Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Natural cytotoxicity triggering receptor 3

Gene

NCR3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Cytotoxicity-activating receptor that contributes to the increased efficiency of activated natural killer (NK) cells to mediate tumor cell lysis. Engagement of NCR3 by BAG6 also promotes dendritic cell (DC) maturation, both through killing those DCs that did not properly acquire a mature phenotype, and inducing NK cells to release TNFA and IFNG, which promotes DC maturation.3 Publications

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Receptor

Enzyme and pathway databases

ReactomeiR-HSA-198933. Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.

Names & Taxonomyi

Protein namesi
Recommended name:
Natural cytotoxicity triggering receptor 3
Alternative name(s):
Activating natural killer receptor p30
Natural killer cell p30-related protein
Short name:
NK-p30
Short name:
NKp30
CD_antigen: CD337
Gene namesi
Name:NCR3
Synonyms:1C7, LY117
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:19077. NCR3.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini19 – 135117ExtracellularSequence analysisAdd
BLAST
Transmembranei136 – 15621HelicalSequence analysisAdd
BLAST
Topological domaini157 – 20145CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

  • cell-cell adherens junction Source: GO_Central
  • integral component of plasma membrane Source: ProtInc
  • plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

MalaCardsiNCR3.
MIMi609148. phenotype.
PharmGKBiPA134883693.

Polymorphism and mutation databases

BioMutaiNCR3.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1818Sequence analysisAdd
BLAST
Chaini19 – 201183Natural cytotoxicity triggering receptor 3PRO_0000015032Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi39 ↔ 108PROSITE-ProRule annotation2 Publications
Glycosylationi42 – 421N-linked (GlcNAc...)Sequence analysis
Glycosylationi121 – 1211N-linked (GlcNAc...)Sequence analysis

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiO14931.
PRIDEiO14931.

Expressioni

Tissue specificityi

Selectively expressed by all resting and activated NK cells and weakly expressed in spleen.2 Publications

Gene expression databases

BgeeiO14931.
ExpressionAtlasiO14931. baseline and differential.
GenevisibleiO14931. HS.

Interactioni

Subunit structurei

Homodimer in the unliganted form. Interacts with CD3Z. Interacts with and is activated by binding to NCR3LG1. Interacts with and is activated by binding to BAG6.7 Publications

GO - Molecular functioni

Protein-protein interaction databases

BioGridi129224. 2 interactions.
DIPiDIP-59939N.
STRINGi9606.ENSP00000342156.

Structurei

Secondary structure

1
201
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi25 – 306Combined sources
Beta strandi35 – 373Combined sources
Beta strandi51 – 599Combined sources
Helixi62 – 643Combined sources
Helixi66 – 683Combined sources
Turni71 – 755Combined sources
Helixi82 – 865Combined sources
Beta strandi93 – 975Combined sources
Helixi100 – 1023Combined sources
Beta strandi104 – 1129Combined sources
Turni113 – 1153Combined sources
Beta strandi116 – 1194Combined sources
Beta strandi123 – 1286Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3NOIX-ray1.84A/B18-130[»]
3PV6X-ray2.30B19-135[»]
ProteinModelPortaliO14931.
SMRiO14931. Positions 18-164.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO14931.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini19 – 126108Ig-likeAdd
BLAST

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410J2FC. Eukaryota.
ENOG410Z2AU. LUCA.
GeneTreeiENSGT00390000006603.
HOVERGENiHBG052590.
InParanoidiO14931.
KOiK06743.
OMAiTWYRDKV.
PhylomeDBiO14931.
TreeFamiTF337790.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
[Graphical view]
PfamiPF07686. V-set. 1 hit.
[Graphical view]
SMARTiSM00409. IG. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 1 hit.
PROSITEiPS50835. IG_LIKE. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O14931-1) [UniParc]FASTAAdd to basket

Also known as: 1C7a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAWMLLLILI MVHPGSCALW VSQPPEIRTL EGSSAFLPCS FNASQGRLAI
60 70 80 90 100
GSVTWFRDEV VPGKEVRNGT PEFRGRLAPL ASSRFLHDHQ AELHIRDVRG
110 120 130 140 150
HDASIYVCRV EVLGLGVGTG NGTRLVVEKE HPQLGAGTVL LLRAGFYAVS
160 170 180 190 200
FLSVAVGSTV YYQGKCLTWK GPRRQLPAVV PAPLPPPCGS SAHLLPPVPG

G
Length:201
Mass (Da):21,593
Last modified:January 1, 1998 - v1
Checksum:i2855AE4D6902D429
GO
Isoform 2 (identifier: O14931-2) [UniParc]FASTAAdd to basket

Also known as: 1C7c

The sequence of this isoform differs from the canonical sequence as follows:
     167-201: LTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG → HCHMGTHCHSSDGPRGVIPEPRCP

Show »
Length:190
Mass (Da):20,640
Checksum:i1FAC919E20A6B18A
GO
Isoform 3 (identifier: O14931-3) [UniParc]FASTAAdd to basket

Also known as: 1C7b

The sequence of this isoform differs from the canonical sequence as follows:
     166-201: CLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG → YAKSTLSGFPQL

Show »
Length:177
Mass (Da):19,237
Checksum:iDD5EC96F0AB2DCE6
GO
Isoform 4 (identifier: O14931-4) [UniParc]FASTAAdd to basket

Also known as: 1C7e

The sequence of this isoform differs from the canonical sequence as follows:
     66-90: Missing.

Note: No experimental confirmation available.
Show »
Length:176
Mass (Da):18,749
Checksum:i162BB775DA2BCD35
GO
Isoform 5 (identifier: O14931-5) [UniParc]FASTAAdd to basket

Also known as: 1C7f

The sequence of this isoform differs from the canonical sequence as follows:
     66-90: Missing.
     167-201: LTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG → HCHMGTHCHSSDGPRGVIPEPRCP

Note: No experimental confirmation available.
Show »
Length:165
Mass (Da):17,796
Checksum:i0A3CA691CA3E1E7E
GO
Isoform 6 (identifier: O14931-6) [UniParc]FASTAAdd to basket

Also known as: 1C7d

The sequence of this isoform differs from the canonical sequence as follows:
     66-90: Missing.
     166-201: CLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG → YAKSTLSGFPQL

Note: No experimental confirmation available.
Show »
Length:152
Mass (Da):16,393
Checksum:i42718746451F9ADC
GO

Polymorphismi

A genetic variation in NCR3 is associated with mild malaria susceptibility [MIMi:609148].1 Publication

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti103 – 1031A → T.
Corresponds to variant rs11575840 [ dbSNP | Ensembl ].
VAR_044114
Natural varianti174 – 1741R → S.
Corresponds to variant rs3179003 [ dbSNP | Ensembl ].
VAR_044115

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei66 – 9025Missing in isoform 4, isoform 5 and isoform 6. 1 PublicationVSP_010411Add
BLAST
Alternative sequencei166 – 20136CLTWK…PVPGG → YAKSTLSGFPQL in isoform 3 and isoform 6. 2 PublicationsVSP_010412Add
BLAST
Alternative sequencei167 – 20135LTWKG…PVPGG → HCHMGTHCHSSDGPRGVIPE PRCP in isoform 2 and isoform 5. 4 PublicationsVSP_010413Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ223153 mRNA. Translation: CAB54004.1.
AB055881 mRNA. Translation: BAB78472.1.
Y14768 Genomic DNA. Translation: CAA75063.1.
Y14768 Genomic DNA. Translation: CAA75064.1.
Y14768 Genomic DNA. Translation: CAA75065.1.
Y14768 Genomic DNA. Translation: CAA75066.1.
Y14768 Genomic DNA. Translation: CAA75067.1.
Y14768 Genomic DNA. Translation: CAA75068.1.
AF031136 mRNA. Translation: AAB86578.1.
AF031137 mRNA. Translation: AAB86579.1.
AF031138 mRNA. Translation: AAB86580.1.
AF129756 Genomic DNA. Translation: AAD18088.1.
BA000025 Genomic DNA. Translation: BAB63393.1.
AL662847 Genomic DNA. Translation: CAI17688.1.
AL662847 Genomic DNA. Translation: CAI17689.1.
AL662847 Genomic DNA. Translation: CAI17690.1.
AL662847 Genomic DNA. Translation: CAI17691.1.
AL662801 Genomic DNA. Translation: CAI18302.1.
AL662801 Genomic DNA. Translation: CAI18303.1.
AL662801 Genomic DNA. Translation: CAI18304.1.
AL662801 Genomic DNA. Translation: CAI18305.1.
AL929587 Genomic DNA. Translation: CAI18660.1.
AL929587 Genomic DNA. Translation: CAI18661.1.
AL929587 Genomic DNA. Translation: CAI18662.1.
AL929587 Genomic DNA. Translation: CAI18663.1.
BX248519 Genomic DNA. Translation: CAI41953.1.
BX248519 Genomic DNA. Translation: CAI41954.1.
BX248519 Genomic DNA. Translation: CAI41955.1.
BX248519 Genomic DNA. Translation: CAI41956.1.
CR753892 Genomic DNA. Translation: CAQ06951.1.
CR753892 Genomic DNA. Translation: CAQ06953.1.
CR753892 Genomic DNA. Translation: CAQ06954.1.
CR759886, CR759905 Genomic DNA. Translation: CAQ07224.1.
CR759886, CR759905 Genomic DNA. Translation: CAQ07226.1.
CR759886, CR759905 Genomic DNA. Translation: CAQ07227.1.
CR942185 Genomic DNA. Translation: CAQ07727.1.
CR942185 Genomic DNA. Translation: CAQ07729.1.
CR942185 Genomic DNA. Translation: CAQ07730.1.
CR759905, CR759886 Genomic DNA. Translation: CAQ08772.1.
CR759905, CR759886 Genomic DNA. Translation: CAQ08774.1.
CR759905, CR759886 Genomic DNA. Translation: CAQ08775.1.
BX927320 Genomic DNA. Translation: CAQ10009.1.
BX927320 Genomic DNA. Translation: CAQ10011.1.
BX927320 Genomic DNA. Translation: CAQ10012.1.
CH471081 Genomic DNA. Translation: EAX03439.1.
CH471081 Genomic DNA. Translation: EAX03440.1.
BC052582 mRNA. Translation: AAH52582.1.
CCDSiCCDS34397.1. [O14931-1]
CCDS47401.1. [O14931-3]
CCDS47402.1. [O14931-2]
RefSeqiNP_001138938.1. NM_001145466.1. [O14931-3]
NP_001138939.1. NM_001145467.1. [O14931-2]
NP_667341.1. NM_147130.2. [O14931-1]
XP_006715112.1. XM_006715049.2. [O14931-1]
XP_006725094.1. XM_006725031.2. [O14931-1]
XP_006725541.1. XM_006725478.2. [O14931-1]
XP_006725755.1. XM_006725692.2. [O14931-1]
XP_006725871.1. XM_006725808.2. [O14931-1]
XP_006725965.1. XM_006725902.2. [O14931-1]
XP_006726052.1. XM_006725989.2. [O14931-1]
XP_006726144.1. XM_006726081.2. [O14931-1]
XP_011512761.1. XM_011514459.1. [O14931-4]
XP_011544587.1. XM_011546285.1. [O14931-4]
XP_011545917.1. XM_011547615.1. [O14931-4]
XP_011546152.1. XM_011547850.1. [O14931-4]
XP_011546323.1. XM_011548021.1. [O14931-1]
XP_011546324.1. XM_011548022.1. [O14931-4]
XP_011546512.1. XM_011548210.1. [O14931-4]
UniGeneiHs.509513.

Genome annotation databases

EnsembliENST00000340027; ENSP00000342156; ENSG00000204475. [O14931-1]
ENST00000376071; ENSP00000365239; ENSG00000204475. [O14931-5]
ENST00000376072; ENSP00000365240; ENSG00000204475. [O14931-2]
ENST00000376073; ENSP00000365241; ENSG00000204475. [O14931-3]
ENST00000383476; ENSP00000372968; ENSG00000206430. [O14931-2]
ENST00000383477; ENSP00000372969; ENSG00000206430. [O14931-1]
ENST00000383478; ENSP00000372970; ENSG00000206430. [O14931-3]
ENST00000400241; ENSP00000383100; ENSG00000206430. [O14931-5]
ENST00000412603; ENSP00000389419; ENSG00000225211. [O14931-2]
ENST00000415123; ENSP00000416944; ENSG00000237103. [O14931-1]
ENST00000418936; ENSP00000402904; ENSG00000237808. [O14931-2]
ENST00000419086; ENSP00000416105; ENSG00000223833. [O14931-5]
ENST00000419728; ENSP00000406373; ENSG00000236315. [O14931-5]
ENST00000420485; ENSP00000412474; ENSG00000237808. [O14931-5]
ENST00000420556; ENSP00000405306; ENSG00000236315. [O14931-1]
ENST00000430599; ENSP00000416035; ENSG00000236979. [O14931-1]
ENST00000432392; ENSP00000409874; ENSG00000236315. [O14931-3]
ENST00000433654; ENSP00000391177; ENSG00000237808. [O14931-3]
ENST00000435674; ENSP00000390131; ENSG00000225211. [O14931-1]
ENST00000436253; ENSP00000395238; ENSG00000223833. [O14931-3]
ENST00000436623; ENSP00000404747; ENSG00000237103. [O14931-2]
ENST00000437517; ENSP00000398313; ENSG00000223833. [O14931-1]
ENST00000438663; ENSP00000415697; ENSG00000225211. [O14931-5]
ENST00000439584; ENSP00000408960; ENSG00000237103. [O14931-3]
ENST00000441372; ENSP00000399128; ENSG00000236979. [O14931-2]
ENST00000446756; ENSP00000411205; ENSG00000236979. [O14931-3]
ENST00000447248; ENSP00000389071; ENSG00000237808. [O14931-1]
ENST00000452296; ENSP00000403978; ENSG00000223833. [O14931-2]
ENST00000453657; ENSP00000409048; ENSG00000236979. [O14931-5]
ENST00000455448; ENSP00000415456; ENSG00000237103. [O14931-5]
ENST00000455825; ENSP00000389396; ENSG00000225211. [O14931-3]
ENST00000457547; ENSP00000412702; ENSG00000236315. [O14931-2]
GeneIDi259197.
KEGGihsa:259197.
UCSCiuc003nuv.3. human. [O14931-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ223153 mRNA. Translation: CAB54004.1.
AB055881 mRNA. Translation: BAB78472.1.
Y14768 Genomic DNA. Translation: CAA75063.1.
Y14768 Genomic DNA. Translation: CAA75064.1.
Y14768 Genomic DNA. Translation: CAA75065.1.
Y14768 Genomic DNA. Translation: CAA75066.1.
Y14768 Genomic DNA. Translation: CAA75067.1.
Y14768 Genomic DNA. Translation: CAA75068.1.
AF031136 mRNA. Translation: AAB86578.1.
AF031137 mRNA. Translation: AAB86579.1.
AF031138 mRNA. Translation: AAB86580.1.
AF129756 Genomic DNA. Translation: AAD18088.1.
BA000025 Genomic DNA. Translation: BAB63393.1.
AL662847 Genomic DNA. Translation: CAI17688.1.
AL662847 Genomic DNA. Translation: CAI17689.1.
AL662847 Genomic DNA. Translation: CAI17690.1.
AL662847 Genomic DNA. Translation: CAI17691.1.
AL662801 Genomic DNA. Translation: CAI18302.1.
AL662801 Genomic DNA. Translation: CAI18303.1.
AL662801 Genomic DNA. Translation: CAI18304.1.
AL662801 Genomic DNA. Translation: CAI18305.1.
AL929587 Genomic DNA. Translation: CAI18660.1.
AL929587 Genomic DNA. Translation: CAI18661.1.
AL929587 Genomic DNA. Translation: CAI18662.1.
AL929587 Genomic DNA. Translation: CAI18663.1.
BX248519 Genomic DNA. Translation: CAI41953.1.
BX248519 Genomic DNA. Translation: CAI41954.1.
BX248519 Genomic DNA. Translation: CAI41955.1.
BX248519 Genomic DNA. Translation: CAI41956.1.
CR753892 Genomic DNA. Translation: CAQ06951.1.
CR753892 Genomic DNA. Translation: CAQ06953.1.
CR753892 Genomic DNA. Translation: CAQ06954.1.
CR759886, CR759905 Genomic DNA. Translation: CAQ07224.1.
CR759886, CR759905 Genomic DNA. Translation: CAQ07226.1.
CR759886, CR759905 Genomic DNA. Translation: CAQ07227.1.
CR942185 Genomic DNA. Translation: CAQ07727.1.
CR942185 Genomic DNA. Translation: CAQ07729.1.
CR942185 Genomic DNA. Translation: CAQ07730.1.
CR759905, CR759886 Genomic DNA. Translation: CAQ08772.1.
CR759905, CR759886 Genomic DNA. Translation: CAQ08774.1.
CR759905, CR759886 Genomic DNA. Translation: CAQ08775.1.
BX927320 Genomic DNA. Translation: CAQ10009.1.
BX927320 Genomic DNA. Translation: CAQ10011.1.
BX927320 Genomic DNA. Translation: CAQ10012.1.
CH471081 Genomic DNA. Translation: EAX03439.1.
CH471081 Genomic DNA. Translation: EAX03440.1.
BC052582 mRNA. Translation: AAH52582.1.
CCDSiCCDS34397.1. [O14931-1]
CCDS47401.1. [O14931-3]
CCDS47402.1. [O14931-2]
RefSeqiNP_001138938.1. NM_001145466.1. [O14931-3]
NP_001138939.1. NM_001145467.1. [O14931-2]
NP_667341.1. NM_147130.2. [O14931-1]
XP_006715112.1. XM_006715049.2. [O14931-1]
XP_006725094.1. XM_006725031.2. [O14931-1]
XP_006725541.1. XM_006725478.2. [O14931-1]
XP_006725755.1. XM_006725692.2. [O14931-1]
XP_006725871.1. XM_006725808.2. [O14931-1]
XP_006725965.1. XM_006725902.2. [O14931-1]
XP_006726052.1. XM_006725989.2. [O14931-1]
XP_006726144.1. XM_006726081.2. [O14931-1]
XP_011512761.1. XM_011514459.1. [O14931-4]
XP_011544587.1. XM_011546285.1. [O14931-4]
XP_011545917.1. XM_011547615.1. [O14931-4]
XP_011546152.1. XM_011547850.1. [O14931-4]
XP_011546323.1. XM_011548021.1. [O14931-1]
XP_011546324.1. XM_011548022.1. [O14931-4]
XP_011546512.1. XM_011548210.1. [O14931-4]
UniGeneiHs.509513.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3NOIX-ray1.84A/B18-130[»]
3PV6X-ray2.30B19-135[»]
ProteinModelPortaliO14931.
SMRiO14931. Positions 18-164.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi129224. 2 interactions.
DIPiDIP-59939N.
STRINGi9606.ENSP00000342156.

Polymorphism and mutation databases

BioMutaiNCR3.

Proteomic databases

PaxDbiO14931.
PRIDEiO14931.

Protocols and materials databases

DNASUi259197.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000340027; ENSP00000342156; ENSG00000204475. [O14931-1]
ENST00000376071; ENSP00000365239; ENSG00000204475. [O14931-5]
ENST00000376072; ENSP00000365240; ENSG00000204475. [O14931-2]
ENST00000376073; ENSP00000365241; ENSG00000204475. [O14931-3]
ENST00000383476; ENSP00000372968; ENSG00000206430. [O14931-2]
ENST00000383477; ENSP00000372969; ENSG00000206430. [O14931-1]
ENST00000383478; ENSP00000372970; ENSG00000206430. [O14931-3]
ENST00000400241; ENSP00000383100; ENSG00000206430. [O14931-5]
ENST00000412603; ENSP00000389419; ENSG00000225211. [O14931-2]
ENST00000415123; ENSP00000416944; ENSG00000237103. [O14931-1]
ENST00000418936; ENSP00000402904; ENSG00000237808. [O14931-2]
ENST00000419086; ENSP00000416105; ENSG00000223833. [O14931-5]
ENST00000419728; ENSP00000406373; ENSG00000236315. [O14931-5]
ENST00000420485; ENSP00000412474; ENSG00000237808. [O14931-5]
ENST00000420556; ENSP00000405306; ENSG00000236315. [O14931-1]
ENST00000430599; ENSP00000416035; ENSG00000236979. [O14931-1]
ENST00000432392; ENSP00000409874; ENSG00000236315. [O14931-3]
ENST00000433654; ENSP00000391177; ENSG00000237808. [O14931-3]
ENST00000435674; ENSP00000390131; ENSG00000225211. [O14931-1]
ENST00000436253; ENSP00000395238; ENSG00000223833. [O14931-3]
ENST00000436623; ENSP00000404747; ENSG00000237103. [O14931-2]
ENST00000437517; ENSP00000398313; ENSG00000223833. [O14931-1]
ENST00000438663; ENSP00000415697; ENSG00000225211. [O14931-5]
ENST00000439584; ENSP00000408960; ENSG00000237103. [O14931-3]
ENST00000441372; ENSP00000399128; ENSG00000236979. [O14931-2]
ENST00000446756; ENSP00000411205; ENSG00000236979. [O14931-3]
ENST00000447248; ENSP00000389071; ENSG00000237808. [O14931-1]
ENST00000452296; ENSP00000403978; ENSG00000223833. [O14931-2]
ENST00000453657; ENSP00000409048; ENSG00000236979. [O14931-5]
ENST00000455448; ENSP00000415456; ENSG00000237103. [O14931-5]
ENST00000455825; ENSP00000389396; ENSG00000225211. [O14931-3]
ENST00000457547; ENSP00000412702; ENSG00000236315. [O14931-2]
GeneIDi259197.
KEGGihsa:259197.
UCSCiuc003nuv.3. human. [O14931-1]

Organism-specific databases

CTDi259197.
GeneCardsiNCR3.
HGNCiHGNC:19077. NCR3.
MalaCardsiNCR3.
MIMi609148. phenotype.
611550. gene.
neXtProtiNX_O14931.
PharmGKBiPA134883693.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410J2FC. Eukaryota.
ENOG410Z2AU. LUCA.
GeneTreeiENSGT00390000006603.
HOVERGENiHBG052590.
InParanoidiO14931.
KOiK06743.
OMAiTWYRDKV.
PhylomeDBiO14931.
TreeFamiTF337790.

Enzyme and pathway databases

ReactomeiR-HSA-198933. Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.

Miscellaneous databases

EvolutionaryTraceiO14931.
GeneWikiiNCR3.
GenomeRNAii259197.
PROiO14931.
SOURCEiSearch...

Gene expression databases

BgeeiO14931.
ExpressionAtlasiO14931. baseline and differential.
GenevisibleiO14931. HS.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
[Graphical view]
PfamiPF07686. V-set. 1 hit.
[Graphical view]
SMARTiSM00409. IG. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 1 hit.
PROSITEiPS50835. IG_LIKE. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Identification and molecular characterization of NKp30, a novel triggering receptor involved in natural cytotoxicity mediated by human natural killer cells."
    Pende D., Parolini S., Pessino A., Sivori S., Augugliaro R., Morelli L., Marcenaro E., Accame L., Malaspina A., Biassoni R., Bottino C., Moretta L., Moretta A.
    J. Exp. Med. 190:1505-1516(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, INTERACTION WITH CD3Z, FUNCTION.
    Tissue: Lymphoid tissue.
  2. "Identification of two novel single nucleotide polymorphisms in the NKp30 gene in human natural killer cells."
    Sato M., Yabe T., Ohashi J., Tsuchiya N., Hanaoka K., Tokunaga K., Juji T.
    Submitted (FEB-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY, INTERACTION WITH CD3Z.
    Tissue: Peripheral blood.
  3. "A new member of the Ig superfamily and a V-ATPase G subunit are among the predicted products of novel genes close to the TNF locus in the human MHC."
    Neville M.J., Campbell R.D.
    J. Immunol. 162:4745-4754(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5 AND 6).
  4. "Genes in a 220-kb region spanning the TNF cluster in human MHC."
    Nalabolu S.R., Shukla H., Nallur G., Parimoo S., Weissman S.M.
    Genomics 31:215-222(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3).
    Tissue: Spleen.
  5. "Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse."
    Xie T., Rowen L., Aguado B., Ahearn M.E., Madan A., Qin S., Campbell R.D., Hood L.
    Genome Res. 13:2621-2636(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "Homo sapiens 2,229,817bp genomic DNA of 6p21.3 HLA class I region."
    Shiina S., Tamiya G., Oka A., Inoko H.
    Submitted (SEP-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The DNA sequence and analysis of human chromosome 6."
    Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
    Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  9. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Blood.
  10. "NK-dependent DC maturation is mediated by TNFalpha and IFNgamma released upon engagement of the NKp30 triggering receptor."
    Vitale M., Della Chiesa M., Carlomagno S., Pende D., Arico M., Moretta L., Moretta A.
    Blood 106:566-571(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN DENDRITIC CELLS MATURATION.
  11. "Human leukocyte antigen-B-associated transcript 3 is released from tumor cells and engages the NKp30 receptor on natural killer cells."
    Pogge von Strandmann E., Simhadri V.R., von Tresckow B., Sasse S., Reiners K.S., Hansen H.P., Rothe A., Boll B., Simhadri V.L., Borchmann P., McKinnon P.J., Hallek M., Engert A.
    Immunity 27:965-974(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH BAG6.
  12. "Association analyses of NCR3 polymorphisms with P. falciparum mild malaria."
    Delahaye N.F., Barbier M., Fumoux F., Rihet P.
    Microbes Infect. 9:160-166(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: INVOLVEMENT IN SUSCEPTIBILITY TO MILD MALARIA.
  13. "Dendritic cells release HLA-B-associated transcript-3 positive exosomes to regulate natural killer function."
    Simhadri V.R., Reiners K.S., Hansen H.P., Topolar D., Simhadri V.L., Nohroudi K., Kufer T.A., Engert A., Pogge von Strandmann E.
    PLoS ONE 3:E3377-E3377(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN DENDRITIC CELLS MATURATION, INTERACTION WITH BAG6.
  14. "The B7 family member B7-H6 is a tumor cell ligand for the activating natural killer cell receptor NKp30 in humans."
    Brandt C.S., Baratin M., Yi E.C., Kennedy J., Gao Z., Fox B., Haldeman B., Ostrander C.D., Kaifu T., Chabannon C., Moretta A., West R., Xu W., Vivier E., Levin S.D.
    J. Exp. Med. 206:1495-1503(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH NCR3LG1.
  15. "Structure of the human activating natural cytotoxicity receptor NKp30 bound to its tumor cell ligand B7-H6."
    Li Y., Wang Q., Mariuzza R.A.
    J. Exp. Med. 208:703-714(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.3 ANGSTROMS) OF 19-135 IN COMPLEX WITH NCR3LG1, SUBUNIT, DISULFIDE BOND.
  16. "Crystal structure of human natural cytotoxicity receptor NKp30 and identification of its ligand binding site."
    Joyce M.G., Tran P., Zhuravleva M.A., Jaw J., Colonna M., Sun P.D.
    Proc. Natl. Acad. Sci. U.S.A. 108:6223-6228(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (1.84 ANGSTROMS) OF 18-130, INTERACTION WITH NCR3LG1, SUBUNIT, DISULFIDE BOND.

Entry informationi

Entry nameiNCTR3_HUMAN
AccessioniPrimary (citable) accession number: O14931
Secondary accession number(s): B0S8F2
, B0S8F4, B0S8F5, O14930, O14932, O95667, O95668, O95669, Q5ST89, Q5ST90, Q5ST91, Q5ST92, Q5STA3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 24, 2004
Last sequence update: January 1, 1998
Last modified: June 8, 2016
This is version 144 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.