Reviewed,
UniProtKB/Swiss-Prot O14836 (TR13B_HUMAN)
Last modified
January 19, 2010.
Version 87.
History...
Clusters with 100%,
90%,
50% identity |
Documents (7) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Tumor necrosis factor receptor superfamily member 13B Alternative name(s): Transmembrane activator and CAML interactor CD_antigen=CD267 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 293 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Receptor for TNFSF13/APRIL and TNFSF13B/TALL1/BAFF/BLYS that binds both ligands with similar high affinity. Mediates calcineurin-dependent activation of NF-AT, as well as activation of NF-kappa-B and AP-1. Involved in the stimulation of B- and T-cell function and the regulation of humoral immunity. Ref.6 Ref.7 |
| Subunit structure | Binds TRAF2, TRAF5 and TRAF6. Binds the NH2-terminal domain of CAMLG with its C-terminus. |
| Subcellular location | |
| Tissue specificity | Highly expressed in spleen, thymus, small intestine and peripheral blood leukocytes. Expressed in resting B-cells and activated T-cells, but not in resting T-cells. |
| Involvement in disease | Defects in TNFRSF13B are a cause of common variable immunodeficiency (CVID) [MIM:240500]. CVID is characterized by a deficiency in all immunoglobulin (Ig) isotypes. Individuals with CVID suffer from recurrent sinopulmonary and gastrointestinal infections and have an increased incidence of autoimmune disorders and of lymphoid and non-lymphoid malignancies. There is evidence for a global isotype switching defect in some individuals with CVID. But CVID is a complex and heterogeneous disease in which defects in B-cell survival, number of circulating CD27+ memory B-cells (including IgM+CD27+ B-cells), B-cell activation after antigen receptor cross-linking, T-cell signaling and cytokine expression have been observed. Ref.10 Defects in TNFRSF13B are a cause of immunoglobulin A deficiency 2 (IGAD2) [MIM:609529]. Selective deficiency of immunoglobulin A (IGAD) is the most common form of primary immunodeficiency, with an incidence of approximately 1 in 600 individuals in the western world. Individuals with symptomatic IGAD often have deficiency of IgG subclasses or decreased antibody response to carbohydrate antigens such as pneumococcal polysaccharide vaccine. Individuals with IGAD also suffer from recurrent sinopulmonary and gastrointestinal infections and have an increased incidence of autoimmune disorders and of lymphoid and non-lymphoid malignancies. In vitro studies have suggested that some individuals with IGAD have impaired isotype class switching to IgA and others may have a post-switch defect. IGAD and CVID have been known to coexist in families. Some individuals initially present with IGAD1 and then develop CVID. These observations suggest that some cases of IGAD and CVID may have a common etiology. |
| Sequence similarities | Contains 2 TNFR-Cys repeats. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Immune response |
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Disease | Disease mutation |
| Domain | Repeat Signal-anchor Transmembrane |
| Molecular function | Receptor |
| PTM | Disulfide bond Glycoprotein |
| Technical term | 3D-structure Complete proteome |
| Gene Ontology (GO) | |
| Biological process | cell surface receptor linked signal transduction Ref.1 Traceable author statement. Source: ProtInc immune responseInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | integral to plasma membrane Ref.1 Traceable author statement. Source: ProtInc |
| Molecular function | protein binding Ref.6 Inferred from physical interaction. Source: IntAct receptor activity Ref.1Traceable author statement. Source: ProtInc |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| TNFSF13 | O75888 | 1 | EBI-519160,EBI-519208 | |
| TNFSF13B | Q9Y275 | 4 | EBI-519160,EBI-519169 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O14836-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O14836-2) The sequence of this isoform differs from the canonical sequence as follows: 21-67: FPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCR → W |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||
Molecule processing | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 293 | 293 | Tumor necrosis factor receptor superfamily member 13B | PRO_0000058931 | |||||||||||||||
Regions | |||||||||||||||||||
| Topological domain | 1 – 165 | 165 | Extracellular Potential | ||||||||||||||||
| Transmembrane | 166 – 186 | 21 | Signal-anchor for type III membrane protein Potential | ||||||||||||||||
| Topological domain | 187 – 293 | 107 | Cytoplasmic Potential | ||||||||||||||||
| Repeat | 33 – 67 | 35 | TNFR-Cys 1 | ||||||||||||||||
| Repeat | 70 – 104 | 35 | TNFR-Cys 2 | ||||||||||||||||
Amino acid modifications | |||||||||||||||||||
| Glycosylation | 128 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||
| Disulfide bond | 34 ↔ 47 | By similarity | |||||||||||||||||
| Disulfide bond | 50 ↔ 62 | By similarity | |||||||||||||||||
| Disulfide bond | 54 ↔ 66 | By similarity | |||||||||||||||||
| Disulfide bond | 71 ↔ 86 | ||||||||||||||||||
| Disulfide bond | 89 ↔ 100 | ||||||||||||||||||
| Disulfide bond | 93 ↔ 104 | ||||||||||||||||||
Natural variations | |||||||||||||||||||
| Alternative sequence | 21 – 67 | 47 | FPQGL…AAFCR → W in isoform 2. | VSP_013798 | |||||||||||||||
| Natural variant | 104 | 1 | C → R in CVID and IGAD2. dbSNP rs34557412. Ref.10 | VAR_024027 | |||||||||||||||
| Natural variant | 181 | 1 | A → G in CVID. Ref.10 | VAR_024028 | |||||||||||||||
| Natural variant | 202 | 1 | R → H in CVID. Ref.10 | VAR_024029 | |||||||||||||||
| Natural variant | 251 | 1 | P → L: dbSNP rs34562254. Ref.3 | VAR_052353 | |||||||||||||||
Secondary structure | |||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||
| Helix | 73 – 75 | 3 | |||||||||||||||||
| Beta strand | 77 – 80 | 4 | |||||||||||||||||
| Turn | 81 – 84 | 4 | |||||||||||||||||
| Beta strand | 85 – 88 | 4 | |||||||||||||||||
| Helix | 89 – 92 | 4 | |||||||||||||||||
| Helix | 98 – 100 | 3 | |||||||||||||||||
| Helix | 101 – 104 | 4 | |||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "NF-AT activation induced by a CAML-interacting member of the tumor necrosis factor receptor superfamily." von Buelow G.-U., Bram R.J. Science 278:138-141(1997) [PubMed: 9311921] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: B-cell. |
| [2] | Zhou G., Ke R., Li H., Zheng G., Shen C., Lin L., Yang S. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT LEU-251. Tissue: Spleen. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [6] | "Tumor necrosis factor (TNF) receptor superfamily member TACI is a high affinity receptor for TNF family members APRIL and BLyS." Wu Y., Bressette D., Carrell J.A., Kaufman T., Feng P., Taylor K., Gan Y., Cho Y.H., Garcia A.D., Gollatz E., Dimke D., LaFleur D., Migone T.S., Nardelli B., Wei P., Ruben S.M., Ullrich S.J., Olsen H.S. Baker K.P.J. Biol. Chem. 275:35478-35485(2000) [PubMed: 10956646] [Abstract] Cited for: FUNCTION. |
| [7] | "APRIL and TALL-I and receptors BCMA and TACI: system for regulating humoral immunity." Yu G., Boone T., Delaney J., Hawkins N., Kelley M.J., Ramakrishnan M., McCabe S., Qiu W.R., Kornuc M., Xia X.-Z., Guo J., Stolina M., Boyle W.J., Sarosi I., Hsu H., Senaldi G., Theill L.E. Nat. Immunol. 1:252-256(2000) [PubMed: 10973284] [Abstract] Cited for: FUNCTION. |
| [8] | "TACI is a TRAF-interacting receptor for TALL-1, a tumor necrosis factor family member involved in B cell regulation." Xia X.-Z., Treanor J., Senaldi G., Khare S.D., Boone T., Kelley M., Theill L.E., Colombero A., Solovyev I., Lee F., McCabe S., Elliott R., Miner K., Hawkins N., Guo J., Stolina M., Yu G., Wang J. Hsu H.J. Exp. Med. 192:137-143(2000) [PubMed: 10880535] [Abstract] Cited for: INTERACTION WITH TRAF2 AND TRAF5. |
| [9] | "Structures of APRIL-receptor complexes: like BCMA, TACI employs only a single cysteine-rich domain for high affinity ligand binding." Hymowitz S.G., Patel D.R., Wallweber H.J., Runyon S., Yan M., Yin J., Shriver S.K., Gordon N.C., Pan B., Skelton N.J., Kelley R.F., Starovasnik M.A. J. Biol. Chem. 280:7218-7227(2005) [PubMed: 15542592] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.9 ANGSTROMS) OF 68-109 IN COMPLEX WITH MOUSE TNFSF13, STRUCTURE BY NMR OF 68-109. |
| [10] | "TACI is mutant in common variable immunodeficiency and IgA deficiency." Castigli E., Wilson S.A., Garibyan L., Rachid R., Bonilla F., Schneider L., Geha R.S. Nat. Genet. 37:829-834(2005) [PubMed: 16007086] [Abstract] Cited for: VARIANT CVID/IGAD2 ARG-104, VARIANTS CVID GLY-181 AND HIS-202. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF023614 mRNA. Translation: AAC51790.1. AY302137 mRNA. Translation: AAP57629.1. AK313302 mRNA. Translation: BAG36107.1. CH471196 Genomic DNA. Translation: EAW55729.1. BC109392 mRNA. Translation: AAI09393.1. | ||||||||||||||||||
| IPI | IPI00018362. IPI00385403. | ||||||||||||||||||
| RefSeq | NP_036584.1. | ||||||||||||||||||
| UniGene | Hs.158341 | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| DIP | DIP-6224N. | ||||||||||||||||||
| IntAct | O14836. 3 interactions. | ||||||||||||||||||
| STRING | O14836. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PRIDE | O14836. | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000261652; ENSP00000261652; ENSG00000240505; Homo sapiens. [Genome view] | ||||||||||||||||||
| GeneID | 23495. | ||||||||||||||||||
| KEGG | hsa:23495. | ||||||||||||||||||
| UCSC | uc002gqs.1. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 23495. | ||||||||||||||||||
| GeneCards | GC17M016783. | ||||||||||||||||||
| H-InvDB | HIX0013576. | ||||||||||||||||||
| HGNC | HGNC:18153. TNFRSF13B. | ||||||||||||||||||
| MIM | 240500. phenotype. 604907. gene. 609529. phenotype. | ||||||||||||||||||
| Orphanet | 1572. Common variable immunodeficiency. 69127. Immunoglobulin A deficiency. | ||||||||||||||||||
| PharmGKB | PA38509. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | prNOG19158. | ||||||||||||||||||
| HOGENOM | HBG278162. | ||||||||||||||||||
| HOVERGEN | O14836. | ||||||||||||||||||
| InParanoid | O14836. | ||||||||||||||||||
| OMA | CHTRTTV. | ||||||||||||||||||
| PhylomeDB | O14836. | ||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||
| Pathway_Interaction_DB | syndecan_2_pathway. Syndecan-2-mediated signaling events. syndecan_4_pathway. Syndecan-4-mediated signaling events. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | O14836. | ||||||||||||||||||
| Bgee | O14836. | ||||||||||||||||||
| CleanEx | HS_TNFRSF13B. | ||||||||||||||||||
| Genevestigator | O14836. | ||||||||||||||||||
| GermOnline | ENSG00000108516. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR015384. TACI_Cys-rich-dom. [Graphical view] | ||||||||||||||||||
| Pfam | PF09305. TACI-CRD2. 2 hits. [Graphical view] | ||||||||||||||||||
| PROSITE | PS00652. TNFR_NGFR_1. 1 hit. PS50050. TNFR_NGFR_2. False negative. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other Resources | |||||||||||||||||||
| NextBio | 45863. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | TR13B_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O14836 Secondary accession number(s): B2R8B0, Q32LX4, Q7Z6F5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human cell differentiation molecules CD nomenclature of surface proteins of human leucocytes and list of entries |
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


