Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Histone demethylase UTY

Gene

UTY

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Male-specific histone demethylase that catalyzes trimethylated 'Lys-27' (H3K27me3) demethylation in histone H3. Has relatively low lysine demethylase activity.1 Publication

Cofactori

Protein has several cofactor binding sites:

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi1093Iron1 Publication1
Metal bindingi1095Iron1 Publication1
Metal bindingi1173Iron1 Publication1
Metal bindingi1278Zinc1 Publication1
Metal bindingi1281Zinc1 Publication1
Metal bindingi1305Zinc1 Publication1
Metal bindingi1308Zinc1 Publication1

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Chromatin regulator, Dioxygenase, Oxidoreductase

Keywords - Ligandi

Iron, Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-3214842. HDMs demethylate histones.

Names & Taxonomyi

Protein namesi
Recommended name:
Histone demethylase UTY (EC:1.14.11.-)
Alternative name(s):
Ubiquitously-transcribed TPR protein on the Y chromosome
Ubiquitously-transcribed Y chromosome tetratricopeptide repeat protein
Gene namesi
Name:UTY
Synonyms:KDM6C
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome Y

Organism-specific databases

HGNCiHGNC:12638. UTY.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi1093H → A: Abolishes lysine demethylase activity. 1 Publication1
Mutagenesisi1138S → G: No effect on lysine demethylase activity. 1 Publication1
Mutagenesisi1214P → I: Significantly higher lysine demethylase activity. 1 Publication1

Organism-specific databases

DisGeNETi7404.
OpenTargetsiENSG00000183878.
PharmGKBiPA37263.

Polymorphism and mutation databases

BioMutaiUTY.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001064111 – 1347Histone demethylase UTYAdd BLAST1347

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei468Omega-N-methylarginineBy similarity1
Modified residuei498Omega-N-methylarginineBy similarity1
Modified residuei716PhosphoserineBy similarity1
Modified residuei774PhosphothreonineBy similarity1
Modified residuei776PhosphoserineBy similarity1
Modified residuei887Phosphothreonine1 Publication1

Keywords - PTMi

Methylation, Phosphoprotein

Proteomic databases

MaxQBiO14607.
PaxDbiO14607.
PeptideAtlasiO14607.
PRIDEiO14607.
TopDownProteomicsiO14607-2. [O14607-2]

PTM databases

iPTMnetiO14607.
PhosphoSitePlusiO14607.

Expressioni

Gene expression databases

BgeeiENSG00000183878.
CleanExiHS_UTY.
ExpressionAtlasiO14607. baseline and differential.
GenevisibleiO14607. HS.

Organism-specific databases

HPAiHPA000568.
HPA001165.

Interactioni

Subunit structurei

Interacts with TLE1 and TLE2.By similarity

Protein-protein interaction databases

BioGridi113247. 6 interactors.
DIPiDIP-48650N.
IntActiO14607. 1 interactor.
STRINGi9606.ENSP00000328939.

Structurei

Secondary structure

11347
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi881 – 883Combined sources3
Beta strandi889 – 891Combined sources3
Helixi895 – 899Combined sources5
Helixi901 – 908Combined sources8
Beta strandi913 – 918Combined sources6
Helixi920 – 924Combined sources5
Helixi928 – 931Combined sources4
Helixi933 – 940Combined sources8
Beta strandi944 – 951Combined sources8
Beta strandi963 – 966Combined sources4
Beta strandi972 – 978Combined sources7
Helixi979 – 997Combined sources19
Beta strandi1028 – 1036Combined sources9
Turni1040 – 1042Combined sources3
Helixi1044 – 1049Combined sources6
Helixi1050 – 1052Combined sources3
Helixi1055 – 1057Combined sources3
Beta strandi1058 – 1060Combined sources3
Helixi1065 – 1068Combined sources4
Beta strandi1069 – 1071Combined sources3
Turni1074 – 1076Combined sources3
Beta strandi1080 – 1084Combined sources5
Beta strandi1089 – 1093Combined sources5
Helixi1096 – 1098Combined sources3
Beta strandi1100 – 1109Combined sources10
Beta strandi1111 – 1116Combined sources6
Helixi1118 – 1120Combined sources3
Helixi1121 – 1130Combined sources10
Turni1135 – 1137Combined sources3
Helixi1144 – 1149Combined sources6
Beta strandi1155 – 1159Combined sources5
Beta strandi1164 – 1167Combined sources4
Beta strandi1172 – 1188Combined sources17
Beta strandi1190 – 1192Combined sources3
Helixi1193 – 1208Combined sources16
Helixi1217 – 1227Combined sources11
Helixi1233 – 1259Combined sources27
Beta strandi1264 – 1266Combined sources3
Turni1279 – 1281Combined sources3
Beta strandi1287 – 1292Combined sources6
Helixi1293 – 1297Combined sources5
Helixi1306 – 1312Combined sources7
Beta strandi1319 – 1325Combined sources7
Helixi1327 – 1335Combined sources9

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3ZLIX-ray1.80A/B878-1347[»]
3ZPOX-ray2.00A/B878-1347[»]
4UF0X-ray1.78A/B878-1347[»]
5A1LX-ray2.00A/B878-1347[»]
5FXVX-ray1.91A/B878-1347[»]
5FXWX-ray2.09A/B878-1347[»]
5FXXX-ray1.99A/B878-1347[»]
5FXZX-ray1.98A/B878-1347[»]
5FY0X-ray2.14A/B878-1347[»]
5FY1X-ray1.78A/B878-1347[»]
5FY7X-ray1.86A/B878-1347[»]
5FYMX-ray2.00A/B878-1347[»]
ProteinModelPortaliO14607.
SMRiO14607.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati90 – 123TPR 1Add BLAST34
Repeati127 – 160TPR 2Add BLAST34
Repeati167 – 196TPR 3Add BLAST30
Repeati202 – 235TPR 4Add BLAST34
Repeati247 – 280TPR 5Add BLAST34
Repeati281 – 314TPR 6Add BLAST34
Repeati315 – 348TPR 7Add BLAST34
Repeati349 – 382TPR 8Add BLAST34
Domaini1042 – 1205JmjCPROSITE-ProRule annotationAdd BLAST164

Sequence similaritiesi

Belongs to the UTX family.Curated
Contains 1 JmjC domain.PROSITE-ProRule annotation
Contains 8 TPR repeats.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, TPR repeat

Phylogenomic databases

eggNOGiKOG1124. Eukaryota.
KOG1246. Eukaryota.
COG0457. LUCA.
GeneTreeiENSGT00410000025758.
HOGENOMiHOG000220834.
HOVERGENiHBG018063.
InParanoidiO14607.
KOiK11447.
PhylomeDBiO14607.
TreeFamiTF317405.

Family and domain databases

Gene3Di1.25.40.10. 1 hit.
InterProiIPR003347. JmjC_dom.
IPR029516. KDM6C.
IPR013026. TPR-contain_dom.
IPR011990. TPR-like_helical_dom.
IPR019734. TPR_repeat.
[Graphical view]
PANTHERiPTHR14017:SF17. PTHR14017:SF17. 2 hits.
PfamiPF02373. JmjC. 1 hit.
PF13181. TPR_8. 1 hit.
[Graphical view]
SMARTiSM00558. JmjC. 1 hit.
SM00028. TPR. 7 hits.
[Graphical view]
SUPFAMiSSF48452. SSF48452. 3 hits.
PROSITEiPS51184. JMJC. 1 hit.
PS50005. TPR. 7 hits.
PS50293. TPR_REGION. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.
Isoform 1 (identifier: O14607-1) [UniParc]FASTAAdd to basket
Also known as: Long

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKSCAVSLTT AAVAFGDEAK KMAEGKASRE SEEESVSLTV EEREALGGMD
60 70 80 90 100
SRLFGFVRLH EDGARTKTLL GKAVRCYESL ILKAEGKVES DFFCQLGHFN
110 120 130 140 150
LLLEDYSKAL SAYQRYYSLQ ADYWKNAAFL YGLGLVYFYY NAFHWAIKAF
160 170 180 190 200
QDVLYVDPSF CRAKEIHLRL GLMFKVNTDY KSSLKHFQLA LIDCNPCTLS
210 220 230 240 250
NAEIQFHIAH LYETQRKYHS AKEAYEQLLQ TENLPAQVKA TVLQQLGWMH
260 270 280 290 300
HNMDLVGDKA TKESYAIQYL QKSLEADPNS GQSWYFLGRC YSSIGKVQDA
310 320 330 340 350
FISYRQSIDK SEASADTWCS IGVLYQQQNQ PMDALQAYIC AVQLDHGHAA
360 370 380 390 400
AWMDLGTLYE SCNQPQDAIK CYLNAARSKR CSNTSTLAAR IKFLQNGSDN
410 420 430 440 450
WNGGQSLSHH PVQQVYSLCL TPQKLQHLEQ LRANRDNLNP AQKHQLEQLE
460 470 480 490 500
SQFVLMQQMR HKEVAQVRTT GIHNGAITDS SLPTNSVSNR QPHGALTRVS
510 520 530 540 550
SVSQPGVRPA CVEKLLSSGA FSAGCIPCGT SKILGSTDTI LLGSNCIAGS
560 570 580 590 600
ESNGNVPYLQ QNTHTLPHNH TDLNSSTEEP WRKQLSNSAQ GLHKSQSSCL
610 620 630 640 650
SGPNEEQPLF STGSAQYHQA TSTGIKKANE HLTLPSNSVP QGDADSHLSC
660 670 680 690 700
HTATSGGQQG IMFTKESKPS KNRSLVPETS RHTGDTSNGC ADVKGLSNHV
710 720 730 740 750
HQLIADAVSS PNHGDSPNLL IADNPQLSAL LIGKANGNVG TGTCDKVNNI
760 770 780 790 800
HPAVHTKTDH SVASSPSSAI STATPSPKST EQRSINSVTS LNSPHSGLHT
810 820 830 840 850
VNGEGLGKSQ SSTKVDLPLA SHRSTSQILP SMSVSICPSS TEVLKACRNP
860 870 880 890 900
GKNGLSNSCI LLDKCPPPRP PTSPYPPLPK DKLNPPTPSI YLENKRDAFF
910 920 930 940 950
PPLHQFCTNP KNPVTVIRGL AGALKLDLGL FSTKTLVEAN NEHMVEVRTQ
960 970 980 990 1000
LLQPADENWD PTGTKKIWRC ESNRSHTTIA KYAQYQASSF QESLREENEK
1010 1020 1030 1040 1050
RTQHKDHSDN ESTSSENSGR RRKGPFKTIK FGTNIDLSDN KKWKLQLHEL
1060 1070 1080 1090 1100
TKLPAFARVV SAGNLLTHVG HTILGMNTVQ LYMKVPGSRT PGHQENNNFC
1110 1120 1130 1140 1150
SVNINIGPGD CEWFVVPEDY WGVLNDFCEK NNLNFLMSSW WPNLEDLYEA
1160 1170 1180 1190 1200
NVPVYRFIQR PGDLVWINAG TVHWVQAVGW CNNIAWNVGP LTACQYKLAV
1210 1220 1230 1240 1250
ERYEWNKLKS VKSPVPMVHL SWNMARNIKV SDPKLFEMIK YCLLKILKQY
1260 1270 1280 1290 1300
QTLREALVAA GKEVIWHGRT NDEPAHYCSI CEVEVFNLLF VTNESNTQKT
1310 1320 1330 1340
YIVHCHDCAR KTSKSLENFV VLEQYKMEDL IQVYDQFTLA LSLSSSS
Length:1,347
Mass (Da):149,548
Last modified:April 14, 2009 - v2
Checksum:iD83B8CAB861BCE60
GO
Isoform 2 (identifier: O14607-2) [UniParc]FASTAAdd to basket
Also known as: Short

The sequence of this isoform differs from the canonical sequence as follows:
     996-1079: EENEKRTQHK...GHTILGMNTV → AGMQWCDLSS...GITGVSHHAR
     1080-1347: Missing.

Show »
Length:1,079
Mass (Da):118,074
Checksum:iB48FF0FAFFED5998
GO
Isoform 3 (identifier: O14607-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1241-1347: Missing.

Show »
Length:1,240
Mass (Da):137,213
Checksum:i38B414FFA5AC7C07
GO
Isoform 4 (identifier: O14607-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     394-394: L → LQAQLCNLPQSSLQNKTKLLPSIEEAWSLPIPAELTSRQGAMNTAQ

Show »
Length:1,392
Mass (Da):154,437
Checksum:iF49723B217462AD0
GO
Isoform 5 (identifier: O14607-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     394-394: L → LQAQLCNLPQSSLQNKTKLLPSIEEAWSLPIPAELTSRQGAMNTAQ
     465-588: Missing.
     1283-1339: Missing.

Show »
Length:1,211
Mass (Da):134,762
Checksum:iC429C9E257FD074A
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti81I → L in ABA25871 (Ref. 2) Curated1
Sequence conflicti86G → R in ABA25870 (Ref. 2) Curated1
Sequence conflicti122D → G in ABA25870 (Ref. 2) Curated1
Sequence conflicti218Y → C in ABA25871 (Ref. 2) Curated1
Sequence conflicti297V → A in ABA25870 (Ref. 2) Curated1
Sequence conflicti301F → S in BAF85547 (PubMed:14702039).Curated1
Sequence conflicti302I → V in ABA25870 (Ref. 2) Curated1
Sequence conflicti372Y → H in ABA25870 (Ref. 2) Curated1
Sequence conflicti431L → P in ABA25870 (Ref. 2) Curated1
Sequence conflicti625I → T in BAF85547 (PubMed:14702039).Curated1
Sequence conflicti644A → V in ABA25870 (Ref. 2) Curated1
Sequence conflicti793S → R in ABA25871 (Ref. 2) Curated1
Sequence conflicti1177A → T in AAC51841 (PubMed:9381176).Curated1
Sequence conflicti1177A → T in AAC51842 (PubMed:9381176).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_045611394L → LQAQLCNLPQSSLQNKTKLL PSIEEAWSLPIPAELTSRQG AMNTAQ in isoform 4 and isoform 5. 1 Publication1
Alternative sequenceiVSP_045612465 – 588Missing in isoform 5. 1 PublicationAdd BLAST124
Alternative sequenceiVSP_006556996 – 1079EENEK…GMNTV → AGMQWCDLSSLQPPPPGFKR FSHLSLPNSWNYRHLPSCPT NFCIFVETGFHHVGQACLEL LTSGGLLASASQSAGITGVS HHAR in isoform 2. 2 PublicationsAdd BLAST84
Alternative sequenceiVSP_0367831080 – 1347Missing in isoform 2. 2 PublicationsAdd BLAST268
Alternative sequenceiVSP_0367841241 – 1347Missing in isoform 3. 1 PublicationAdd BLAST107
Alternative sequenceiVSP_0456131283 – 1339Missing in isoform 5. 1 PublicationAdd BLAST57

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF000994 mRNA. Translation: AAC51841.1.
AF000995 mRNA. Translation: AAC51842.1.
AF000996 mRNA. Translation: AAC51843.1.
DQ140389 mRNA. Translation: ABA25870.1.
DQ140390 mRNA. Translation: ABA25871.1.
AK292858 mRNA. Translation: BAF85547.1.
AC005820 Genomic DNA. No translation available.
AC006376 Genomic DNA. No translation available.
AC010877 Genomic DNA. No translation available.
CCDSiCCDS14783.1. [O14607-1]
CCDS14784.1. [O14607-3]
CCDS14785.1. [O14607-2]
CCDS59184.1. [O14607-4]
CCDS59185.1. [O14607-5]
PIRiT02214.
RefSeqiNP_001245181.1. NM_001258252.1. [O14607-4]
NP_001245183.1. NM_001258254.1. [O14607-5]
NP_009056.3. NM_007125.4. [O14607-1]
NP_872600.1. NM_182659.1. [O14607-3]
NP_872601.1. NM_182660.1. [O14607-2]
UniGeneiHs.115277.

Genome annotation databases

EnsembliENST00000329134; ENSP00000330446; ENSG00000183878. [O14607-2]
ENST00000331397; ENSP00000328939; ENSG00000183878. [O14607-1]
ENST00000362096; ENSP00000355420; ENSG00000183878. [O14607-3]
ENST00000382896; ENSP00000372352; ENSG00000183878. [O14607-4]
ENST00000624098; ENSP00000485539; ENSG00000183878. [O14607-5]
GeneIDi7404.
KEGGihsa:7404.
UCSCiuc004fsx.3. human. [O14607-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF000994 mRNA. Translation: AAC51841.1.
AF000995 mRNA. Translation: AAC51842.1.
AF000996 mRNA. Translation: AAC51843.1.
DQ140389 mRNA. Translation: ABA25870.1.
DQ140390 mRNA. Translation: ABA25871.1.
AK292858 mRNA. Translation: BAF85547.1.
AC005820 Genomic DNA. No translation available.
AC006376 Genomic DNA. No translation available.
AC010877 Genomic DNA. No translation available.
CCDSiCCDS14783.1. [O14607-1]
CCDS14784.1. [O14607-3]
CCDS14785.1. [O14607-2]
CCDS59184.1. [O14607-4]
CCDS59185.1. [O14607-5]
PIRiT02214.
RefSeqiNP_001245181.1. NM_001258252.1. [O14607-4]
NP_001245183.1. NM_001258254.1. [O14607-5]
NP_009056.3. NM_007125.4. [O14607-1]
NP_872600.1. NM_182659.1. [O14607-3]
NP_872601.1. NM_182660.1. [O14607-2]
UniGeneiHs.115277.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3ZLIX-ray1.80A/B878-1347[»]
3ZPOX-ray2.00A/B878-1347[»]
4UF0X-ray1.78A/B878-1347[»]
5A1LX-ray2.00A/B878-1347[»]
5FXVX-ray1.91A/B878-1347[»]
5FXWX-ray2.09A/B878-1347[»]
5FXXX-ray1.99A/B878-1347[»]
5FXZX-ray1.98A/B878-1347[»]
5FY0X-ray2.14A/B878-1347[»]
5FY1X-ray1.78A/B878-1347[»]
5FY7X-ray1.86A/B878-1347[»]
5FYMX-ray2.00A/B878-1347[»]
ProteinModelPortaliO14607.
SMRiO14607.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi113247. 6 interactors.
DIPiDIP-48650N.
IntActiO14607. 1 interactor.
STRINGi9606.ENSP00000328939.

PTM databases

iPTMnetiO14607.
PhosphoSitePlusiO14607.

Polymorphism and mutation databases

BioMutaiUTY.

Proteomic databases

MaxQBiO14607.
PaxDbiO14607.
PeptideAtlasiO14607.
PRIDEiO14607.
TopDownProteomicsiO14607-2. [O14607-2]

Protocols and materials databases

DNASUi7404.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000329134; ENSP00000330446; ENSG00000183878. [O14607-2]
ENST00000331397; ENSP00000328939; ENSG00000183878. [O14607-1]
ENST00000362096; ENSP00000355420; ENSG00000183878. [O14607-3]
ENST00000382896; ENSP00000372352; ENSG00000183878. [O14607-4]
ENST00000624098; ENSP00000485539; ENSG00000183878. [O14607-5]
GeneIDi7404.
KEGGihsa:7404.
UCSCiuc004fsx.3. human. [O14607-1]

Organism-specific databases

CTDi7404.
DisGeNETi7404.
GeneCardsiUTY.
H-InvDBHIX0056663.
HGNCiHGNC:12638. UTY.
HPAiHPA000568.
HPA001165.
MIMi400009. gene.
neXtProtiNX_O14607.
OpenTargetsiENSG00000183878.
PharmGKBiPA37263.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1124. Eukaryota.
KOG1246. Eukaryota.
COG0457. LUCA.
GeneTreeiENSGT00410000025758.
HOGENOMiHOG000220834.
HOVERGENiHBG018063.
InParanoidiO14607.
KOiK11447.
PhylomeDBiO14607.
TreeFamiTF317405.

Enzyme and pathway databases

ReactomeiR-HSA-3214842. HDMs demethylate histones.

Miscellaneous databases

ChiTaRSiUTY. human.
GeneWikiiUTY_(gene).
GenomeRNAii7404.
PROiO14607.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000183878.
CleanExiHS_UTY.
ExpressionAtlasiO14607. baseline and differential.
GenevisibleiO14607. HS.

Family and domain databases

Gene3Di1.25.40.10. 1 hit.
InterProiIPR003347. JmjC_dom.
IPR029516. KDM6C.
IPR013026. TPR-contain_dom.
IPR011990. TPR-like_helical_dom.
IPR019734. TPR_repeat.
[Graphical view]
PANTHERiPTHR14017:SF17. PTHR14017:SF17. 2 hits.
PfamiPF02373. JmjC. 1 hit.
PF13181. TPR_8. 1 hit.
[Graphical view]
SMARTiSM00558. JmjC. 1 hit.
SM00028. TPR. 7 hits.
[Graphical view]
SUPFAMiSSF48452. SSF48452. 3 hits.
PROSITEiPS51184. JMJC. 1 hit.
PS50005. TPR. 7 hits.
PS50293. TPR_REGION. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiUTY_HUMAN
AccessioniPrimary (citable) accession number: O14607
Secondary accession number(s): A8K9Z3
, E1U199, E1U1A0, F5H4V7, F8W8R7, O14608
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: April 14, 2009
Last modified: November 2, 2016
This is version 155 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome Y
    Human chromosome Y: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.