Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tumor necrosis factor receptor superfamily member 13B

Gene

TNFRSF13B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Receptor for TNFSF13/APRIL and TNFSF13B/TALL1/BAFF/BLYS that binds both ligands with similar high affinity. Mediates calcineurin-dependent activation of NF-AT, as well as activation of NF-kappa-B and AP-1. Involved in the stimulation of B- and T-cell function and the regulation of humoral immunity.2 Publications

GO - Molecular functioni

  • receptor activity Source: ProtInc

GO - Biological processi

Keywordsi

Molecular functionReceptor
Biological processAdaptive immunity, Immunity

Enzyme and pathway databases

ReactomeiR-HSA-5669034. TNFs bind their physiological receptors.
SignaLinkiO14836.
SIGNORiO14836.

Names & Taxonomyi

Protein namesi
Recommended name:
Tumor necrosis factor receptor superfamily member 13B
Alternative name(s):
Transmembrane activator and CAML interactor
CD_antigen: CD267
Gene namesi
Name:TNFRSF13B
Synonyms:TACI
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

EuPathDBiHostDB:ENSG00000240505.8.
HGNCiHGNC:18153. TNFRSF13B.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 165ExtracellularSequence analysisAdd BLAST165
Transmembranei166 – 186Helical; Signal-anchor for type III membrane proteinSequence analysisAdd BLAST21
Topological domaini187 – 293CytoplasmicSequence analysisAdd BLAST107

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Involvement in diseasei

Immunodeficiency, common variable, 2 (CVID2)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA primary immunodeficiency characterized by antibody deficiency, hypogammaglobulinemia, recurrent bacterial infections and an inability to mount an antibody response to antigen. The defect results from a failure of B-cell differentiation and impaired secretion of immunoglobulins; the numbers of circulating B-cells is usually in the normal range, but can be low.
See also OMIM:240500
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_024027104C → R in CVID2 and IGAD2. 1 PublicationCorresponds to variant dbSNP:rs34557412Ensembl.1
Natural variantiVAR_024028181A → G in CVID2. 1 Publication1
Natural variantiVAR_024029202R → H in CVID2. 1 PublicationCorresponds to variant dbSNP:rs104894649Ensembl.1
Immunoglobulin A deficiency 2 (IGAD2)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionSelective deficiency of immunoglobulin A (IGAD) is the most common form of primary immunodeficiency, with an incidence of approximately 1 in 600 individuals in the western world. Individuals with symptomatic IGAD often have deficiency of IgG subclasses or decreased antibody response to carbohydrate antigens such as pneumococcal polysaccharide vaccine. Individuals with IGAD also suffer from recurrent sinopulmonary and gastrointestinal infections and have an increased incidence of autoimmune disorders and of lymphoid and non-lymphoid malignancies. In vitro studies have suggested that some individuals with IGAD have impaired isotype class switching to IgA and others may have a post-switch defect. IGAD and CVID have been known to coexist in families. Some individuals initially present with IGAD1 and then develop CVID. These observations suggest that some cases of IGAD and CVID may have a common etiology.
See also OMIM:609529
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_024027104C → R in CVID2 and IGAD2. 1 PublicationCorresponds to variant dbSNP:rs34557412Ensembl.1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNETi23495.
GeneReviewsiTNFRSF13B.
MalaCardsiTNFRSF13B.
MIMi240500. phenotype.
609529. phenotype.
OpenTargetsiENSG00000240505.
Orphaneti1572. Common variable immunodeficiency.
69127. Immunoglobulin A deficiency.
PharmGKBiPA38509.

Polymorphism and mutation databases

BioMutaiTNFRSF13B.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000589311 – 293Tumor necrosis factor receptor superfamily member 13BAdd BLAST293

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi34 ↔ 47By similarity
Disulfide bondi50 ↔ 62By similarity
Disulfide bondi54 ↔ 66By similarity
Disulfide bondi71 ↔ 86
Disulfide bondi89 ↔ 100
Disulfide bondi93 ↔ 104
Glycosylationi128N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiO14836.
PeptideAtlasiO14836.
PRIDEiO14836.

PTM databases

iPTMnetiO14836.
PhosphoSitePlusiO14836.
SwissPalmiO14836.

Expressioni

Tissue specificityi

Highly expressed in spleen, thymus, small intestine and peripheral blood leukocytes. Expressed in resting B-cells and activated T-cells, but not in resting T-cells.

Gene expression databases

BgeeiENSG00000240505.
CleanExiHS_TNFRSF13B.
ExpressionAtlasiO14836. baseline and differential.
GenevisibleiO14836. HS.

Organism-specific databases

HPAiHPA030453.

Interactioni

Subunit structurei

Binds TRAF2, TRAF5 and TRAF6. Binds the NH2-terminal domain of CAMLG with its C-terminus.1 Publication

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi117046. 36 interactors.
DIPiDIP-6224N.
IntActiO14836. 12 interactors.
STRINGi9606.ENSP00000261652.

Structurei

Secondary structure

1293
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi73 – 75Combined sources3
Beta strandi77 – 80Combined sources4
Turni81 – 84Combined sources4
Beta strandi85 – 88Combined sources4
Helixi89 – 92Combined sources4
Helixi98 – 100Combined sources3
Helixi101 – 104Combined sources4

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1XU1X-ray1.90R/S/T68-109[»]
1XUTNMR-A68-109[»]
ProteinModelPortaliO14836.
SMRiO14836.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO14836.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati33 – 67TNFR-Cys 1Add BLAST35
Repeati70 – 104TNFR-Cys 2Add BLAST35

Keywords - Domaini

Repeat, Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IHJ8. Eukaryota.
ENOG410Z545. LUCA.
GeneTreeiENSGT00390000013910.
HOGENOMiHOG000273905.
HOVERGENiHBG058015.
InParanoidiO14836.
KOiK05150.
OMAiCHTRTTV.
OrthoDBiEOG091G0ISO.
PhylomeDBiO14836.
TreeFamiTF337993.

Family and domain databases

CDDicd13415. TNFRSF13B. 1 hit.
InterProiView protein in InterPro
IPR015384. TACI_Cys-rich-dom.
IPR022317. TNFR_13B.
PANTHERiPTHR15511. PTHR15511. 1 hit.
PfamiView protein in Pfam
PF09305. TACI-CRD2. 2 hits.
PRINTSiPR01963. TNFACTORR13B.
PROSITEiView protein in PROSITE
PS00652. TNFR_NGFR_1. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O14836-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSGLGRSRRG GRSRVDQEER FPQGLWTGVA MRSCPEEQYW DPLLGTCMSC
60 70 80 90 100
KTICNHQSQR TCAAFCRSLS CRKEQGKFYD HLLRDCISCA SICGQHPKQC
110 120 130 140 150
AYFCENKLRS PVNLPPELRR QRSGEVENNS DNSGRYQGLE HRGSEASPAL
160 170 180 190 200
PGLKLSADQV ALVYSTLGLC LCAVLCCFLV AVACFLKKRG DPCSCQPRSR
210 220 230 240 250
PRQSPAKSSQ DHAMEAGSPV STSPEPVETC SFCFPECRAP TQESAVTPGT
260 270 280 290
PDPTCAGRWG CHTRTTVLQP CPHIPDSGLG IVCVPAQEGG PGA
Length:293
Mass (Da):31,816
Last modified:January 1, 1998 - v1
Checksum:i411799F3DE17A5EB
GO
Isoform 2 (identifier: O14836-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     21-67: FPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCR → W

Show »
Length:247
Mass (Da):26,664
Checksum:i850E1F4C2578E8E6
GO
Isoform 3 (identifier: O14836-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     150-176: LPGLKLSADQVALVYSTLGLCLCAVLC → PRGCPAPGTRKSFWDKENFQGEGFHLG
     177-293: Missing.

Note: No experimental confirmation available.
Show »
Length:176
Mass (Da):19,865
Checksum:i4506764708AF788C
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06475856H → N Found in a renal cell carcinoma sample; somatic mutation. 1 Publication1
Natural variantiVAR_024027104C → R in CVID2 and IGAD2. 1 PublicationCorresponds to variant dbSNP:rs34557412Ensembl.1
Natural variantiVAR_024028181A → G in CVID2. 1 Publication1
Natural variantiVAR_024029202R → H in CVID2. 1 PublicationCorresponds to variant dbSNP:rs104894649Ensembl.1
Natural variantiVAR_052353251P → L1 PublicationCorresponds to variant dbSNP:rs34562254Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_01379821 – 67FPQGL…AAFCR → W in isoform 2. 2 PublicationsAdd BLAST47
Alternative sequenceiVSP_054184150 – 176LPGLK…CAVLC → PRGCPAPGTRKSFWDKENFQ GEGFHLG in isoform 3. 1 PublicationAdd BLAST27
Alternative sequenceiVSP_054185177 – 293Missing in isoform 3. 1 PublicationAdd BLAST117

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF023614 mRNA. Translation: AAC51790.1.
AY302137 mRNA. Translation: AAP57629.1.
AK301032 mRNA. Translation: BAH13394.1.
AK313302 mRNA. Translation: BAG36107.1.
CH471196 Genomic DNA. Translation: EAW55729.1.
BC109392 mRNA. Translation: AAI09393.1.
CCDSiCCDS11181.1. [O14836-1]
RefSeqiNP_036584.1. NM_012452.2. [O14836-1]
UniGeneiHs.158341.

Genome annotation databases

EnsembliENST00000261652; ENSP00000261652; ENSG00000240505. [O14836-1]
ENST00000583789; ENSP00000462952; ENSG00000240505. [O14836-2]
GeneIDi23495.
KEGGihsa:23495.
UCSCiuc002gqt.2. human. [O14836-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiTR13B_HUMAN
AccessioniPrimary (citable) accession number: O14836
Secondary accession number(s): B2R8B0
, B7Z6V8, Q32LX4, Q7Z6F5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 27, 2002
Last sequence update: January 1, 1998
Last modified: November 22, 2017
This is version 154 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references