Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O14920

- IKKB_HUMAN

UniProt

O14920 - IKKB_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Inhibitor of nuclear factor kappa-B kinase subunit beta

Gene

IKBKB

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Serine kinase that plays an essential role in the NF-kappa-B signaling pathway which is activated by multiple stimuli such as inflammatory cytokines, bacterial or viral products, DNA damages or other cellular stresses. Acts as part of the canonical IKK complex in the conventional pathway of NF-kappa-B activation and phosphorylates inhibitors of NF-kappa-B on 2 critical serine residues. These modifications allow polyubiquitination of the inhibitors and subsequent degradation by the proteasome. In turn, free NF-kappa-B is translocated into the nucleus and activates the transcription of hundreds of genes involved in immune response, growth control, or protection against apoptosis. In addition to the NF-kappa-B inhibitors, phosphorylates several other components of the signaling pathway including NEMO/IKBKG, NF-kappa-B subunits RELA and NFKB1, as well as IKK-related kinases TBK1 and IKBKE. IKK-related kinase phosphorylations may prevent the overproduction of inflammatory mediators since they exert a negative regulation on canonical IKKs. Also phosphorylates other substrates including NCOA3, BCL10 and IRS1. Within the nucleus, acts as an adapter protein for NFKBIA degradation in UV-induced NF-kappa-B activation.7 Publications

Catalytic activityi

ATP + [I-kappa-B protein] = ADP + [I-kappa-B phosphoprotein].

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei44 – 441ATPPROSITE-ProRule annotation
Active sitei145 – 1451Proton acceptorPROSITE-ProRule annotation

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi21 – 299ATPPROSITE-ProRule annotation

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. IkappaB kinase activity Source: UniProtKB
  3. protein heterodimerization activity Source: UniProtKB
  4. protein homodimerization activity Source: UniProtKB
  5. protein kinase activity Source: UniProtKB
  6. protein kinase binding Source: UniProtKB
  7. protein serine/threonine kinase activity Source: Reactome
  8. scaffold protein binding Source: MGI

GO - Biological processi

  1. B cell homeostasis Source: Ensembl
  2. cellular response to tumor necrosis factor Source: UniProtKB
  3. Fc-epsilon receptor signaling pathway Source: Reactome
  4. I-kappaB kinase/NF-kappaB signaling Source: UniProtKB
  5. I-kappaB phosphorylation Source: GOC
  6. inflammatory response Source: UniProtKB
  7. innate immune response Source: UniProtKB
  8. MyD88-dependent toll-like receptor signaling pathway Source: Reactome
  9. MyD88-independent toll-like receptor signaling pathway Source: Reactome
  10. negative regulation of apoptotic process Source: Reactome
  11. neurotrophin TRK receptor signaling pathway Source: Reactome
  12. nucleotide-binding domain, leucine rich repeat containing receptor signaling pathway Source: Reactome
  13. nucleotide-binding oligomerization domain containing signaling pathway Source: Reactome
  14. positive regulation of cation channel activity Source: Ensembl
  15. positive regulation of I-kappaB kinase/NF-kappaB signaling Source: Reactome
  16. positive regulation of NF-kappaB transcription factor activity Source: UniProtKB
  17. positive regulation of sodium ion transport Source: Ensembl
  18. positive regulation of transcription, DNA-templated Source: UniProtKB
  19. positive regulation of transcription from RNA polymerase II promoter Source: UniProtKB
  20. positive regulation of type I interferon production Source: Reactome
  21. protein phosphorylation Source: UniProtKB
  22. response to virus Source: UniProtKB
  23. serine phosphorylation of STAT protein Source: UniProtKB
  24. T cell receptor signaling pathway Source: Reactome
  25. toll-like receptor 10 signaling pathway Source: Reactome
  26. toll-like receptor 2 signaling pathway Source: Reactome
  27. toll-like receptor 3 signaling pathway Source: Reactome
  28. toll-like receptor 4 signaling pathway Source: Reactome
  29. toll-like receptor 5 signaling pathway Source: Reactome
  30. toll-like receptor 9 signaling pathway Source: Reactome
  31. toll-like receptor signaling pathway Source: Reactome
  32. toll-like receptor TLR1:TLR2 signaling pathway Source: Reactome
  33. toll-like receptor TLR6:TLR2 signaling pathway Source: Reactome
  34. TRIF-dependent toll-like receptor signaling pathway Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Kinase, Serine/threonine-protein kinase, Transferase

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDAi2.7.11.10. 2681.
ReactomeiREACT_118563. RIP-mediated NFkB activation via ZBP1.
REACT_118656. Activation of NF-kappaB in B cells.
REACT_12555. Downstream TCR signaling.
REACT_13415. p75NTR recruits signalling complexes.
REACT_13696. NF-kB is activated and signals survival.
REACT_163994. FCERI mediated NF-kB activation.
REACT_21281. TAK1 activates NFkB by phosphorylation and activation of IKKs complex.
REACT_22442. Interleukin-1 signaling.
REACT_24918. IRAK1 recruits IKK complex.
REACT_24969. TRAF6 mediated NF-kB activation.
REACT_25039. NF-kB activation through FADD/RIP-1 pathway mediated by caspase-8 and -10.
REACT_25354. IRAK1 recruits IKK complex upon TLR7/8 or 9 stimulation.
REACT_25374. IKK complex recruitment mediated by RIP1.
REACT_75776. NOD1/2 Signaling Pathway.
SABIO-RKO14920.
SignaLinkiO14920.

Names & Taxonomyi

Protein namesi
Recommended name:
Inhibitor of nuclear factor kappa-B kinase subunit beta (EC:2.7.11.10)
Short name:
I-kappa-B-kinase beta
Short name:
IKK-B
Short name:
IKK-beta
Short name:
IkBKB
Alternative name(s):
I-kappa-B kinase 2
Short name:
IKK2
Nuclear factor NF-kappa-B inhibitor kinase beta
Short name:
NFKBIKB
Gene namesi
Name:IKBKB
Synonyms:IKKB
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 8

Organism-specific databases

HGNCiHGNC:5960. IKBKB.

Subcellular locationi

Cytoplasm. Nucleus. Membrane raft
Note: Colocalized with DPP4 in membrane rafts.

GO - Cellular componenti

  1. CD40 receptor complex Source: BHF-UCL
  2. cytoplasm Source: HPA
  3. cytoplasmic side of plasma membrane Source: BHF-UCL
  4. cytosol Source: Reactome
  5. IkappaB kinase complex Source: UniProtKB
  6. nucleus Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Membrane, Nucleus

Pathology & Biotechi

Involvement in diseasei

Immunodeficiency 15 (IMD15) [MIM:615592]: An autosomal recessive primary immunodeficiency disorder characterized by onset in infancy of life-threatening bacterial, fungal, and viral infections and failure to thrive. Laboratory studies show hypo- or agammaglobulinemia with relatively normal numbers of B and T-cells, and impaired differentiation and activation of immune cells.1 Publication
Note: The disease is caused by mutations affecting the gene represented in this entry.

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi44 – 441K → A: Loss of kinase activity and no effect on binding to NIK. 2 Publications
Mutagenesisi163 – 1631K → R: Monoubiquitinated; when associated with E-177 and E-181. 1 Publication
Mutagenesisi177 – 1815SLCTS → ALCTA: COmplete loss of TBK1-mediated phosphorylation. 1 Publication
Mutagenesisi177 – 1771S → A: Decrease of activity. 2 Publications
Mutagenesisi177 – 1771S → E: Full activation. Interaction with TRIM21 is enhanced; when associated with E-181. Monoubiquitinated; when associated with R-163 and E-181. Strongly promoted NF-kappa-B gene expression; when associated with E-181. 2 Publications
Mutagenesisi181 – 1811S → A: Decrease of activity. 2 Publications
Mutagenesisi181 – 1811S → E: Full activation. Interaction with TRIM21 is enhanced; when associated with E-177. Monoubiquitinated; when associated with R-163 and E-177. Strongly promoted NF-kappa-B gene expression; when associated with E-177. 2 Publications
Mutagenesisi191 – 1911P → A: Loss of hypoxic inducibility. 1 Publication

Keywords - Diseasei

SCID

Organism-specific databases

MIMi615592. phenotype.
Orphaneti397787. Severe combined immunodeficiency due to IKK2 deficiency.
PharmGKBiPA29776.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 756756Inhibitor of nuclear factor kappa-B kinase subunit betaPRO_0000086013Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Cross-linki163 – 163Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)1 Publication
Modified residuei177 – 1771Phosphoserine; by TBK1 and PKC/PRKCZ3 Publications
Modified residuei179 – 1791S-nitrosocysteine1 Publication
Modified residuei180 – 1801O-acetylthreonine; by Yersinia yopJ1 Publication
Modified residuei181 – 1811Phosphoserine; by TBK1, PKC/PRKCZ and PDPK14 Publications
Modified residuei191 – 1911Hydroxyproline1 Publication
Modified residuei670 – 6701Phosphoserine; by autocatalysis1 Publication
Modified residuei672 – 6721Phosphoserine3 Publications
Modified residuei675 – 6751Phosphoserine; by autocatalysis1 Publication
Modified residuei682 – 6821Phosphoserine; by autocatalysis1 Publication
Modified residuei689 – 6891Phosphoserine; by autocatalysis1 Publication
Modified residuei692 – 6921Phosphoserine; by autocatalysis1 Publication
Modified residuei695 – 6951Phosphoserine; by autocatalysis1 Publication
Modified residuei697 – 6971Phosphoserine; by autocatalysis1 Publication
Modified residuei705 – 7051Phosphoserine; by autocatalysis1 Publication
Modified residuei733 – 7331Phosphoserine; by autocatalysis1 Publication
Modified residuei740 – 7401Phosphoserine; by autocatalysis1 Publication
Modified residuei750 – 7501Phosphoserine; by autocatalysis1 Publication

Post-translational modificationi

Upon cytokine stimulation, phosphorylated on Ser-177 and Ser-181 by MEKK1 and/or MAP3K14/NIK as well as TBK1 and PRKCZ; which enhances activity. Once activated, autophosphorylates on the C-terminal serine cluster; which decreases activity and prevents prolonged activation of the inflammatory response. Phosphorylated by the IKK-related kinases TBK1 and IKBKE, which is associated with reduced CHUK/IKKA and IKBKB activity and NF-kappa-B-dependent gene transcription. Dephosphorylated at Ser-177 and Ser-181 by PPM1A and PPM1B.4 Publications
Acetylation of Thr-180 by Yersinia yopJ prevents phosphorylation and activation, thus blocking the I-kappa-B pathway.2 Publications
Ubiquitinated. Monoubiquitination involves TRIM21 that leads to inhibition of Tax-induced NF-kappa-B signaling. According to PubMed:19675099, 'Ser-163' does not serve as a monoubiquitination site. According to PubMed:16267042, ubiquitination on 'Ser-163' modulates phosphorylation on C-terminal serine residues. Monoubiquitination by TRIM21 is disrupted by Yersinia yopJ.2 Publications
Hydroxylated by PHD1/EGLN2, loss of hydroxylation under hypoxic conditions results in activation of NF-kappaB.1 Publication

Keywords - PTMi

Acetylation, Hydroxylation, Isopeptide bond, Phosphoprotein, S-nitrosylation, Ubl conjugation

Proteomic databases

MaxQBiO14920.
PaxDbiO14920.
PRIDEiO14920.

PTM databases

PhosphoSiteiO14920.

Expressioni

Tissue specificityi

Highly expressed in heart, placenta, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, testis and peripheral blood.

Gene expression databases

BgeeiO14920.
CleanExiHS_IKBKB.
ExpressionAtlasiO14920. baseline and differential.
GenevestigatoriO14920.

Organism-specific databases

HPAiCAB004447.
HPA001249.

Interactioni

Subunit structurei

Component of the I-kappa-B-kinase (IKK) core complex consisting of CHUK, IKBKB and IKBKG; probably four alpha/CHUK-beta/IKBKB dimers are associated with four gamma/IKBKG subunits. The IKK core complex seems to associate with regulatory or adapter proteins to form a IKK-signalosome holo-complex. The IKK complex associates with TERF2IP/RAP1, leading to promote IKK-mediated phosphorylation of RELA/p65. Part of a complex composed of NCOA2, NCOA3, CHUK/IKKA, IKBKB, IKBKG and CREBBP. Part of a 70-90 kDa complex at least consisting of CHUK/IKKA, IKBKB, NFKBIA, RELA, IKBKAP and MAP3K14. Found in a membrane raft complex, at least composed of BCL10, CARD11, DPP4 and IKBKB. Interacts with SQSTM1 through PRKCZ or PRKCI. Forms an NGF-induced complex with IKBKB, PRKCI and TRAF6. May interact with MAVS/IPS1. Interacts with NALP2. Interacts with TICAM1. Interacts with Yersinia yopJ. Interacts with FAF1; the interaction disrupts the IKK complex formation. Interacts with ATM. Part of a ternary complex consisting of TANK, IKBKB and IKBKG. Interacts with NIBP; the interaction is direct. Interacts with ARRB1 and ARRB2. Interacts with TRIM21. Interacts with NLRC5; prevents IKBKB phosphorylation and kinase activity. Interacts with PDPK1. Interacts with EIF2AK2/PKR. The phosphorylated form interacts with PPM1A and PPM1B. Interacts with ZNF268 isoform 2; the interaction is further increased in a TNF-alpha-dependent manner. Interacts with IKBKE. Interacts with NAA10, leading to NAA10 degradation (By similarity).By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
CDC37Q165433EBI-81266,EBI-295634
CHUKO1511113EBI-81266,EBI-81249
CREBBPQ927932EBI-81266,EBI-81215
HSP90AB1P082382EBI-81266,EBI-352572
IKBKGQ9Y6K925EBI-81266,EBI-81279
KEAP1Q141456EBI-81266,EBI-751001
MAP3K14Q995583EBI-81266,EBI-358011
NCOA3Q9Y6Q93EBI-81266,EBI-81196
NFKBIAP2596312EBI-81266,EBI-307386
PPP2CAP677753EBI-81266,EBI-712311
RPS3P233964EBI-81266,EBI-351193
STAP2Q9UGK37EBI-81266,EBI-1553984
taxP034093EBI-81266,EBI-5236464From a different organism.
TSC1Q925743EBI-81266,EBI-1047085
VACWR196P247723EBI-81266,EBI-4291651From a different organism.
Zc3h12aQ5D1E74EBI-81266,EBI-5326026From a different organism.

Protein-protein interaction databases

BioGridi109767. 116 interactions.
DIPiDIP-27527N.
IntActiO14920. 59 interactions.
MINTiMINT-107608.
STRINGi9606.ENSP00000339151.

Structurei

Secondary structure

1
756
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi15 – 228Combined sources
Beta strandi29 – 346Combined sources
Turni35 – 373Combined sources
Beta strandi40 – 445Combined sources
Helixi52 – 6716Combined sources
Turni81 – 833Combined sources
Helixi84 – 863Combined sources
Beta strandi87 – 915Combined sources
Beta strandi94 – 974Combined sources
Helixi104 – 1096Combined sources
Helixi111 – 1133Combined sources
Helixi119 – 13820Combined sources
Helixi148 – 1503Combined sources
Beta strandi151 – 1555Combined sources
Beta strandi157 – 1648Combined sources
Helixi182 – 1854Combined sources
Turni186 – 1883Combined sources
Helixi191 – 1955Combined sources
Helixi202 – 21716Combined sources
Helixi228 – 2358Combined sources
Beta strandi244 – 2474Combined sources
Beta strandi253 – 2586Combined sources
Helixi267 – 28014Combined sources
Turni285 – 2895Combined sources
Turni292 – 2943Combined sources
Turni296 – 2983Combined sources
Helixi299 – 3079Combined sources
Beta strandi310 – 3167Combined sources
Turni317 – 3204Combined sources
Beta strandi321 – 3277Combined sources
Helixi333 – 34412Combined sources
Helixi348 – 3503Combined sources
Beta strandi353 – 3553Combined sources
Helixi367 – 3704Combined sources
Turni382 – 3854Combined sources
Beta strandi386 – 3894Combined sources
Helixi408 – 4158Combined sources
Helixi423 – 49977Combined sources
Turni500 – 5045Combined sources
Helixi509 – 52012Combined sources
Helixi527 – 54822Combined sources
Helixi559 – 57517Combined sources
Helixi579 – 5813Combined sources
Helixi588 – 66174Combined sources
Helixi706 – 72924Combined sources
Helixi734 – 7363Combined sources
Helixi740 – 7423Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3BRTX-ray2.25A/C701-730[»]
3BRVX-ray2.20A/C701-745[»]
4E3CX-ray3.98A/B/C/D/E/F11-669[»]
4KIKX-ray2.83A/B2-664[»]
ProteinModelPortaliO14920.
SMRiO14920. Positions 2-663, 702-743.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO14920.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini15 – 300286Protein kinasePROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni458 – 47922Leucine-zipperAdd
BLAST
Regioni737 – 7426NEMO-binding

Domaini

The kinase domain is located in the N-terminal region. The leucine zipper is important to allow homo- and hetero-dimerization. At the C-terminal region is located the region responsible for the interaction with NEMO/IKBKG.1 Publication

Sequence similaritiesi

Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. I-kappa-B kinase subfamily.PROSITE-ProRule annotation
Contains 1 protein kinase domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiCOG0515.
GeneTreeiENSGT00770000120525.
HOGENOMiHOG000038048.
HOVERGENiHBG018241.
InParanoidiO14920.
KOiK07209.
OMAiWEAFEKV.
OrthoDBiEOG7FBRH3.
PhylomeDBiO14920.
TreeFamiTF324269.

Family and domain databases

InterProiIPR022007. IKKbetaNEMObind.
IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR008271. Ser/Thr_kinase_AS.
IPR000626. Ubiquitin-like.
IPR029071. Ubiquitin-rel_dom.
[Graphical view]
PfamiPF12179. IKKbetaNEMObind. 1 hit.
PF00069. Pkinase. 1 hit.
[Graphical view]
SUPFAMiSSF54236. SSF54236. 1 hit.
SSF56112. SSF56112. 1 hit.
PROSITEiPS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O14920-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSWSPSLTTQ TCGAWEMKER LGTGGFGNVI RWHNQETGEQ IAIKQCRQEL
60 70 80 90 100
SPRNRERWCL EIQIMRRLTH PNVVAARDVP EGMQNLAPND LPLLAMEYCQ
110 120 130 140 150
GGDLRKYLNQ FENCCGLREG AILTLLSDIA SALRYLHENR IIHRDLKPEN
160 170 180 190 200
IVLQQGEQRL IHKIIDLGYA KELDQGSLCT SFVGTLQYLA PELLEQQKYT
210 220 230 240 250
VTVDYWSFGT LAFECITGFR PFLPNWQPVQ WHSKVRQKSE VDIVVSEDLN
260 270 280 290 300
GTVKFSSSLP YPNNLNSVLA ERLEKWLQLM LMWHPRQRGT DPTYGPNGCF
310 320 330 340 350
KALDDILNLK LVHILNMVTG TIHTYPVTED ESLQSLKARI QQDTGIPEED
360 370 380 390 400
QELLQEAGLA LIPDKPATQC ISDGKLNEGH TLDMDLVFLF DNSKITYETQ
410 420 430 440 450
ISPRPQPESV SCILQEPKRN LAFFQLRKVW GQVWHSIQTL KEDCNRLQQG
460 470 480 490 500
QRAAMMNLLR NNSCLSKMKN SMASMSQQLK AKLDFFKTSI QIDLEKYSEQ
510 520 530 540 550
TEFGITSDKL LLAWREMEQA VELCGRENEV KLLVERMMAL QTDIVDLQRS
560 570 580 590 600
PMGRKQGGTL DDLEEQAREL YRRLREKPRD QRTEGDSQEM VRLLLQAIQS
610 620 630 640 650
FEKKVRVIYT QLSKTVVCKQ KALELLPKVE EVVSLMNEDE KTVVRLQEKR
660 670 680 690 700
QKELWNLLKI ACSKVRGPVS GSPDSMNASR LSQPGQLMSQ PSTASNSLPE
710 720 730 740 750
PAKKSEELVA EAHNLCTLLE NAIQDTVREQ DQSFTALDWS WLQTEEEEHS

CLEQAS
Length:756
Mass (Da):86,564
Last modified:January 1, 1998 - v1
Checksum:iF9CADF671AE9E14E
GO
Isoform 2 (identifier: O14920-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHN → MFSGGCHSPGFGRPSPAFPAPGSPPPAPRPCR

Show »
Length:754
Mass (Da):85,945
Checksum:i9C31F5C1DC92661E
GO
Isoform 3 (identifier: O14920-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     231-256: WHSKVRQKSEVDIVVSEDLNGTVKFS → CVRMWPGTVAHSCNPSTLGGRGRWIS
     257-756: Missing.

Show »
Length:256
Mass (Da):29,236
Checksum:i8B4762DD49F4065A
GO
Isoform 4 (identifier: O14920-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-66: MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCLEIQIMR → MSSDGTI

Note: No experimental confirmation available.

Show »
Length:697
Mass (Da):79,509
Checksum:i21B61110941FE1D9
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti259 – 2591L → S in BAG63942. (PubMed:14702039)Curated
Sequence conflicti259 – 2591L → S in BAH14789. (PubMed:14702039)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti360 – 3601A → S in breast cancer samples; infiltrating ductal carcinoma; somatic mutation. 2 Publications
VAR_035626
Natural varianti369 – 3691Q → R.1 Publication
Corresponds to variant rs56411242 [ dbSNP | Ensembl ].
VAR_040567
Natural varianti526 – 5261R → Q.1 Publication
Corresponds to variant rs2272736 [ dbSNP | Ensembl ].
VAR_040568
Natural varianti554 – 5541R → W.1 Publication
Corresponds to variant rs17875749 [ dbSNP | Ensembl ].
VAR_021124
Natural varianti710 – 7101A → T.1 Publication
Corresponds to variant rs34309584 [ dbSNP | Ensembl ].
VAR_040569
Natural varianti734 – 7341F → L.1 Publication
Corresponds to variant rs56301637 [ dbSNP | Ensembl ].
VAR_040570
Natural varianti736 – 7361A → T.
Corresponds to variant rs17611716 [ dbSNP | Ensembl ].
VAR_051628

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 6666MSWSP…IQIMR → MSSDGTI in isoform 4. 1 PublicationVSP_043408Add
BLAST
Alternative sequencei1 – 3434MSWSP…IRWHN → MFSGGCHSPGFGRPSPAFPA PGSPPPAPRPCR in isoform 2. 1 PublicationVSP_041825Add
BLAST
Alternative sequencei231 – 25626WHSKV…TVKFS → CVRMWPGTVAHSCNPSTLGG RGRWIS in isoform 3. 1 PublicationVSP_041826Add
BLAST
Alternative sequencei257 – 756500Missing in isoform 3. 1 PublicationVSP_041827Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF029684 mRNA. Translation: AAC51860.1.
AF080158 mRNA. Translation: AAD08997.1.
AF031416 mRNA. Translation: AAC64675.1.
AK302723 mRNA. Translation: BAG63942.1.
AK303528 mRNA. Translation: BAG64556.1.
AK316418 mRNA. Translation: BAH14789.1.
AY663108 Genomic DNA. Translation: AAT65965.1.
AC083973 Genomic DNA. No translation available.
BC006231 mRNA. Translation: AAH06231.1.
CCDSiCCDS55228.1. [O14920-2]
CCDS56535.1. [O14920-4]
CCDS6128.1. [O14920-1]
RefSeqiNP_001177649.1. NM_001190720.2. [O14920-2]
NP_001229707.1. NM_001242778.1. [O14920-4]
NP_001547.1. NM_001556.2. [O14920-1]
UniGeneiHs.597664.

Genome annotation databases

EnsembliENST00000416505; ENSP00000404920; ENSG00000104365. [O14920-4]
ENST00000519735; ENSP00000430483; ENSG00000104365. [O14920-3]
ENST00000520810; ENSP00000430684; ENSG00000104365. [O14920-1]
ENST00000520835; ENSP00000430868; ENSG00000104365. [O14920-2]
GeneIDi3551.
KEGGihsa:3551.
UCSCiuc003xow.2. human. [O14920-1]
uc011lcq.2. human. [O14920-2]
uc011lcr.2. human. [O14920-4]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

SeattleSNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF029684 mRNA. Translation: AAC51860.1 .
AF080158 mRNA. Translation: AAD08997.1 .
AF031416 mRNA. Translation: AAC64675.1 .
AK302723 mRNA. Translation: BAG63942.1 .
AK303528 mRNA. Translation: BAG64556.1 .
AK316418 mRNA. Translation: BAH14789.1 .
AY663108 Genomic DNA. Translation: AAT65965.1 .
AC083973 Genomic DNA. No translation available.
BC006231 mRNA. Translation: AAH06231.1 .
CCDSi CCDS55228.1. [O14920-2 ]
CCDS56535.1. [O14920-4 ]
CCDS6128.1. [O14920-1 ]
RefSeqi NP_001177649.1. NM_001190720.2. [O14920-2 ]
NP_001229707.1. NM_001242778.1. [O14920-4 ]
NP_001547.1. NM_001556.2. [O14920-1 ]
UniGenei Hs.597664.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
3BRT X-ray 2.25 A/C 701-730 [» ]
3BRV X-ray 2.20 A/C 701-745 [» ]
4E3C X-ray 3.98 A/B/C/D/E/F 11-669 [» ]
4KIK X-ray 2.83 A/B 2-664 [» ]
ProteinModelPortali O14920.
SMRi O14920. Positions 2-663, 702-743.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 109767. 116 interactions.
DIPi DIP-27527N.
IntActi O14920. 59 interactions.
MINTi MINT-107608.
STRINGi 9606.ENSP00000339151.

Chemistry

BindingDBi O14920.
ChEMBLi CHEMBL1991.
DrugBanki DB06151. Acetylcysteine.
DB00945. Acetylsalicylic acid.
DB01169. Arsenic trioxide.
DB00995. Auranofin.
DB00244. Mesalazine.
DB00795. Sulfasalazine.
GuidetoPHARMACOLOGYi 2039.

PTM databases

PhosphoSitei O14920.

Proteomic databases

MaxQBi O14920.
PaxDbi O14920.
PRIDEi O14920.

Protocols and materials databases

DNASUi 3551.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000416505 ; ENSP00000404920 ; ENSG00000104365 . [O14920-4 ]
ENST00000519735 ; ENSP00000430483 ; ENSG00000104365 . [O14920-3 ]
ENST00000520810 ; ENSP00000430684 ; ENSG00000104365 . [O14920-1 ]
ENST00000520835 ; ENSP00000430868 ; ENSG00000104365 . [O14920-2 ]
GeneIDi 3551.
KEGGi hsa:3551.
UCSCi uc003xow.2. human. [O14920-1 ]
uc011lcq.2. human. [O14920-2 ]
uc011lcr.2. human. [O14920-4 ]

Organism-specific databases

CTDi 3551.
GeneCardsi GC08P042146.
HGNCi HGNC:5960. IKBKB.
HPAi CAB004447.
HPA001249.
MIMi 603258. gene.
615592. phenotype.
neXtProti NX_O14920.
Orphaneti 397787. Severe combined immunodeficiency due to IKK2 deficiency.
PharmGKBi PA29776.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0515.
GeneTreei ENSGT00770000120525.
HOGENOMi HOG000038048.
HOVERGENi HBG018241.
InParanoidi O14920.
KOi K07209.
OMAi WEAFEKV.
OrthoDBi EOG7FBRH3.
PhylomeDBi O14920.
TreeFami TF324269.

Enzyme and pathway databases

BRENDAi 2.7.11.10. 2681.
Reactomei REACT_118563. RIP-mediated NFkB activation via ZBP1.
REACT_118656. Activation of NF-kappaB in B cells.
REACT_12555. Downstream TCR signaling.
REACT_13415. p75NTR recruits signalling complexes.
REACT_13696. NF-kB is activated and signals survival.
REACT_163994. FCERI mediated NF-kB activation.
REACT_21281. TAK1 activates NFkB by phosphorylation and activation of IKKs complex.
REACT_22442. Interleukin-1 signaling.
REACT_24918. IRAK1 recruits IKK complex.
REACT_24969. TRAF6 mediated NF-kB activation.
REACT_25039. NF-kB activation through FADD/RIP-1 pathway mediated by caspase-8 and -10.
REACT_25354. IRAK1 recruits IKK complex upon TLR7/8 or 9 stimulation.
REACT_25374. IKK complex recruitment mediated by RIP1.
REACT_75776. NOD1/2 Signaling Pathway.
SABIO-RK O14920.
SignaLinki O14920.

Miscellaneous databases

ChiTaRSi IKBKB. human.
EvolutionaryTracei O14920.
GeneWikii IKK2.
GenomeRNAii 3551.
NextBioi 13864.
PROi O14920.
SOURCEi Search...

Gene expression databases

Bgeei O14920.
CleanExi HS_IKBKB.
ExpressionAtlasi O14920. baseline and differential.
Genevestigatori O14920.

Family and domain databases

InterProi IPR022007. IKKbetaNEMObind.
IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR008271. Ser/Thr_kinase_AS.
IPR000626. Ubiquitin-like.
IPR029071. Ubiquitin-rel_dom.
[Graphical view ]
Pfami PF12179. IKKbetaNEMObind. 1 hit.
PF00069. Pkinase. 1 hit.
[Graphical view ]
SUPFAMi SSF54236. SSF54236. 1 hit.
SSF56112. SSF56112. 1 hit.
PROSITEi PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "IKK-1 and IKK-2: cytokine-activated IkappaB kinases essential for NF-kappaB activation."
    Mercurio F., Zhu H., Murray B.W., Shevchenko A., Bennett B.L., Li J.W., Young D.B., Barbosa M., Mann M., Manning A., Rao A.
    Science 278:860-866(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), MUTAGENESIS OF LYS-44; SER-177 AND SER-181.
    Tissue: Cervix carcinoma.
  2. "IkappaB kinase-beta: NF-kappaB activation and complex formation with IkappaB kinase-alpha and NIK."
    Woronicz J.D., Gao X., Cao Z., Rothe M., Goeddel D.V.
    Science 278:866-869(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), MUTAGENESIS OF LYS-44.
  3. "IkappaB kinase-alpha and -beta genes are coexpressed in adult and embryonic tissues but localized to different human chromosomes."
    Hu M.C.-T., Wang Y.-P.
    Gene 222:31-40(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Heart.
  4. "Assignment of IkappaB kinase beta (IKBKB) to human chromosome band 8p12-->p11 by in situ hybridization."
    Shindo M., Nakano H., Sakon S., Yagita H., Mihara M., Okumura K.
    Cytogenet. Cell Genet. 82:32-33(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), GENE MAPPING.
  5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4).
    Tissue: Testis and Thymus.
  6. SeattleSNPs variation discovery resource
    Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT TRP-554.
  7. "DNA sequence and analysis of human chromosome 8."
    Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T.
    , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.
    Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Lung.
  9. "Acetylation of MEK2 and I kappa B kinase (IKK) activation loop residues by YopJ inhibits signaling."
    Mittal R., Peak-Chew S.Y., McMahon H.T.
    Proc. Natl. Acad. Sci. U.S.A. 103:18574-18579(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 170-182 (ISOFORM 1), INACTIVATION BY YERSINIA YOPJ, ACETYLATION AT THR-180, IDENTIFICATION BY MASS SPECTROMETRY.
  10. "Coordinate regulation of IkappaB kinases by mitogen-activated protein kinase kinase kinase 1 and NF-kappaB-inducing kinase."
    Nemoto S., DiDonato J.A., Lin A.
    Mol. Cell. Biol. 18:7336-7343(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: IKK PHOSPHORYLATION.
  11. "IKAP is a scaffold protein of the IkappaB kinase complex."
    Cohen L., Henzel W.J., Baeuerle P.A.
    Nature 395:292-296(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION IN A COMPLEX WITH CHUK; NFKBIA; RELA; IKBKAP AND MAP3K14.
  12. "The interaction of p62 with RIP links the atypical PKCs to NF-kappaB activation."
    Sanz L., Sanchez P., Lallena M.-J., Diaz-Meco M.T., Moscat J.
    EMBO J. 18:3044-3053(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH SQSTM1; PRKCZ AND PRKCI.
  13. "Activation of IkappaB kinase beta by protein kinase C isoforms."
    Lallena M.J., Diaz-Meco M.T., Bren G., Paya C.V., Moscat J.
    Mol. Cell. Biol. 19:2180-2188(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION AT SER-177 AND SER-181.
  14. "Positive and negative regulation of IkappaB kinase activity through IKKbeta subunit phosphorylation."
    Delhase M., Hayakawa M., Chen Y., Karin M.
    Science 284:309-313(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION AT SER-177; SER-181; SER-670; SER-672; SER-675; SER-682; SER-689; SER-692; SER-695; SER-697; SER-705; SER-733; SER-740 AND SER-750.
  15. "PKR stimulates NF-kappaB irrespective of its kinase function by interacting with the IkappaB kinase complex."
    Bonnet M.C., Weil R., Dam E., Hovanessian A.G., Meurs E.F.
    Mol. Cell. Biol. 20:4532-4542(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH EIF2AK2.
  16. Cited for: PHOSPHORYLATION AT SER-177 AND SER-181 BY TBK1, MUTAGENESIS OF 177-SER--SER-181.
  17. "Direct phosphorylation of NF-kappa B1 p105 by the Ikappa B kinase complex on serine 927 is essential for signal-induced p105 proteolysis."
    Salmeron A., Janzen J., Soneji Y., Bump N., Kamens J., Allen H., Ley S.C.
    J. Biol. Chem. 276:22215-22222(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN PHOSPHORYLATION OF NFKB1.
  18. "Association of the adaptor TANK with the I kappa B kinase (IKK) regulator NEMO connects IKK complexes with IKK epsilon and TBK1 kinases."
    Chariot A., Leonardi A., Muller J., Bonif M., Brown K., Siebenlist U.
    J. Biol. Chem. 277:37029-37036(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH IKBKG AND TANK.
  19. "Regulation of SRC-3 (pCIP/ACTR/AIB-1/RAC-3/TRAM-1) coactivator activity by I kappa B kinase."
    Wu R.-C., Qin J., Hashimoto Y., Wong J., Xu J., Tsai S.Y., Tsai M.-J., O'Malley B.W.
    Mol. Cell. Biol. 22:3549-3561(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION IN A COMPLEX WITH CREBBP; NCOA2; NCOA3; IKKA AND IKBKG.
  20. "Tetrameric oligomerization of IkappaB kinase gamma (IKKgamma) is obligatory for IKK complex activity and NF-kappaB activation."
    Tegethoff S., Behlke J., Scheidereit C.
    Mol. Cell. Biol. 23:2029-2041(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: COMPOSITION OF THE IKK COMPLEX.
  21. "Mechanisms of the TRIF-induced interferon-stimulated response element and NF-kappaB activation and apoptosis pathways."
    Han K.J., Su X., Xu L.-G., Bin L.H., Zhang J., Shu H.-B.
    J. Biol. Chem. 279:15652-15661(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH TICAM1.
  22. "PAN1/NALP2/PYPAF2, an inducible inflammatory mediator that regulates NF-kappaB and caspase-1 activation in macrophages."
    Bruey J.-M., Bruey-Sedano N., Newman R., Chandler S., Stehlik C., Reed J.C.
    J. Biol. Chem. 279:51897-51907(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH NALP2.
  23. "beta-Arrestin inhibits NF-kappaB activity by means of its interaction with the NF-kappaB inhibitor IkappaBalpha."
    Witherow D.S., Garrison T.R., Miller W.E., Lefkowitz R.J.
    Proc. Natl. Acad. Sci. U.S.A. 101:8603-8607(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH ARRB1 AND ARRB2.
  24. Cited for: S-NITROSYLATION AT CYS-179.
  25. "NIBP, a novel NIK and IKK(beta)-binding protein that enhances NF-(kappa)B activation."
    Hu W.-H., Pendergast J.S., Mo X.-M., Brambilla R., Bracchi-Ricard V., Li F., Walters W.M., Blits B., He L., Schaal S.M., Bethea J.R.
    J. Biol. Chem. 280:29233-29241(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH NIBP.
  26. "3-Phosphoinositide-dependent protein kinase-1-mediated IkappaB kinase beta (IkkB) phosphorylation activates NF-kappaB signaling."
    Tanaka H., Fujita N., Tsuruo T.
    J. Biol. Chem. 280:40965-40973(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION AT SER-181 BY PDPK1, INTERACTION WITH PDPK1.
  27. "Site-specific monoubiquitination of IkappaB kinase IKKbeta regulates its phosphorylation and persistent activation."
    Carter R.S., Pennington K.N., Arrate P., Oltz E.M., Ballard D.W.
    J. Biol. Chem. 280:43272-43279(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: UBIQUITINATION AT LYS-163.
  28. "Cardif is an adaptor protein in the RIG-I antiviral pathway and is targeted by hepatitis C virus."
    Meylan E., Curran J., Hofmann K., Moradpour D., Binder M., Bartenschlager R., Tschopp J.
    Nature 437:1167-1172(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH MAVS.
  29. "Prolyl hydroxylase-1 negatively regulates IkappaB kinase-beta, giving insight into hypoxia-induced NFkappaB activity."
    Cummins E.P., Berra E., Comerford K.M., Ginouves A., Fitzgerald K.T., Seeballuck F., Godson C., Nielsen J.E., Moynagh P., Pouyssegur J., Taylor C.T.
    Proc. Natl. Acad. Sci. U.S.A. 103:18154-18159(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: HYDROXYLATION AT PRO-191, MUTAGENESIS OF PRO-191.
  30. "Yersinia YopJ acetylates and inhibits kinase activation by blocking phosphorylation."
    Mukherjee S., Keitany G., Li Y., Wang Y., Ball H.L., Goldsmith E.J., Orth K.
    Science 312:1211-1214(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH YOPJ, ACETYLATION.
  31. "Molecular linkage between the kinase ATM and NF-kappaB signaling in response to genotoxic stimuli."
    Wu Z.H., Shi Y., Tibbetts R.S., Miyamoto S.
    Science 311:1141-1146(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH ATM.
  32. Cited for: IDENTIFICATION IN A MEMBRANE RAFT COMPLEX, SUBCELLULAR LOCATION.
  33. "FAF1 suppresses IkappaB kinase (IKK) activation by disrupting the IKK complex assembly."
    Park M.Y., Moon J.H., Lee K.S., Choi H.I., Chung J., Hong H.J., Kim E.
    J. Biol. Chem. 282:27572-27577(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH FAF1.
  34. "Negative feedback loop in T cell activation through IkappaB kinase-induced phosphorylation and degradation of Bcl10."
    Lobry C., Lopez T., Israel A., Weil R.
    Proc. Natl. Acad. Sci. U.S.A. 104:908-913(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN PHOSPHORYLATION OF BCL10.
  35. "The I kappa B/NF-kappa B system: a key determinant of mucosal inflammation and protection."
    Jobin C., Sartor R.B.
    Am. J. Physiol. 278:C451-C462(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: REVIEW.
  36. "The IkappaB kinase complex: master regulator of NF-kappaB signaling."
    Solt L.A., May M.J.
    Immunol. Res. 42:3-18(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: REVIEW, DOMAIN.
  37. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
    Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
    Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  38. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-672, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  39. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  40. "Phosphorylation of ARD1 by IKKbeta contributes to its destabilization and degradation."
    Kuo H.P., Lee D.F., Xia W., Lai C.C., Li L.Y., Hung M.C.
    Biochem. Biophys. Res. Commun. 389:156-161(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH NAA10, FUNCTION IN PHOSPHORYLATION OF NAA10.
  41. "PPM1A and PPM1B act as IKKbeta phosphatases to terminate TNFalpha-induced IKKbeta-NF-kappaB activation."
    Sun W., Yu Y., Dotti G., Shen T., Tan X., Savoldo B., Pass A.K., Chu M., Zhang D., Lu X., Fu S., Lin X., Yang J.
    Cell. Signal. 21:95-102(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: DEPHOSPHORYLATION AT SER-177 AND SER-181, INTERACTION WITH PPM1A AND PPM1B.
  42. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  43. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-672, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  44. "NLRC5 negatively regulates the NF-kappaB and type I interferon signaling pathways."
    Cui J., Zhu L., Xia X., Wang H.Y., Legras X., Hong J., Ji J., Shen P., Zheng S., Chen Z.J., Wang R.F.
    Cell 141:483-496(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH NLRC5.
  45. "Ro52-mediated monoubiquitination of IKK{beta} down-regulates NF-{kappa}B signalling."
    Wada K., Niida M., Tanaka M., Kamitani T.
    J. Biochem. 146:821-832(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH TRIM21, MONOUBIQUITINATION, UBIQUITINATION INACTIVATION BY YERSINIA YOPJ, MUTAGENESIS OF LYS-163; SER-177 AND SER-181.
  46. "Respiratory syncytial virus-mediated NF-kappa B p65 phosphorylation at serine 536 is dependent on RIG-I, TRAF6, and IKK beta."
    Yoboua F., Martel A., Duval A., Mukawera E., Grandvaux N.
    J. Virol. 84:7267-7277(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN PHOSPHORYLATION OF RELA.
  47. "Nuclear IKKbeta is an adaptor protein for IkappaBalpha ubiquitination and degradation in UV-induced NF-kappaB activation."
    Tsuchiya Y., Asano T., Nakayama K., Kato T. Jr., Karin M., Kamata H.
    Mol. Cell 39:570-582(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION, FUNCTION.
  48. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  49. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  50. Cited for: FUNCTION, PHOSPHORYLATION BY TBK1 AND IKBKE.
  51. "The zinc finger protein ZNF268 is overexpressed in human cervical cancer and contributes to tumorigenesis via enhancing NF-kappaB signaling."
    Wang W., Guo M., Hu L., Cai J., Zeng Y., Luo J., Shu Z., Li W., Huang Z.
    J. Biol. Chem. 287:42856-42866(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH ZNF268, SUBUNIT.
  52. "IKKepsilon-mediated tumorigenesis requires K63-linked polyubiquitination by a cIAP1/cIAP2/TRAF2 E3 ubiquitin ligase complex."
    Zhou A.Y., Shen R.R., Kim E., Lock Y.J., Xu M., Chen Z.J., Hahn W.C.
    Cell Rep. 3:724-733(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH IKBKE.
  53. Cited for: INVOLVEMENT IN IMD15.
  54. "Structure of a NEMO/IKK-associating domain reveals architecture of the interaction site."
    Rushe M., Silvian L., Bixler S., Chen L.L., Cheung A., Bowes S., Cuervo H., Berkowitz S., Zheng T., Guckian K., Pellegrini M., Lugovskoy A.
    Structure 16:798-808(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.25 ANGSTROMS) OF 701-742.
  55. Cited for: VARIANT [LARGE SCALE ANALYSIS] SER-360.
  56. "Patterns of somatic mutation in human cancer genomes."
    Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G.
    , Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.
    Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS [LARGE SCALE ANALYSIS] SER-360; ARG-369; GLN-526; THR-710 AND LEU-734.

Entry informationi

Entry nameiIKKB_HUMAN
AccessioniPrimary (citable) accession number: O14920
Secondary accession number(s): B4DZ30, B4E0U4, O75327
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 1, 2001
Last sequence update: January 1, 1998
Last modified: November 26, 2014
This is version 168 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  7. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3