Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O14617

- AP3D1_HUMAN

UniProt

O14617 - AP3D1_HUMAN

Protein

AP-3 complex subunit delta-1

Gene

AP3D1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 138 (01 Oct 2014)
      Sequence version 1 (01 Jan 1998)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Part of the AP-3 complex, an adaptor-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes. In concert with the BLOC-1 complex, AP-3 is required to target cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals.

    GO - Molecular functioni

    1. protein transporter activity Source: InterPro
    2. transporter activity Source: ProtInc

    GO - Biological processi

    1. anterograde axon cargo transport Source: UniProtKB
    2. anterograde synaptic vesicle transport Source: UniProtKB
    3. antigen processing and presentation, exogenous lipid antigen via MHC class Ib Source: Ensembl
    4. endosome to melanosome transport Source: BHF-UCL
    5. eye pigment biosynthetic process Source: ProtInc
    6. intracellular protein transport Source: ProtInc
    7. melanosome organization Source: BHF-UCL
    8. positive regulation of NK T cell differentiation Source: Ensembl
    9. protein localization to membrane Source: BHF-UCL
    10. protein localization to organelle Source: Ensembl
    11. regulation of sequestering of zinc ion Source: BHF-UCL
    12. synaptic vesicle membrane organization Source: Ensembl

    Keywords - Biological processi

    Protein transport, Transport

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    AP-3 complex subunit delta-1
    Alternative name(s):
    AP-3 complex subunit delta
    Adaptor-related protein complex 3 subunit delta-1
    Delta-adaptin
    Gene namesi
    Name:AP3D1
    ORF Names:PRO0039
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 19

    Organism-specific databases

    HGNCiHGNC:568. AP3D1.

    Subcellular locationi

    Cytoplasm By similarity. Golgi apparatus membrane By similarity; Peripheral membrane protein By similarity; Cytoplasmic side By similarity

    GO - Cellular componenti

    1. endosome membrane Source: UniProtKB
    2. Golgi apparatus Source: ProtInc
    3. Golgi membrane Source: UniProtKB-SubCell
    4. lysosomal membrane Source: UniProtKB
    5. membrane Source: UniProtKB
    6. membrane coat Source: InterPro
    7. terminal bouton Source: Ensembl

    Keywords - Cellular componenti

    Cytoplasm, Golgi apparatus, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA24859.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Initiator methioninei1 – 11Removed1 Publication
    Chaini2 – 11531152AP-3 complex subunit delta-1PRO_0000193766Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei2 – 21N-acetylalanine1 Publication
    Modified residuei632 – 6321Phosphoserine3 Publications
    Modified residuei634 – 6341Phosphoserine2 Publications
    Modified residuei636 – 6361Phosphoserine2 Publications
    Modified residuei658 – 6581Phosphoserine2 Publications
    Modified residuei688 – 6881Phosphoserine1 Publication
    Modified residuei758 – 7581Phosphoserine1 Publication
    Modified residuei759 – 7591Phosphoserine1 Publication
    Modified residuei762 – 7621Phosphothreonine1 Publication
    Modified residuei764 – 7641Phosphoserine1 Publication
    Modified residuei788 – 7881Phosphoserine2 Publications
    Modified residuei829 – 8291Phosphoserine1 Publication

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    MaxQBiO14617.
    PaxDbiO14617.
    PRIDEiO14617.

    PTM databases

    PhosphoSiteiO14617.

    Expressioni

    Tissue specificityi

    Present in all adult tissues examined with the highest levels in skeletal muscle, heart, pancreas and testis.1 Publication

    Gene expression databases

    ArrayExpressiO14617.
    BgeeiO14617.
    CleanExiHS_AP3D1.
    GenevestigatoriO14617.

    Organism-specific databases

    HPAiHPA047554.

    Interactioni

    Subunit structurei

    AP-3 associates with the BLOC-1 complex By similarity. Adaptor protein complex 3 (AP-3) is a heterotetramer composed of two large adaptins (delta-type subunit AP3D1 and beta-type subunit AP3B1 or AP3B2), a medium adaptin (mu-type subunit AP3M1 or AP3M2) and a small adaptin (sigma-type subunit APS1 or AP3S2).By similarity

    Protein-protein interaction databases

    BioGridi114455. 13 interactions.
    DIPiDIP-46793N.
    IntActiO14617. 9 interactions.
    MINTiMINT-5003757.
    STRINGi9606.ENSP00000344055.

    Structurei

    Secondary structure

    1
    1153
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi704 – 7063
    Beta strandi722 – 7287

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    4AFIX-ray2.80A/B680-729[»]
    ProteinModelPortaliO14617.
    SMRiO14617. Positions 16-507, 696-729.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati34 – 7138HEAT 1Add
    BLAST
    Repeati77 – 11438HEAT 2Add
    BLAST
    Repeati142 – 17938HEAT 3Add
    BLAST
    Repeati180 – 21637HEAT 4Add
    BLAST
    Repeati254 – 29239HEAT 5Add
    BLAST
    Repeati299 – 33638HEAT 6Add
    BLAST
    Repeati338 – 37336HEAT 7Add
    BLAST
    Repeati375 – 40935HEAT 8Add
    BLAST
    Repeati431 – 46838HEAT 9Add
    BLAST
    Repeati497 – 53539HEAT 10Add
    BLAST
    Repeati548 – 58538HEAT 11Add
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili659 – 67921Sequence AnalysisAdd
    BLAST
    Coiled coili725 – 75632Sequence AnalysisAdd
    BLAST
    Coiled coili845 – 86925Sequence AnalysisAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi828 – 89366Lys-richAdd
    BLAST

    Sequence similaritiesi

    Contains 11 HEAT repeats.Curated

    Keywords - Domaini

    Coiled coil, Repeat

    Phylogenomic databases

    eggNOGiCOG5096.
    HOGENOMiHOG000000981.
    HOVERGENiHBG050520.
    KOiK12396.
    OMAiKANAVCK.
    OrthoDBiEOG79SDWG.
    PhylomeDBiO14617.
    TreeFamiTF105666.

    Family and domain databases

    Gene3Di1.25.10.10. 1 hit.
    InterProiIPR017105. AP3_complex_dsu.
    IPR011989. ARM-like.
    IPR016024. ARM-type_fold.
    IPR010474. BLV_receptor.
    IPR002553. Clathrin/coatomer_adapt-like_N.
    [Graphical view]
    PfamiPF01602. Adaptin_N. 1 hit.
    PF06375. BLVR. 1 hit.
    [Graphical view]
    PIRSFiPIRSF037092. AP3_complex_delta. 1 hit.
    SUPFAMiSSF48371. SSF48371. 1 hit.

    Sequences (5)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O14617-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MALKMVKGSI DRMFDKNLQD LVRGIRNHKE DEAKYISQCI DEIKQELKQD     50
    NIAVKANAVC KLTYLQMLGY DISWAAFNII EVMSASKFTF KRIGYLAASQ 100
    SFHEGTDVIM LTTNQIRKDL SSPSQYDTGV ALTGLSCFVT PDLARDLAND 150
    IMTLMSHTKP YIRKKAVLIM YKVFLKYPES LRPAFPRLKE KLEDPDPGVQ 200
    SAAVNVICEL ARRNPKNYLS LAPLFFKLMT SSTNNWVLIK IIKLFGALTP 250
    LEPRLGKKLI EPLTNLIHST SAMSLLYECV NTVIAVLISL SSGMPNHSAS 300
    IQLCVQKLRI LIEDSDQNLK YLGLLAMSKI LKTHPKSVQS HKDLILQCLD 350
    DKDESIRLRA LDLLYGMVSK KNLMEIVKKL MTHVDKAEGT TYRDELLTKI 400
    IDICSQSNYQ YITNFEWYIS ILVELTRLEG TRHGHLIAAQ MLDVAIRVKA 450
    IRKFAVSQMS ALLDSAHLLA SSTQRNGICE VLYAAAWICG EFSEHLQEPH 500
    HTLEAMLRPR VTTLPGHIQA VYVQNVVKLY ASILQQKEQA GEAEGAQAVT 550
    QLMVDRLPQF VQSADLEVQE RASCILQLVK HIQKLQAKDV PVAEEVSALF 600
    AGELNPVAPK AQKKVPVPEG LDLDAWINEP LSDSESEDER PRAVFHEEEQ 650
    RRPKHRPSEA DEEELARRRE ARKQEQANNP FYIKSSPSPQ KRYQDTPGVE 700
    HIPVVQIDLS VPLKVPGLPM SDQYVKLEEE RRHRQKLEKD KRRKKRKEKE 750
    KKGKRRHSSL PTESDEDIAP AQQVDIVTEE MPENALPSDE DDKDPNDPYR 800
    ALDIDLDKPL ADSEKLPIQK HRNTETSKSP EKDVPMVEKK SKKPKKKEKK 850
    HKEKERDKEK KKEKEKKKSP KPKKKKHRKE KEERTKGKKK SKKQPPGSEE 900
    AAGEPVQNGA PEEEQLPPES SYSLLAENSY VKMTCDIRGS LQEDSQVTVA 950
    IVLENRSSSI LKGMELSVLD SLNARMARPQ GSSVHDGVPV PFQLPPGVSN 1000
    EAQYVFTIQS IVMAQKLKGT LSFIAKNDEG ATHEKLDFRL HFSCSSYLIT 1050
    TPCYSDAFAK LLESGDLSMS SIKVDGIRMS FQNLLAKICF HHHFSVVERV 1100
    DSCASMYSRS IQGHHVCLLV KKGENSVSVD GKCSDSTLLS NLLEEMKATL 1150
    AKC 1153
    Length:1,153
    Mass (Da):130,158
    Last modified:January 1, 1998 - v1
    Checksum:i1B491DD64EAD5096
    GO
    Isoform 2 (identifier: O14617-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         168-258: Missing.
         866-866: K → KKAEDLDFWLSTTPPPAPAPAPAPVPSTDECEDAKTEAQGEEDDAEGQDQD

    Note: Contains a phosphoserine at position 828.

    Show »
    Length:1,112
    Mass (Da):125,040
    Checksum:i33380E690D5AC35F
    GO
    Isoform 3 (identifier: O14617-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         117-285: Missing.

    Show »
    Length:984
    Mass (Da):111,238
    Checksum:i8FA5C9ED9EF57A83
    GO
    Isoform 4 (identifier: O14617-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         746-877: Missing.

    Show »
    Length:1,021
    Mass (Da):114,707
    Checksum:i730F9AD61CEF63DD
    GO
    Isoform 5 (identifier: O14617-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         866-866: K → KKAEDLDFWLSTTPPPAPAPAPAPVPSTGELSVNTVTTPKDECEDAKTEAQGEEDDAEGQDQD

    Note: Contains a phosphoserine at position 931.

    Show »
    Length:1,215
    Mass (Da):136,651
    Checksum:iE77257F13AD4A67F
    GO

    Sequence cautioni

    The sequence AAG35473.1 differs from that shown. Reason: Contaminating sequence. Presence of an unrelated sequence found on chromosome 7.
    The sequence AAH10065.1 differs from that shown. Reason: Lack of 8 exons and truncation of 2 other exons in the C- terminus. Alternative splicing seems doubtful, since exon-intron junctions are not the consensus ones.
    The sequence BAD92041.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti3 – 31L → F in AAD03777. (PubMed:9151686)Curated
    Sequence conflicti167 – 1671Missing in AAC34214. (PubMed:15057824)Curated
    Sequence conflicti252 – 2521E → G in AAH10065. (PubMed:15489334)Curated
    Sequence conflicti595 – 6039EVSALFAGE → DFVHCCYEL in AAG35473. 1 PublicationCurated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti541 – 5411G → R.
    Corresponds to variant rs34569645 [ dbSNP | Ensembl ].
    VAR_033517
    Natural varianti1072 – 10721I → V.
    Corresponds to variant rs25673 [ dbSNP | Ensembl ].
    VAR_033518

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei117 – 285169Missing in isoform 3. 1 PublicationVSP_000167Add
    BLAST
    Alternative sequencei168 – 25891Missing in isoform 2. 2 PublicationsVSP_000165Add
    BLAST
    Alternative sequencei746 – 877132Missing in isoform 4. 1 PublicationVSP_000168Add
    BLAST
    Alternative sequencei866 – 8661K → KKAEDLDFWLSTTPPPAPAP APAPVPSTDECEDAKTEAQG EEDDAEGQDQD in isoform 2. 2 PublicationsVSP_000166
    Alternative sequencei866 – 8661K → KKAEDLDFWLSTTPPPAPAP APAPVPSTGELSVNTVTTPK DECEDAKTEAQGEEDDAEGQ DQD in isoform 5. 1 PublicationVSP_017106

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF002163 mRNA. Translation: AAC51761.1.
    U91930 mRNA. Translation: AAD03777.1.
    AB208804 mRNA. Translation: BAD92041.1. Different initiation.
    AC005545 Genomic DNA. Translation: AAC34212.1.
    AC005545 Genomic DNA. Translation: AAC34214.1.
    BC010065 mRNA. Translation: AAH10065.1. Sequence problems.
    AF130042 mRNA. Translation: AAG35473.1. Sequence problems.
    CCDSiCCDS42459.1. [O14617-1]
    CCDS58638.1. [O14617-5]
    RefSeqiNP_001248755.1. NM_001261826.1. [O14617-5]
    NP_003929.4. NM_003938.6. [O14617-1]
    UniGeneiHs.512815.

    Genome annotation databases

    EnsembliENST00000345016; ENSP00000344055; ENSG00000065000. [O14617-1]
    ENST00000355272; ENSP00000347416; ENSG00000065000. [O14617-5]
    GeneIDi8943.
    KEGGihsa:8943.
    UCSCiuc002luz.4. human. [O14617-1]
    uc002lva.4. human. [O14617-5]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF002163 mRNA. Translation: AAC51761.1 .
    U91930 mRNA. Translation: AAD03777.1 .
    AB208804 mRNA. Translation: BAD92041.1 . Different initiation.
    AC005545 Genomic DNA. Translation: AAC34212.1 .
    AC005545 Genomic DNA. Translation: AAC34214.1 .
    BC010065 mRNA. Translation: AAH10065.1 . Sequence problems.
    AF130042 mRNA. Translation: AAG35473.1 . Sequence problems.
    CCDSi CCDS42459.1. [O14617-1 ]
    CCDS58638.1. [O14617-5 ]
    RefSeqi NP_001248755.1. NM_001261826.1. [O14617-5 ]
    NP_003929.4. NM_003938.6. [O14617-1 ]
    UniGenei Hs.512815.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    4AFI X-ray 2.80 A/B 680-729 [» ]
    ProteinModelPortali O14617.
    SMRi O14617. Positions 16-507, 696-729.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 114455. 13 interactions.
    DIPi DIP-46793N.
    IntActi O14617. 9 interactions.
    MINTi MINT-5003757.
    STRINGi 9606.ENSP00000344055.

    PTM databases

    PhosphoSitei O14617.

    Proteomic databases

    MaxQBi O14617.
    PaxDbi O14617.
    PRIDEi O14617.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000345016 ; ENSP00000344055 ; ENSG00000065000 . [O14617-1 ]
    ENST00000355272 ; ENSP00000347416 ; ENSG00000065000 . [O14617-5 ]
    GeneIDi 8943.
    KEGGi hsa:8943.
    UCSCi uc002luz.4. human. [O14617-1 ]
    uc002lva.4. human. [O14617-5 ]

    Organism-specific databases

    CTDi 8943.
    GeneCardsi GC19M002101.
    H-InvDB HIX0014607.
    HGNCi HGNC:568. AP3D1.
    HPAi HPA047554.
    MIMi 607246. gene.
    neXtProti NX_O14617.
    PharmGKBi PA24859.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5096.
    HOGENOMi HOG000000981.
    HOVERGENi HBG050520.
    KOi K12396.
    OMAi KANAVCK.
    OrthoDBi EOG79SDWG.
    PhylomeDBi O14617.
    TreeFami TF105666.

    Miscellaneous databases

    ChiTaRSi AP3D1. human.
    GeneWikii AP3D1.
    GenomeRNAii 8943.
    NextBioi 33636.
    PROi O14617.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O14617.
    Bgeei O14617.
    CleanExi HS_AP3D1.
    Genevestigatori O14617.

    Family and domain databases

    Gene3Di 1.25.10.10. 1 hit.
    InterProi IPR017105. AP3_complex_dsu.
    IPR011989. ARM-like.
    IPR016024. ARM-type_fold.
    IPR010474. BLV_receptor.
    IPR002553. Clathrin/coatomer_adapt-like_N.
    [Graphical view ]
    Pfami PF01602. Adaptin_N. 1 hit.
    PF06375. BLVR. 1 hit.
    [Graphical view ]
    PIRSFi PIRSF037092. AP3_complex_delta. 1 hit.
    SUPFAMi SSF48371. SSF48371. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Altered expression of a novel adaptin leads to defective pigment granule biogenesis in the Drosophila eye color mutant garnet."
      Ooi C.E., Moreira J.E., Dell'Angelica E.C., Poy G., Wassarman D.A., Bonifacino J.S.
      EMBO J. 16:4508-4518(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4).
      Tissue: Fetal brain.
    2. "Characterization of the adaptor-related protein complex, AP-3."
      Simpson F., Peden A.A., Christopoulou L., Robinson M.S.
      J. Cell Biol. 137:835-845(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY.
      Tissue: Heart.
    3. Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F.
      Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
      Tissue: Brain.
    4. "The DNA sequence and biology of human chromosome 19."
      Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
      , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
      Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Muscle.
    6. "Functional prediction of the coding sequences of 75 new genes deduced by analysis of cDNA clones from human fetal liver."
      Zhang C., Yu Y., Zhang S., Wei H., Bi J., Zhou G., Dong C., Zai Y., Xu W., Gao F., Liu M., He F.
      Submitted (FEB-1999) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 74-603 (ISOFORM 1).
      Tissue: Fetal liver.
    7. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
      Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
      Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-632; SER-634; SER-636 AND SER-658, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    8. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Platelet.
    9. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-688; SER-758; SER-759; THR-762; SER-764 AND SER-788, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-828 (ISOFORM 2), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-931 (ISOFORM 5), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    10. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-632; SER-634; SER-636; SER-788 AND SER-829, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    11. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    12. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-632 AND SER-658, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    13. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiAP3D1_HUMAN
    AccessioniPrimary (citable) accession number: O14617
    Secondary accession number(s): O00202
    , O75262, Q59HF5, Q96G11, Q9H3C6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 11, 2002
    Last sequence update: January 1, 1998
    Last modified: October 1, 2014
    This is version 138 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 19
      Human chromosome 19: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3