Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

O14836 (TR13B_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 128. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (7) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Tumor necrosis factor receptor superfamily member 13B
Alternative name(s):
Transmembrane activator and CAML interactor
CD_antigen=CD267
Gene names
Name:TNFRSF13B
Synonyms:TACI
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length293 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Receptor for TNFSF13/APRIL and TNFSF13B/TALL1/BAFF/BLYS that binds both ligands with similar high affinity. Mediates calcineurin-dependent activation of NF-AT, as well as activation of NF-kappa-B and AP-1. Involved in the stimulation of B- and T-cell function and the regulation of humoral immunity. Ref.6 Ref.7

Subunit structure

Binds TRAF2, TRAF5 and TRAF6. Binds the NH2-terminal domain of CAMLG with its C-terminus.

Subcellular location

Membrane; Single-pass type III membrane protein.

Tissue specificity

Highly expressed in spleen, thymus, small intestine and peripheral blood leukocytes. Expressed in resting B-cells and activated T-cells, but not in resting T-cells.

Involvement in disease

Immunodeficiency, common variable, 2 (CVID2) [MIM:240500]: A primary immunodeficiency characterized by antibody deficiency, hypogammaglobulinemia, recurrent bacterial infections and an inability to mount an antibody response to antigen. The defect results from a failure of B-cell differentiation and impaired secretion of immunoglobulins; the numbers of circulating B-cells is usually in the normal range, but can be low.
Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.10

Immunoglobulin A deficiency 2 (IGAD2) [MIM:609529]: Selective deficiency of immunoglobulin A (IGAD) is the most common form of primary immunodeficiency, with an incidence of approximately 1 in 600 individuals in the western world. Individuals with symptomatic IGAD often have deficiency of IgG subclasses or decreased antibody response to carbohydrate antigens such as pneumococcal polysaccharide vaccine. Individuals with IGAD also suffer from recurrent sinopulmonary and gastrointestinal infections and have an increased incidence of autoimmune disorders and of lymphoid and non-lymphoid malignancies. In vitro studies have suggested that some individuals with IGAD have impaired isotype class switching to IgA and others may have a post-switch defect. IGAD and CVID have been known to coexist in families. Some individuals initially present with IGAD1 and then develop CVID. These observations suggest that some cases of IGAD and CVID may have a common etiology.
Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.10

Sequence similarities

Contains 2 TNFR-Cys repeats.

Binary interactions

With

Entry

#Exp.

IntAct

Notes

MYD88Q9983612EBI-519160,EBI-447677
TNFSF13BQ9Y2757EBI-519160,EBI-519169

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: O14836-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: O14836-2)

The sequence of this isoform differs from the canonical sequence as follows:
     21-67: FPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCR → W
Isoform 3 (identifier: O14836-3)

The sequence of this isoform differs from the canonical sequence as follows:
     150-176: LPGLKLSADQVALVYSTLGLCLCAVLC → PRGCPAPGTRKSFWDKENFQGEGFHLG
     177-293: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 293293Tumor necrosis factor receptor superfamily member 13B
PRO_0000058931

Regions

Topological domain1 – 165165Extracellular Potential
Transmembrane166 – 18621Helical; Signal-anchor for type III membrane protein; Potential
Topological domain187 – 293107Cytoplasmic Potential
Repeat33 – 6735TNFR-Cys 1
Repeat70 – 10435TNFR-Cys 2

Amino acid modifications

Glycosylation1281N-linked (GlcNAc...) Potential
Disulfide bond34 ↔ 47 By similarity
Disulfide bond50 ↔ 62 By similarity
Disulfide bond54 ↔ 66 By similarity
Disulfide bond71 ↔ 86
Disulfide bond89 ↔ 100
Disulfide bond93 ↔ 104

Natural variations

Alternative sequence21 – 6747FPQGL…AAFCR → W in isoform 2.
VSP_013798
Alternative sequence150 – 17627LPGLK…CAVLC → PRGCPAPGTRKSFWDKENFQ GEGFHLG in isoform 3.
VSP_054184
Alternative sequence177 – 293117Missing in isoform 3.
VSP_054185
Natural variant561H → N Found in a renal cell carcinoma sample; somatic mutation. Ref.11
VAR_064758
Natural variant1041C → R in CVID2 and IGAD2. Ref.10
Corresponds to variant rs34557412 [ dbSNP | Ensembl ].
VAR_024027
Natural variant1811A → G in CVID2. Ref.10
VAR_024028
Natural variant2021R → H in CVID2. Ref.10
VAR_024029
Natural variant2511P → L. Ref.3
Corresponds to variant rs34562254 [ dbSNP | Ensembl ].
VAR_052353

Secondary structure

........... 293
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified January 1, 1998. Version 1.
Checksum: 411799F3DE17A5EB

FASTA29331,816
        10         20         30         40         50         60 
MSGLGRSRRG GRSRVDQEER FPQGLWTGVA MRSCPEEQYW DPLLGTCMSC KTICNHQSQR 

        70         80         90        100        110        120 
TCAAFCRSLS CRKEQGKFYD HLLRDCISCA SICGQHPKQC AYFCENKLRS PVNLPPELRR 

       130        140        150        160        170        180 
QRSGEVENNS DNSGRYQGLE HRGSEASPAL PGLKLSADQV ALVYSTLGLC LCAVLCCFLV 

       190        200        210        220        230        240 
AVACFLKKRG DPCSCQPRSR PRQSPAKSSQ DHAMEAGSPV STSPEPVETC SFCFPECRAP 

       250        260        270        280        290 
TQESAVTPGT PDPTCAGRWG CHTRTTVLQP CPHIPDSGLG IVCVPAQEGG PGA 

« Hide

Isoform 2 [UniParc].

Checksum: 850E1F4C2578E8E6
Show »

FASTA24726,664
Isoform 3 [UniParc].

Checksum: 4506764708AF788C
Show »

FASTA17619,865

References

« Hide 'large scale' references
[1]"NF-AT activation induced by a CAML-interacting member of the tumor necrosis factor receptor superfamily."
von Buelow G.-U., Bram R.J.
Science 278:138-141(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: B-cell.
[2]Zhou G., Ke R., Li H., Zheng G., Shen C., Lin L., Yang S.
Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), VARIANT LEU-251.
Tissue: Spleen.
[4]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
[6]"Tumor necrosis factor (TNF) receptor superfamily member TACI is a high affinity receptor for TNF family members APRIL and BLyS."
Wu Y., Bressette D., Carrell J.A., Kaufman T., Feng P., Taylor K., Gan Y., Cho Y.H., Garcia A.D., Gollatz E., Dimke D., LaFleur D., Migone T.S., Nardelli B., Wei P., Ruben S.M., Ullrich S.J., Olsen H.S. expand/collapse author list , Kanakaraj P., Moore P.A., Baker K.P.
J. Biol. Chem. 275:35478-35485(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION.
[7]"APRIL and TALL-I and receptors BCMA and TACI: system for regulating humoral immunity."
Yu G., Boone T., Delaney J., Hawkins N., Kelley M.J., Ramakrishnan M., McCabe S., Qiu W.R., Kornuc M., Xia X.-Z., Guo J., Stolina M., Boyle W.J., Sarosi I., Hsu H., Senaldi G., Theill L.E.
Nat. Immunol. 1:252-256(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION.
[8]"TACI is a TRAF-interacting receptor for TALL-1, a tumor necrosis factor family member involved in B cell regulation."
Xia X.-Z., Treanor J., Senaldi G., Khare S.D., Boone T., Kelley M., Theill L.E., Colombero A., Solovyev I., Lee F., McCabe S., Elliott R., Miner K., Hawkins N., Guo J., Stolina M., Yu G., Wang J. expand/collapse author list , Delaney J., Meng S.-Y., Boyle W.J., Hsu H.
J. Exp. Med. 192:137-143(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH TRAF2 AND TRAF5.
[9]"Structures of APRIL-receptor complexes: like BCMA, TACI employs only a single cysteine-rich domain for high affinity ligand binding."
Hymowitz S.G., Patel D.R., Wallweber H.J., Runyon S., Yan M., Yin J., Shriver S.K., Gordon N.C., Pan B., Skelton N.J., Kelley R.F., Starovasnik M.A.
J. Biol. Chem. 280:7218-7227(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: X-RAY CRYSTALLOGRAPHY (1.9 ANGSTROMS) OF 68-109 IN COMPLEX WITH MOUSE TNFSF13, STRUCTURE BY NMR OF 68-109.
[10]"TACI is mutant in common variable immunodeficiency and IgA deficiency."
Castigli E., Wilson S.A., Garibyan L., Rachid R., Bonilla F., Schneider L., Geha R.S.
Nat. Genet. 37:829-834(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT IGAD2 ARG-104, VARIANTS CVID2 ARG-104; GLY-181 AND HIS-202.
[11]"Exome sequencing identifies frequent mutation of the SWI/SNF complex gene PBRM1 in renal carcinoma."
Varela I., Tarpey P., Raine K., Huang D., Ong C.K., Stephens P., Davies H., Jones D., Lin M.L., Teague J., Bignell G., Butler A., Cho J., Dalgliesh G.L., Galappaththige D., Greenman C., Hardy C., Jia M. expand/collapse author list , Latimer C., Lau K.W., Marshall J., McLaren S., Menzies A., Mudie L., Stebbings L., Largaespada D.A., Wessels L.F.A., Richard S., Kahnoski R.J., Anema J., Tuveson D.A., Perez-Mancera P.A., Mustonen V., Fischer A., Adams D.J., Rust A., Chan-On W., Subimerb C., Dykema K., Furge K., Campbell P.J., Teh B.T., Stratton M.R., Futreal P.A.
Nature 469:539-542(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT ASN-56.
+Additional computationally mapped references.

Web resources

TNFRSF13Bbase

TNFRSF13B mutation db

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF023614 mRNA. Translation: AAC51790.1.
AY302137 mRNA. Translation: AAP57629.1.
AK301032 mRNA. Translation: BAH13394.1.
AK313302 mRNA. Translation: BAG36107.1.
CH471196 Genomic DNA. Translation: EAW55729.1.
BC109392 mRNA. Translation: AAI09393.1.
CCDSCCDS11181.1. [O14836-1]
RefSeqNP_036584.1. NM_012452.2. [O14836-1]
UniGeneHs.158341.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
1XU1X-ray1.90R/S/T68-109[»]
1XUTNMR-A68-109[»]
ProteinModelPortalO14836.
SMRO14836. Positions 68-109.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid117046. 11 interactions.
DIPDIP-6224N.
IntActO14836. 11 interactions.
STRING9606.ENSP00000261652.

Chemistry

GuidetoPHARMACOLOGY1885.

PTM databases

PhosphoSiteO14836.

Proteomic databases

MaxQBO14836.
PaxDbO14836.
PRIDEO14836.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000261652; ENSP00000261652; ENSG00000240505. [O14836-1]
ENST00000583789; ENSP00000462952; ENSG00000240505. [O14836-2]
GeneID23495.
KEGGhsa:23495.
UCSCuc002gqs.1. human. [O14836-1]
uc002gqt.1. human. [O14836-2]

Organism-specific databases

CTD23495.
GeneCardsGC17M016832.
GeneReviewsTNFRSF13B.
H-InvDBHIX0173687.
HGNCHGNC:18153. TNFRSF13B.
HPAHPA030453.
MIM240500. phenotype.
604907. gene.
609529. phenotype.
neXtProtNX_O14836.
Orphanet1572. Common variable immunodeficiency.
69127. Immunoglobulin A deficiency.
PharmGKBPA38509.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG43611.
HOGENOMHOG000273905.
HOVERGENHBG058015.
InParanoidO14836.
KOK05150.
OMACHTRTTV.
OrthoDBEOG7W6WMN.
PhylomeDBO14836.
TreeFamTF337993.

Enzyme and pathway databases

SignaLinkO14836.

Gene expression databases

ArrayExpressO14836.
BgeeO14836.
CleanExHS_TNFRSF13B.
GenevestigatorO14836.

Family and domain databases

InterProIPR015384. TACI_Cys-rich-dom.
IPR022317. TNFR_13B.
[Graphical view]
PfamPF09305. TACI-CRD2. 2 hits.
[Graphical view]
PRINTSPR01963. TNFACTORR13B.
PROSITEPS00652. TNFR_NGFR_1. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSTNFRSF13B. human.
EvolutionaryTraceO14836.
GeneWikiTNFRSF13B.
GenomeRNAi23495.
NextBio35480074.
PROO14836.
SOURCESearch...

Entry information

Entry nameTR13B_HUMAN
AccessionPrimary (citable) accession number: O14836
Secondary accession number(s): B2R8B0 expand/collapse secondary AC list , B7Z6V8, Q32LX4, Q7Z6F5
Entry history
Integrated into UniProtKB/Swiss-Prot: May 27, 2002
Last sequence update: January 1, 1998
Last modified: July 9, 2014
This is version 128 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 17

Human chromosome 17: entries, gene names and cross-references to MIM

Human cell differentiation molecules

CD nomenclature of surface proteins of human leucocytes and list of entries