases | |
| CTD | 259197. |
| GeneCards | GC06M031664. |
| HGNC | HGNC:19077. NCR3. |
| MIM | 609148. phenotype. 611550. gene. |
| PharmGKB | PA134883693. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG11796. |
| HOVERGEN | HBG052590. |
| InParanoid | O14931. |
| OMA | GVYVCRV. |
Gene expression databases | |
| Genevestigator | O14931. |
| GermOnline | ENSG00000204475. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR007110. Ig-like. IPR013783. Ig-like_fold. IPR003599. Ig_sub. IPR013106. Ig_V-set. [Graphical view] |
| Gene3D | G3DSA:2.60.40.10. Ig-like_fold. 1 hit. |
| Pfam | PF07686. V-set. 1 hit. [Graphical view] |
| SMART | SM00409. IG. 1 hit. [Graphical view] |
| PROSITE | PS50835. IG_LIKE. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 93046. |
| SOURCE | Search... |
Entry information
| Entry name | NCTR3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O14931 Secondary accession number(s): B0S8F2 Q5STA3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human cell differentiation molecules CD nomenclature of surface proteins of human leucocytes and list of entries |
| Human chromosome 6 Human chromosome 6: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


