O14920 (IKKB_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 150.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Inhibitor of nuclear factor kappa-B kinase subunit beta Short name=I-kappa-B-kinase beta Short name=IKK-B Short name=IKK-beta Short name=IkBKB EC=2.7.11.10 Alternative name(s): I-kappa-B kinase 2 Short name=IKK2 Nuclear factor NF-kappa-B inhibitor kinase beta Short name=NFKBIKB | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 756 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Serine kinase that plays an essential role in the NF-kappa-B signaling pathway which is activated by multiple stimuli such as inflammatory cytokines, bacterial or viral products, DNA damages or other cellular stresses. Acts as part of the canonical IKK complex in the conventional pathway of NF-kappa-B activation and phosphorylates inhibitors of NF-kappa-B on 2 critical serine residues. These modifications allow polyubiquitination of the inhibitors and subsequent degradation by the proteasome. In turn, free NF-kappa-B is translocated into the nucleus and activates the transcription of hundreds of genes involved in immune response, growth control, or protection against apoptosis. In addition to the NF-kappa-B inhibitors, phosphorylates several other components of the signaling pathway including NEMO/IKBKG, NF-kappa-B subunits RELA and NFKB1, as well as IKK-related kinases TBK1 and IKBKE. IKK-related kinase phosphorylations may prevent the overproduction of inflammatory mediators since they exert a negative regulation on canonical IKKs. Also phosphorylates other substrates including NCOA3, BCL10 and IRS1. Within the nucleus, acts as an adapter protein for NFKBIA degradation in UV-induced NF-kappa-B activation. Ref.16 Ref.32 Ref.39 Ref.41 Ref.42 Ref.45 |
| Catalytic activity | ATP + [I-kappa-B protein] = ADP + [I-kappa-B phosphoprotein]. |
| Subunit structure | Component of the I-kappa-B-kinase (IKK) core complex consisting of CHUK, IKBKB and IKBKG; probably four alpha/CHUK-beta/IKBKB dimers are associated with four gamma/IKBKG subunits. The IKK core complex seems to associate with regulatory or adapter proteins to form a IKK-signalosome holo-complex. The IKK complex associates with TERF2IP/RAP1, leading to promote IKK-mediated phosphorylation of RELA/p65. Part of a complex composed of NCOA2, NCOA3, CHUK/IKKA, IKBKB, IKBKG and CREBBP. Part of a 70-90 kDa complex at least consisting of CHUK/IKKA, IKBKB, NFKBIA, RELA, IKBKAP and MAP3K14. Found in a membrane raft complex, at least composed of BCL10, CARD11, DPP4 and IKBKB. Interacts with SQSTM1 through PRKCZ or PRKCI. Forms an NGF-induced complex with IKBKB, PRKCI and TRAF6. May interact with MAVS/IPS1. Interacts with NALP2. Interacts with TICAM1. Interacts with Yersinia yopJ. Interacts with FAF1; the interaction disrupts the IKK complex formation. Interacts with ATM. Part of a ternary complex consisting of TANK, IKBKB and IKBKG. Interacts with NIBP; the interaction is direct. Interacts with ARRB1 and ARRB2. Interacts with TRIM21. Interacts with NLRC5; prevents IKBKB phosphorylation and kinase activity. Interacts with PDPK1. Ref.11 Ref.12 Ref.17 Ref.18 Ref.20 Ref.21 Ref.22 Ref.24 Ref.25 Ref.27 Ref.28 Ref.29 Ref.30 Ref.31 Ref.39 Ref.40 |
| Subcellular location | Cytoplasm. Nucleus. Membrane raft. Note: Colocalized with DPP4 in membrane rafts. Ref.30 Ref.42 |
| Tissue specificity | Highly expressed in heart, placenta, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, testis and peripheral blood. |
| Domain | The kinase domain is located in the N-terminal region. The leucine zipper is important to allow homo- and hetero-dimerization. At the C-terminal region is located the region responsible for the interaction with NEMO/IKBKG. Ref.34 |
| Post-translational modification | Upon cytokine stimulation, phosphorylated on Ser-177 and Ser-181 by MEKK1 and/or MAP3K14/NIK as well as TBK1 and PRKCZ; which enhances activity. Once activated, autophosphorylates on the C-terminal serine cluster; which decreases activity and prevents prolonged activation of the inflammatory response. Phosphorylated by the IKK-related kinases TBK1 and IKBKE, which is associated with reduced CHUK/IKKA and IKBKB activity and NF-kappa-B-dependent gene transcription. Ref.10 Ref.13 Ref.14 Ref.15 Ref.25 Ref.45 Acetylation of Thr-180 by Yersinia yopJ prevents phosphorylation and activation, thus blocking the I-kappa-B pathway. Ubiquitinated. Monoubiquitination involves TRIM21 that leads to inhibition of Tax-induced NF-kappa-B signaling. According to Ref.40, 'Ser-163' does not serve as a monoubiquitination site. According to Ref.26, ubiquitination on 'Ser-163' modulates phosphorylation on C-terminal serine residues. Monoubiquitination by TRIM21 is disrupted by Yersinia yopJ. Ref.26 Ref.40 |
| Sequence similarities | Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. I-kappa-B kinase subfamily. Contains 1 protein kinase domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| itself | 6 | EBI-81266,EBI-81266 | ||
| CHUK | O15111 | 10 | EBI-81266,EBI-81249 | |
| IKBKG | Q9Y6K9 | 14 | EBI-81266,EBI-81279 | |
| KEAP1 | Q14145 | 6 | EBI-81266,EBI-751001 | |
| MAP3K14 | Q99558 | 2 | EBI-81266,EBI-358011 | |
| NCOA3 | Q9Y6Q9 | 3 | EBI-81266,EBI-81196 | |
| NFKBIA | P25963 | 10 | EBI-81266,EBI-307386 | |
| RPS3 | P23396 | 4 | EBI-81266,EBI-351193 | |
| STAP2 | Q9UGK3 | 7 | EBI-81266,EBI-1553984 | |
| TSC1 | Q92574 | 3 | EBI-81266,EBI-1047085 | |
| VACWR196 | P24772 | 3 | EBI-81266,EBI-4291651 | From a different organism. |
| Zc3h12a | Q5D1E7 | 4 | EBI-81266,EBI-5326026 | From a different organism. |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O14920-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O14920-2) The sequence of this isoform differs from the canonical sequence as follows: 1-34: MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHN → MFSGGCHSPGFGRPSPAFPAPGSPPPAPRPCR | ||||||
| Isoform 3 (identifier: O14920-3) The sequence of this isoform differs from the canonical sequence as follows: 231-256: WHSKVRQKSEVDIVVSEDLNGTVKFS → CVRMWPGTVAHSCNPSTLGGRGRWIS 257-756: Missing. | ||||||
| Isoform 4 (identifier: O14920-4) The sequence of this isoform differs from the canonical sequence as follows: 1-66: MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCLEIQIMR → MSSDGTI | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||
Molecule processing | |||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 756 | 756 | Inhibitor of nuclear factor kappa-B kinase subunit beta | PRO_0000086013 | |||||||||||
Regions | |||||||||||||||
| Domain | 15 – 300 | 286 | Protein kinase | ||||||||||||
| Nucleotide binding | 21 – 29 | 9 | ATP By similarity | ||||||||||||
| Region | 458 – 479 | 22 | Leucine-zipper | ||||||||||||
| Region | 737 – 742 | 6 | NEMO-binding | ||||||||||||
Sites | |||||||||||||||
| Active site | 145 | 1 | Proton acceptor By similarity | ||||||||||||
| Binding site | 44 | 1 | ATP By similarity | ||||||||||||
Amino acid modifications | |||||||||||||||
| Modified residue | 177 | 1 | Phosphoserine; by TBK1 and PKC/PRKCZ Ref.13 Ref.14 Ref.15 | ||||||||||||
| Modified residue | 179 | 1 | S-nitrosocysteine Ref.23 | ||||||||||||
| Modified residue | 180 | 1 | O-acetylthreonine; by Yersinia yopJ | ||||||||||||
| Modified residue | 181 | 1 | Phosphoserine; by TBK1, PKC/PRKCZ and PDPK1 Ref.13 Ref.14 Ref.15 Ref.25 | ||||||||||||
| Modified residue | 670 | 1 | Phosphoserine; by autocatalysis Probable | ||||||||||||
| Modified residue | 672 | 1 | Phosphoserine Ref.14 Ref.36 Ref.38 | ||||||||||||
| Modified residue | 675 | 1 | Phosphoserine; by autocatalysis Probable | ||||||||||||
| Modified residue | 682 | 1 | Phosphoserine; by autocatalysis Probable | ||||||||||||
| Modified residue | 689 | 1 | Phosphoserine; by autocatalysis Probable | ||||||||||||
| Modified residue | 692 | 1 | Phosphoserine; by autocatalysis Probable | ||||||||||||
| Modified residue | 695 | 1 | Phosphoserine; by autocatalysis Probable | ||||||||||||
| Modified residue | 697 | 1 | Phosphoserine; by autocatalysis Probable | ||||||||||||
| Modified residue | 705 | 1 | Phosphoserine; by autocatalysis Probable | ||||||||||||
| Modified residue | 733 | 1 | Phosphoserine; by autocatalysis Probable | ||||||||||||
| Modified residue | 740 | 1 | Phosphoserine; by autocatalysis Probable | ||||||||||||
| Modified residue | 750 | 1 | Phosphoserine; by autocatalysis Probable | ||||||||||||
| Cross-link | 163 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) Ref.26 | |||||||||||||
Natural variations | |||||||||||||||
| Alternative sequence | 1 – 66 | 66 | MSWSP…IQIMR → MSSDGTI in isoform 4. | VSP_043408 | |||||||||||
| Alternative sequence | 1 – 34 | 34 | MSWSP…IRWHN → MFSGGCHSPGFGRPSPAFPA PGSPPPAPRPCR in isoform 2. | VSP_041825 | |||||||||||
| Alternative sequence | 231 – 256 | 26 | WHSKV…TVKFS → CVRMWPGTVAHSCNPSTLGG RGRWIS in isoform 3. | VSP_041826 | |||||||||||
| Alternative sequence | 257 – 756 | 500 | Missing in isoform 3. | VSP_041827 | |||||||||||
| Natural variant | 360 | 1 | A → S in breast cancer samples; infiltrating ductal carcinoma; somatic mutation. Ref.47 Ref.48 | VAR_035626 | |||||||||||
| Natural variant | 369 | 1 | Q → R. Ref.48 Corresponds to variant rs56411242 [ dbSNP | Ensembl ]. | VAR_040567 | |||||||||||
| Natural variant | 526 | 1 | R → Q. Ref.48 Corresponds to variant rs2272736 [ dbSNP | Ensembl ]. | VAR_040568 | |||||||||||
| Natural variant | 554 | 1 | R → W. Ref.6 Corresponds to variant rs17875749 [ dbSNP | Ensembl ]. | VAR_021124 | |||||||||||
| Natural variant | 710 | 1 | A → T. Ref.48 Corresponds to variant rs34309584 [ dbSNP | Ensembl ]. | VAR_040569 | |||||||||||
| Natural variant | 734 | 1 | F → L. Ref.48 Corresponds to variant rs56301637 [ dbSNP | Ensembl ]. | VAR_040570 | |||||||||||
| Natural variant | 736 | 1 | A → T. Corresponds to variant rs17611716 [ dbSNP | Ensembl ]. | VAR_051628 | |||||||||||
Experimental info | |||||||||||||||
| Mutagenesis | 44 | 1 | K → A: Loss of kinase activity and no effect on binding to NIK. Ref.1 Ref.2 | ||||||||||||
| Mutagenesis | 163 | 1 | K → R: Monoubiquitinated; when associated with E-177 and E-181. Ref.40 | ||||||||||||
| Mutagenesis | 177 – 181 | 5 | SLCTS → ALCTA: COmplete loss of TBK1-mediated phosphorylation. Ref.1 Ref.15 Ref.40 | ||||||||||||
| Mutagenesis | 177 | 1 | S → A: Decrease of activity. Ref.1 Ref.40 | ||||||||||||
| Mutagenesis | 177 | 1 | S → E: Full activation. Interaction with TRIM21 is enhanced; when associated with E-181. Monoubiquitinated; when associated with R-163 and E-181. Strongly promoted NF-kappa-B gene expression; when associated with E-181. Ref.1 Ref.40 | ||||||||||||
| Mutagenesis | 181 | 1 | S → A: Decrease of activity. Ref.1 Ref.40 | ||||||||||||
| Mutagenesis | 181 | 1 | S → E: Full activation. Interaction with TRIM21 is enhanced; when associated with E-177. Monoubiquitinated; when associated with R-163 and E-177. Strongly promoted NF-kappa-B gene expression; when associated with E-177. Ref.1 Ref.40 | ||||||||||||
| Sequence conflict | 259 | 1 | L → S in BAG63942. Ref.5 | ||||||||||||
| Sequence conflict | 259 | 1 | L → S in BAH14789. Ref.5 | ||||||||||||
Secondary structure | |||||||||||||||
Helix Strand Turn | |||||||||||||||
| Helix | 706 – 729 | 24 | |||||||||||||
| Helix | 734 – 736 | 3 | |||||||||||||
| Helix | 740 – 742 | 3 | |||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "IKK-1 and IKK-2: cytokine-activated IkappaB kinases essential for NF-kappaB activation." Mercurio F., Zhu H., Murray B.W., Shevchenko A., Bennett B.L., Li J.W., Young D.B., Barbosa M., Mann M., Manning A., Rao A. Science 278:860-866(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), MUTAGENESIS OF LYS-44; SER-177 AND SER-181. Tissue: Cervix carcinoma. |
| [2] | "IkappaB kinase-beta: NF-kappaB activation and complex formation with IkappaB kinase-alpha and NIK." Woronicz J.D., Gao X., Cao Z., Rothe M., Goeddel D.V. Science 278:866-869(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), MUTAGENESIS OF LYS-44. |
| [3] | "IkappaB kinase-alpha and -beta genes are coexpressed in adult and embryonic tissues but localized to different human chromosomes." Hu M.C.-T., Wang Y.-P. Gene 222:31-40(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Heart. |
| [4] | "Assignment of IkappaB kinase beta (IKBKB) to human chromosome band 8p12-->p11 by in situ hybridization." Shindo M., Nakano H., Sakon S., Yagita H., Mihara M., Okumura K. Cytogenet. Cell Genet. 82:32-33(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), GENE MAPPING. |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4). Tissue: Testis and Thymus. |
| [6] | SeattleSNPs variation discovery resource Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT TRP-554. |
| [7] | "DNA sequence and analysis of human chromosome 8." Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T. Lander E.S.Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Lung. |
| [9] | "Acetylation of MEK2 and I kappa B kinase (IKK) activation loop residues by YopJ inhibits signaling." Mittal R., Peak-Chew S.Y., McMahon H.T. Proc. Natl. Acad. Sci. U.S.A. 103:18574-18579(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 170-182 (ISOFORM 1), INACTIVATION BY YERSINIA YOPJ, ACETYLATION AT THR-180, MASS SPECTROMETRY. |
| [10] | "Coordinate regulation of IkappaB kinases by mitogen-activated protein kinase kinase kinase 1 and NF-kappaB-inducing kinase." Nemoto S., DiDonato J.A., Lin A. Mol. Cell. Biol. 18:7336-7343(1998) [PubMed] [Europe PMC] [Abstract] Cited for: IKK PHOSPHORYLATION. |
| [11] | "IKAP is a scaffold protein of the IkappaB kinase complex." Cohen L., Henzel W.J., Baeuerle P.A. Nature 395:292-296(1998) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION IN A COMPLEX WITH CHUK; NFKBIA; RELA; IKBKAP AND MAP3K14. |
| [12] | "The interaction of p62 with RIP links the atypical PKCs to NF-kappaB activation." Sanz L., Sanchez P., Lallena M.-J., Diaz-Meco M.T., Moscat J. EMBO J. 18:3044-3053(1999) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SQSTM1; PRKCZ AND PRKCI. |
| [13] | "Activation of IkappaB kinase beta by protein kinase C isoforms." Lallena M.J., Diaz-Meco M.T., Bren G., Paya C.V., Moscat J. Mol. Cell. Biol. 19:2180-2188(1999) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT SER-177 AND SER-181. |
| [14] | "Positive and negative regulation of IkappaB kinase activity through IKKbeta subunit phosphorylation." Delhase M., Hayakawa M., Chen Y., Karin M. Science 284:309-313(1999) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT SER-177; SER-181; SER-670; SER-672; SER-675; SER-682; SER-689; SER-692; SER-695; SER-697; SER-705; SER-733; SER-740 AND SER-750. |
| [15] | "NAK is an IkappaB kinase-activating kinase." Tojima Y., Fujimoto A., Delhase M., Chen Y., Hatakeyama S., Nakayama K., Kaneko Y., Nimura Y., Motoyama N., Ikeda K., Karin M., Nakanishi M. Nature 404:778-782(2000) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT SER-177 AND SER-181 BY TBK1, MUTAGENESIS OF 177-SER--SER-181. |
| [16] | "Direct phosphorylation of NF-kappa B1 p105 by the Ikappa B kinase complex on serine 927 is essential for signal-induced p105 proteolysis." Salmeron A., Janzen J., Soneji Y., Bump N., Kamens J., Allen H., Ley S.C. J. Biol. Chem. 276:22215-22222(2001) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN PHOSPHORYLATION OF NFKB1. |
| [17] | "Association of the adaptor TANK with the I kappa B kinase (IKK) regulator NEMO connects IKK complexes with IKK epsilon and TBK1 kinases." Chariot A., Leonardi A., Muller J., Bonif M., Brown K., Siebenlist U. J. Biol. Chem. 277:37029-37036(2002) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH IKBKG AND TANK. |
| [18] | "Regulation of SRC-3 (pCIP/ACTR/AIB-1/RAC-3/TRAM-1) coactivator activity by I kappa B kinase." Wu R.-C., Qin J., Hashimoto Y., Wong J., Xu J., Tsai S.Y., Tsai M.-J., O'Malley B.W. Mol. Cell. Biol. 22:3549-3561(2002) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION IN A COMPLEX WITH CREBBP; NCOA2; NCOA3; IKKA AND IKBKG. |
| [19] | "Tetrameric oligomerization of IkappaB kinase gamma (IKKgamma) is obligatory for IKK complex activity and NF-kappaB activation." Tegethoff S., Behlke J., Scheidereit C. Mol. Cell. Biol. 23:2029-2041(2003) [PubMed] [Europe PMC] [Abstract] Cited for: COMPOSITION OF THE IKK COMPLEX. |
| [20] | "Mechanisms of the TRIF-induced interferon-stimulated response element and NF-kappaB activation and apoptosis pathways." Han K.J., Su X., Xu L.-G., Bin L.H., Zhang J., Shu H.-B. J. Biol. Chem. 279:15652-15661(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH TICAM1. |
| [21] | "PAN1/NALP2/PYPAF2, an inducible inflammatory mediator that regulates NF-kappaB and caspase-1 activation in macrophages." Bruey J.-M., Bruey-Sedano N., Newman R., Chandler S., Stehlik C., Reed J.C. J. Biol. Chem. 279:51897-51907(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH NALP2. |
| [22] | "beta-Arrestin inhibits NF-kappaB activity by means of its interaction with the NF-kappaB inhibitor IkappaBalpha." Witherow D.S., Garrison T.R., Miller W.E., Lefkowitz R.J. Proc. Natl. Acad. Sci. U.S.A. 101:8603-8607(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH ARRB1 AND ARRB2. |
| [23] | "Nitric oxide represses inhibitory kappaB kinase through S-nitrosylation." Reynaert N.L., Ckless K., Korn S.H., Vos N., Guala A.S., Wouters E.F., van der Vliet A., Janssen-Heininger Y.M. Proc. Natl. Acad. Sci. U.S.A. 101:8945-8950(2004) [PubMed] [Europe PMC] [Abstract] Cited for: S-NITROSYLATION AT CYS-179. |
| [24] | "NIBP, a novel NIK and IKK(beta)-binding protein that enhances NF-(kappa)B activation." Hu W.-H., Pendergast J.S., Mo X.-M., Brambilla R., Bracchi-Ricard V., Li F., Walters W.M., Blits B., He L., Schaal S.M., Bethea J.R. J. Biol. Chem. 280:29233-29241(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH NIBP. |
| [25] | "3-Phosphoinositide-dependent protein kinase-1-mediated IkappaB kinase beta (IkkB) phosphorylation activates NF-kappaB signaling." Tanaka H., Fujita N., Tsuruo T. J. Biol. Chem. 280:40965-40973(2005) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT SER-181 BY PDPK1, INTERACTION WITH PDPK1. |
| [26] | "Site-specific monoubiquitination of IkappaB kinase IKKbeta regulates its phosphorylation and persistent activation." Carter R.S., Pennington K.N., Arrate P., Oltz E.M., Ballard D.W. J. Biol. Chem. 280:43272-43279(2005) [PubMed] [Europe PMC] [Abstract] Cited for: UBIQUITINATION AT LYS-163. |
| [27] | "Cardif is an adaptor protein in the RIG-I antiviral pathway and is targeted by hepatitis C virus." Meylan E., Curran J., Hofmann K., Moradpour D., Binder M., Bartenschlager R., Tschopp J. Nature 437:1167-1172(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH MAVS. |
| [28] | "Yersinia YopJ acetylates and inhibits kinase activation by blocking phosphorylation." Mukherjee S., Keitany G., Li Y., Wang Y., Ball H.L., Goldsmith E.J., Orth K. Science 312:1211-1214(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH YOPJ, ACETYLATION. |
| [29] | "Molecular linkage between the kinase ATM and NF-kappaB signaling in response to genotoxic stimuli." Wu Z.H., Shi Y., Tibbetts R.S., Miyamoto S. Science 311:1141-1146(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH ATM. |
| [30] | "Caveolin-1 triggers T-cell activation via CD26 in association with CARMA1." Ohnuma K., Uchiyama M., Yamochi T., Nishibashi K., Hosono O., Takahashi N., Kina S., Tanaka H., Lin X., Dang N.H., Morimoto C. J. Biol. Chem. 282:10117-10131(2007) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION IN A MEMBRANE RAFT COMPLEX, SUBCELLULAR LOCATION. |
| [31] | "FAF1 suppresses IkappaB kinase (IKK) activation by disrupting the IKK complex assembly." Park M.Y., Moon J.H., Lee K.S., Choi H.I., Chung J., Hong H.J., Kim E. J. Biol. Chem. 282:27572-27577(2007) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH FAF1. |
| [32] | "Negative feedback loop in T cell activation through IkappaB kinase-induced phosphorylation and degradation of Bcl10." Lobry C., Lopez T., Israel A., Weil R. Proc. Natl. Acad. Sci. U.S.A. 104:908-913(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN PHOSPHORYLATION OF BCL10. |
| [33] | "The I kappa B/NF-kappa B system: a key determinant of mucosal inflammation and protection." Jobin C., Sartor R.B. Am. J. Physiol. 278:C451-C462(2000) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW. |
| [34] | "The IkappaB kinase complex: master regulator of NF-kappaB signaling." Solt L.A., May M.J. Immunol. Res. 42:3-18(2008) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW, DOMAIN. |
| [35] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [36] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-672, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [37] | "Large-scale proteomics analysis of the human kinome." Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G., Mann M., Daub H. Mol. Cell. Proteomics 8:1751-1764(2009) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [38] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-672, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [39] | "NLRC5 negatively regulates the NF-kappaB and type I interferon signaling pathways." Cui J., Zhu L., Xia X., Wang H.Y., Legras X., Hong J., Ji J., Shen P., Zheng S., Chen Z.J., Wang R.F. Cell 141:483-496(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH NLRC5. |
| [40] | "Ro52-mediated monoubiquitination of IKK{beta} down-regulates NF-{kappa}B signalling." Wada K., Niida M., Tanaka M., Kamitani T. J. Biochem. 146:821-832(2009) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH TRIM21, MONOUBIQUITINATION, UBIQUITINATION INACTIVATION BY YERSINIA YOPJ, MUTAGENESIS OF LYS-163; SER-177 AND SER-181. |
| [41] | "Respiratory syncytial virus-mediated NF-kappa B p65 phosphorylation at serine 536 is dependent on RIG-I, TRAF6, and IKK beta." Yoboua F., Martel A., Duval A., Mukawera E., Grandvaux N. J. Virol. 84:7267-7277(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN PHOSPHORYLATION OF RELA. |
| [42] | "Nuclear IKKbeta is an adaptor protein for IkappaBalpha ubiquitination and degradation in UV-induced NF-kappaB activation." Tsuchiya Y., Asano T., Nakayama K., Kato T. Jr., Karin M., Kamata H. Mol. Cell 39:570-582(2010) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, FUNCTION. |
| [43] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [44] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [45] | "Novel cross-talk within the IKK family controls innate immunity." Clark K., Peggie M., Plater L., Sorcek R.J., Young E.R., Madwed J.B., Hough J., McIver E.G., Cohen P. Biochem. J. 434:93-104(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, PHOSPHORYLATION BY TBK1 AND IKBKE. |
| [46] | "Structure of a NEMO/IKK-associating domain reveals architecture of the interaction site." Rushe M., Silvian L., Bixler S., Chen L.L., Cheung A., Bowes S., Cuervo H., Berkowitz S., Zheng T., Guckian K., Pellegrini M., Lugovskoy A. Structure 16:798-808(2008) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.25 ANGSTROMS) OF 701-742. |
| [47] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] SER-360. |
| [48] | "Patterns of somatic mutation in human cancer genomes." Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. Stratton M.R.Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] SER-360; ARG-369; GLN-526; THR-710 AND LEU-734. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF029684 mRNA. Translation: AAC51860.1. AF080158 mRNA. Translation: AAD08997.1. AF031416 mRNA. Translation: AAC64675.1. AK302723 mRNA. Translation: BAG63942.1. AK303528 mRNA. Translation: BAG64556.1. AK316418 mRNA. Translation: BAH14789.1. AY663108 Genomic DNA. Translation: AAT65965.1. AC083973 Genomic DNA. No translation available. BC006231 mRNA. Translation: AAH06231.1. | ||||||||||||||||||
| IPI | IPI00024709. IPI00798101. IPI00982033. IPI01010552. | ||||||||||||||||||
| RefSeq | NP_001177649.1. NM_001190720.2. NP_001229707.1. NM_001242778.1. NP_001547.1. NM_001556.2. | ||||||||||||||||||
| UniGene | Hs.597664. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | O14920. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| DIP | DIP-27527N. | ||||||||||||||||||
| IntAct | O14920. 33 interactions. | ||||||||||||||||||
| MINT | MINT-107608. | ||||||||||||||||||
| STRING | 9606.ENSP00000339151. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | O14920. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PaxDb | O14920. | ||||||||||||||||||
| PRIDE | O14920. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| DNASU | 3551. | ||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000416505; ENSP00000404920; ENSG00000104365. ENST00000519735; ENSP00000430483; ENSG00000104365. ENST00000520810; ENSP00000430684; ENSG00000104365. ENST00000520835; ENSP00000430868; ENSG00000104365. | ||||||||||||||||||
| GeneID | 3551. | ||||||||||||||||||
| KEGG | hsa:3551. | ||||||||||||||||||
| UCSC | uc003xow.2. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 3551. | ||||||||||||||||||
| GeneCards | GC08P042146. | ||||||||||||||||||
| HGNC | HGNC:5960. IKBKB. | ||||||||||||||||||
| HPA | CAB004447. HPA001249. | ||||||||||||||||||
| MIM | 603258. gene. | ||||||||||||||||||
| neXtProt | NX_O14920. | ||||||||||||||||||
| PharmGKB | PA29776. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | COG0515. | ||||||||||||||||||
| HOGENOM | HOG000038048. | ||||||||||||||||||
| HOVERGEN | HBG018241. | ||||||||||||||||||
| InParanoid | O14920. | ||||||||||||||||||
| KO | K07209. | ||||||||||||||||||
| OMA | GILFYEL. | ||||||||||||||||||
| OrthoDB | EOG4PK276. | ||||||||||||||||||
| PhylomeDB | O14920. | ||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||
| BRENDA | 2.7.11.10. 2681. | ||||||||||||||||||
| Pathway_Interaction_DB | nfkappabatypicalpathway. Atypical NF-kappaB pathway. bcr_5pathway. BCR signaling pathway. nfkappabcanonicalpathway. Canonical NF-kappaB pathway. fcer1pathway. Fc-epsilon receptor I signaling in mast cells. foxopathway. FoxO family signaling. il1pathway. IL1-mediated signaling events. p75ntrpathway. p75(NTR)-mediated signaling. tcrpathway. TCR signaling in naive CD4+ T cells. cd8tcrpathway. TCR signaling in naive CD8+ T cells. tnfpathway. TNF receptor signaling pathway. trail_pathway. TRAIL signaling pathway. | ||||||||||||||||||
| Reactome | REACT_111102. Signal Transduction. REACT_6782. TRAF6 Mediated Induction of proinflammatory cytokines. REACT_6900. Immune System. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | O14920. | ||||||||||||||||||
| Bgee | O14920. | ||||||||||||||||||
| CleanEx | HS_IKBKB. | ||||||||||||||||||
| Genevestigator | O14920. | ||||||||||||||||||
| GermOnline | ENSG00000104365. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR022007. IKKbetaNEMObind. IPR011009. Kinase-like_dom. IPR000719. Prot_kinase_cat_dom. IPR008271. Ser/Thr_kinase_AS. IPR019955. Ubiquitin_supergroup. [Graphical view] | ||||||||||||||||||
| Pfam | PF12179. IKKbetaNEMObind. 1 hit. PF00069. Pkinase. 1 hit. [Graphical view] | ||||||||||||||||||
| SUPFAM | SSF56112. Kinase_like. 1 hit. | ||||||||||||||||||
| PROSITE | PS00107. PROTEIN_KINASE_ATP. False negative. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| BindingDB | O14920. | ||||||||||||||||||
| ChEMBL | CHEMBL1991. | ||||||||||||||||||
| DrugBank | DB01169. Arsenic trioxide. DB00995. Auranofin. | ||||||||||||||||||
| EvolutionaryTrace | O14920. | ||||||||||||||||||
| GenomeRNAi | 3551. | ||||||||||||||||||
| NextBio | 13864. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | IKKB_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O14920 Secondary accession number(s): B4DZ30, B4E0U4, O75327 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
