SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O14607

- UTY_HUMAN

UniProt

O14607 - UTY_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Histone demethylase UTY

Gene
UTY
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at protein leveli

Functioni

Histone demethylase By similarity.

Cofactori

Ascorbate By similarity.
Fe2+ By similarity.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi1093 – 10931Iron By similarity
Metal bindingi1095 – 10951Iron By similarity

GO - Molecular functioni

  1. histone demethylase activity (H3-K36 specific) Source: Ensembl
  2. metal ion binding Source: UniProtKB-KW
  3. RNA polymerase II core promoter proximal region sequence-specific DNA binding Source: Ensembl

GO - Biological processi

  1. canonical Wnt signaling pathway Source: Ensembl
  2. cardiac muscle cell contraction Source: Ensembl
  3. establishment of protein localization Source: Ensembl
  4. heart development Source: Ensembl
  5. in utero embryonic development Source: Ensembl
  6. regulation of chromatin silencing Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Chromatin regulator, Dioxygenase, Oxidoreductase

Keywords - Ligandi

Iron, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Histone demethylase UTY (EC:1.14.11.-)
Alternative name(s):
Ubiquitously-transcribed TPR protein on the Y chromosome
Ubiquitously-transcribed Y chromosome tetratricopeptide repeat protein
Gene namesi
Name:UTY
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome Y

Organism-specific databases

HGNCiHGNC:12638. UTY.

Subcellular locationi

Nucleus Reviewed prediction

GO - Cellular componenti

  1. nucleus Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA37263.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 13471347Histone demethylase UTYPRO_0000106411Add
BLAST

Proteomic databases

MaxQBiO14607.
PaxDbiO14607.
PRIDEiO14607.

PTM databases

PhosphoSiteiO14607.

Expressioni

Gene expression databases

ArrayExpressiO14607.
BgeeiO14607.
CleanExiHS_UTY.
GenevestigatoriO14607.

Organism-specific databases

HPAiHPA000568.
HPA001165.
HPA002111.

Interactioni

Subunit structurei

Interacts with TLE1 and TLE2 By similarity.

Protein-protein interaction databases

BioGridi113247. 4 interactions.
DIPiDIP-48650N.
IntActiO14607. 1 interaction.
STRINGi9606.ENSP00000328939.

Structurei

Secondary structure

1
1347
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi881 – 8833
Beta strandi889 – 8913
Helixi895 – 8995
Helixi901 – 9088
Beta strandi913 – 9186
Helixi920 – 9245
Helixi928 – 9314
Helixi933 – 9397
Beta strandi944 – 9518
Beta strandi963 – 9664
Beta strandi972 – 9787
Helixi979 – 99719
Beta strandi1028 – 10369
Turni1040 – 10423
Helixi1044 – 10507
Helixi1055 – 10573
Beta strandi1058 – 10603
Helixi1065 – 10684
Turni1074 – 10763
Beta strandi1080 – 10845
Beta strandi1089 – 10935
Helixi1096 – 10983
Beta strandi1100 – 110910
Beta strandi1111 – 11166
Helixi1118 – 11203
Helixi1121 – 113010
Turni1135 – 11373
Helixi1144 – 11496
Beta strandi1155 – 11595
Beta strandi1164 – 11674
Beta strandi1172 – 118817
Beta strandi1190 – 11923
Helixi1193 – 120816
Helixi1217 – 122711
Helixi1233 – 125927
Beta strandi1264 – 12663
Turni1279 – 12813
Beta strandi1287 – 12926
Helixi1293 – 12975
Helixi1306 – 13127
Beta strandi1319 – 13257
Helixi1327 – 13359

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3ZLIX-ray1.80A/B878-1347[»]
3ZPOX-ray2.00A/B878-1347[»]
ProteinModelPortaliO14607.
SMRiO14607. Positions 131-375, 833-1344.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati90 – 12334TPR 1Add
BLAST
Repeati127 – 16034TPR 2Add
BLAST
Repeati167 – 19630TPR 3Add
BLAST
Repeati202 – 23534TPR 4Add
BLAST
Repeati247 – 28034TPR 5Add
BLAST
Repeati281 – 31434TPR 6Add
BLAST
Repeati315 – 34834TPR 7Add
BLAST
Repeati349 – 38234TPR 8Add
BLAST
Domaini1042 – 1205164JmjCAdd
BLAST

Sequence similaritiesi

Belongs to the UTX family.
Contains 1 JmjC domain.
Contains 8 TPR repeats.

Keywords - Domaini

Repeat, TPR repeat

Phylogenomic databases

eggNOGiCOG0457.
HOGENOMiHOG000220834.
HOVERGENiHBG018063.
KOiK11447.
OMAiNCIAGSE.
OrthoDBiEOG7CG6Z5.
PhylomeDBiO14607.
TreeFamiTF317405.

Family and domain databases

Gene3Di1.25.40.10. 1 hit.
InterProiIPR003347. JmjC_dom.
IPR029516. KDM6C.
IPR013026. TPR-contain_dom.
IPR011990. TPR-like_helical.
IPR001440. TPR_1.
IPR019734. TPR_repeat.
[Graphical view]
PANTHERiPTHR14017:SF17. PTHR14017:SF17. 1 hit.
PfamiPF02373. JmjC. 1 hit.
PF00515. TPR_1. 3 hits.
PF13181. TPR_8. 1 hit.
[Graphical view]
SMARTiSM00558. JmjC. 1 hit.
SM00028. TPR. 6 hits.
[Graphical view]
PROSITEiPS51184. JMJC. 1 hit.
PS50005. TPR. 7 hits.
PS50293. TPR_REGION. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Note: Additional isoforms seem to exist.

Isoform 1 (identifier: O14607-1) [UniParc]FASTAAdd to Basket

Also known as: Long

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MKSCAVSLTT AAVAFGDEAK KMAEGKASRE SEEESVSLTV EEREALGGMD     50
SRLFGFVRLH EDGARTKTLL GKAVRCYESL ILKAEGKVES DFFCQLGHFN 100
LLLEDYSKAL SAYQRYYSLQ ADYWKNAAFL YGLGLVYFYY NAFHWAIKAF 150
QDVLYVDPSF CRAKEIHLRL GLMFKVNTDY KSSLKHFQLA LIDCNPCTLS 200
NAEIQFHIAH LYETQRKYHS AKEAYEQLLQ TENLPAQVKA TVLQQLGWMH 250
HNMDLVGDKA TKESYAIQYL QKSLEADPNS GQSWYFLGRC YSSIGKVQDA 300
FISYRQSIDK SEASADTWCS IGVLYQQQNQ PMDALQAYIC AVQLDHGHAA 350
AWMDLGTLYE SCNQPQDAIK CYLNAARSKR CSNTSTLAAR IKFLQNGSDN 400
WNGGQSLSHH PVQQVYSLCL TPQKLQHLEQ LRANRDNLNP AQKHQLEQLE 450
SQFVLMQQMR HKEVAQVRTT GIHNGAITDS SLPTNSVSNR QPHGALTRVS 500
SVSQPGVRPA CVEKLLSSGA FSAGCIPCGT SKILGSTDTI LLGSNCIAGS 550
ESNGNVPYLQ QNTHTLPHNH TDLNSSTEEP WRKQLSNSAQ GLHKSQSSCL 600
SGPNEEQPLF STGSAQYHQA TSTGIKKANE HLTLPSNSVP QGDADSHLSC 650
HTATSGGQQG IMFTKESKPS KNRSLVPETS RHTGDTSNGC ADVKGLSNHV 700
HQLIADAVSS PNHGDSPNLL IADNPQLSAL LIGKANGNVG TGTCDKVNNI 750
HPAVHTKTDH SVASSPSSAI STATPSPKST EQRSINSVTS LNSPHSGLHT 800
VNGEGLGKSQ SSTKVDLPLA SHRSTSQILP SMSVSICPSS TEVLKACRNP 850
GKNGLSNSCI LLDKCPPPRP PTSPYPPLPK DKLNPPTPSI YLENKRDAFF 900
PPLHQFCTNP KNPVTVIRGL AGALKLDLGL FSTKTLVEAN NEHMVEVRTQ 950
LLQPADENWD PTGTKKIWRC ESNRSHTTIA KYAQYQASSF QESLREENEK 1000
RTQHKDHSDN ESTSSENSGR RRKGPFKTIK FGTNIDLSDN KKWKLQLHEL 1050
TKLPAFARVV SAGNLLTHVG HTILGMNTVQ LYMKVPGSRT PGHQENNNFC 1100
SVNINIGPGD CEWFVVPEDY WGVLNDFCEK NNLNFLMSSW WPNLEDLYEA 1150
NVPVYRFIQR PGDLVWINAG TVHWVQAVGW CNNIAWNVGP LTACQYKLAV 1200
ERYEWNKLKS VKSPVPMVHL SWNMARNIKV SDPKLFEMIK YCLLKILKQY 1250
QTLREALVAA GKEVIWHGRT NDEPAHYCSI CEVEVFNLLF VTNESNTQKT 1300
YIVHCHDCAR KTSKSLENFV VLEQYKMEDL IQVYDQFTLA LSLSSSS 1347
Length:1,347
Mass (Da):149,548
Last modified:April 14, 2009 - v2
Checksum:iD83B8CAB861BCE60
GO
Isoform 2 (identifier: O14607-2) [UniParc]FASTAAdd to Basket

Also known as: Short

The sequence of this isoform differs from the canonical sequence as follows:
     996-1079: EENEKRTQHK...GHTILGMNTV → AGMQWCDLSS...GITGVSHHAR
     1080-1347: Missing.

Show »
Length:1,079
Mass (Da):118,074
Checksum:iB48FF0FAFFED5998
GO
Isoform 3 (identifier: O14607-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1241-1347: Missing.

Show »
Length:1,240
Mass (Da):137,213
Checksum:i38B414FFA5AC7C07
GO
Isoform 4 (identifier: O14607-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     394-394: L → LQAQLCNLPQSSLQNKTKLLPSIEEAWSLPIPAELTSRQGAMNTAQ

Show »
Length:1,392
Mass (Da):154,437
Checksum:iF49723B217462AD0
GO
Isoform 5 (identifier: O14607-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     394-394: L → LQAQLCNLPQSSLQNKTKLLPSIEEAWSLPIPAELTSRQGAMNTAQ
     465-588: Missing.
     1283-1339: Missing.

Show »
Length:1,211
Mass (Da):134,762
Checksum:iC429C9E257FD074A
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei394 – 3941L → LQAQLCNLPQSSLQNKTKLL PSIEEAWSLPIPAELTSRQG AMNTAQ in isoform 4 and isoform 5. VSP_045611
Alternative sequencei465 – 588124Missing in isoform 5. VSP_045612Add
BLAST
Alternative sequencei996 – 107984EENEK…GMNTV → AGMQWCDLSSLQPPPPGFKR FSHLSLPNSWNYRHLPSCPT NFCIFVETGFHHVGQACLEL LTSGGLLASASQSAGITGVS HHAR in isoform 2. VSP_006556Add
BLAST
Alternative sequencei1080 – 1347268Missing in isoform 2. VSP_036783Add
BLAST
Alternative sequencei1241 – 1347107Missing in isoform 3. VSP_036784Add
BLAST
Alternative sequencei1283 – 133957Missing in isoform 5. VSP_045613Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti81 – 811I → L in ABA25871. 1 Publication
Sequence conflicti86 – 861G → R in ABA25870. 1 Publication
Sequence conflicti122 – 1221D → G in ABA25870. 1 Publication
Sequence conflicti218 – 2181Y → C in ABA25871. 1 Publication
Sequence conflicti297 – 2971V → A in ABA25870. 1 Publication
Sequence conflicti301 – 3011F → S in BAF85547. 1 Publication
Sequence conflicti302 – 3021I → V in ABA25870. 1 Publication
Sequence conflicti372 – 3721Y → H in ABA25870. 1 Publication
Sequence conflicti431 – 4311L → P in ABA25870. 1 Publication
Sequence conflicti625 – 6251I → T in BAF85547. 1 Publication
Sequence conflicti644 – 6441A → V in ABA25870. 1 Publication
Sequence conflicti793 – 7931S → R in ABA25871. 1 Publication
Sequence conflicti1177 – 11771A → T in AAC51841. 1 Publication
Sequence conflicti1177 – 11771A → T in AAC51842. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF000994 mRNA. Translation: AAC51841.1.
AF000995 mRNA. Translation: AAC51842.1.
AF000996 mRNA. Translation: AAC51843.1.
DQ140389 mRNA. Translation: ABA25870.1.
DQ140390 mRNA. Translation: ABA25871.1.
AK292858 mRNA. Translation: BAF85547.1.
AC005820 Genomic DNA. No translation available.
AC006376 Genomic DNA. No translation available.
AC010877 Genomic DNA. No translation available.
CCDSiCCDS14783.1. [O14607-1]
CCDS14784.1. [O14607-3]
CCDS14785.1. [O14607-2]
CCDS59184.1. [O14607-4]
CCDS59185.1. [O14607-5]
PIRiT02214.
RefSeqiNP_001245181.1. NM_001258252.1. [O14607-4]
NP_001245183.1. NM_001258254.1. [O14607-5]
NP_009056.3. NM_007125.4. [O14607-1]
NP_872600.1. NM_182659.1. [O14607-3]
NP_872601.1. NM_182660.1. [O14607-2]
UniGeneiHs.115277.

Genome annotation databases

EnsembliENST00000329134; ENSP00000330446; ENSG00000183878. [O14607-2]
ENST00000331397; ENSP00000328939; ENSG00000183878. [O14607-1]
ENST00000362096; ENSP00000355420; ENSG00000183878. [O14607-3]
ENST00000382896; ENSP00000372352; ENSG00000183878. [O14607-4]
ENST00000537580; ENSP00000439922; ENSG00000183878. [O14607-5]
GeneIDi7404.
KEGGihsa:7404.
UCSCiuc004fsw.1. human. [O14607-1]
uc004fsz.3. human. [O14607-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF000994 mRNA. Translation: AAC51841.1 .
AF000995 mRNA. Translation: AAC51842.1 .
AF000996 mRNA. Translation: AAC51843.1 .
DQ140389 mRNA. Translation: ABA25870.1 .
DQ140390 mRNA. Translation: ABA25871.1 .
AK292858 mRNA. Translation: BAF85547.1 .
AC005820 Genomic DNA. No translation available.
AC006376 Genomic DNA. No translation available.
AC010877 Genomic DNA. No translation available.
CCDSi CCDS14783.1. [O14607-1 ]
CCDS14784.1. [O14607-3 ]
CCDS14785.1. [O14607-2 ]
CCDS59184.1. [O14607-4 ]
CCDS59185.1. [O14607-5 ]
PIRi T02214.
RefSeqi NP_001245181.1. NM_001258252.1. [O14607-4 ]
NP_001245183.1. NM_001258254.1. [O14607-5 ]
NP_009056.3. NM_007125.4. [O14607-1 ]
NP_872600.1. NM_182659.1. [O14607-3 ]
NP_872601.1. NM_182660.1. [O14607-2 ]
UniGenei Hs.115277.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
3ZLI X-ray 1.80 A/B 878-1347 [» ]
3ZPO X-ray 2.00 A/B 878-1347 [» ]
ProteinModelPortali O14607.
SMRi O14607. Positions 131-375, 833-1344.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 113247. 4 interactions.
DIPi DIP-48650N.
IntActi O14607. 1 interaction.
STRINGi 9606.ENSP00000328939.

PTM databases

PhosphoSitei O14607.

Proteomic databases

MaxQBi O14607.
PaxDbi O14607.
PRIDEi O14607.

Protocols and materials databases

DNASUi 7404.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000329134 ; ENSP00000330446 ; ENSG00000183878 . [O14607-2 ]
ENST00000331397 ; ENSP00000328939 ; ENSG00000183878 . [O14607-1 ]
ENST00000362096 ; ENSP00000355420 ; ENSG00000183878 . [O14607-3 ]
ENST00000382896 ; ENSP00000372352 ; ENSG00000183878 . [O14607-4 ]
ENST00000537580 ; ENSP00000439922 ; ENSG00000183878 . [O14607-5 ]
GeneIDi 7404.
KEGGi hsa:7404.
UCSCi uc004fsw.1. human. [O14607-1 ]
uc004fsz.3. human. [O14607-2 ]

Organism-specific databases

CTDi 7404.
GeneCardsi GC0YM015360.
H-InvDB HIX0056663.
HGNCi HGNC:12638. UTY.
HPAi HPA000568.
HPA001165.
HPA002111.
MIMi 400009. gene.
neXtProti NX_O14607.
PharmGKBi PA37263.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0457.
HOGENOMi HOG000220834.
HOVERGENi HBG018063.
KOi K11447.
OMAi NCIAGSE.
OrthoDBi EOG7CG6Z5.
PhylomeDBi O14607.
TreeFami TF317405.

Miscellaneous databases

GeneWikii UTY_(gene).
GenomeRNAii 7404.
NextBioi 28984.
PROi O14607.
SOURCEi Search...

Gene expression databases

ArrayExpressi O14607.
Bgeei O14607.
CleanExi HS_UTY.
Genevestigatori O14607.

Family and domain databases

Gene3Di 1.25.40.10. 1 hit.
InterProi IPR003347. JmjC_dom.
IPR029516. KDM6C.
IPR013026. TPR-contain_dom.
IPR011990. TPR-like_helical.
IPR001440. TPR_1.
IPR019734. TPR_repeat.
[Graphical view ]
PANTHERi PTHR14017:SF17. PTHR14017:SF17. 1 hit.
Pfami PF02373. JmjC. 1 hit.
PF00515. TPR_1. 3 hits.
PF13181. TPR_8. 1 hit.
[Graphical view ]
SMARTi SM00558. JmjC. 1 hit.
SM00028. TPR. 6 hits.
[Graphical view ]
PROSITEi PS51184. JMJC. 1 hit.
PS50005. TPR. 7 hits.
PS50293. TPR_REGION. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Functional coherence of the human Y chromosome."
    Lahn B.T., Page D.C.
    Science 278:675-680(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3).
  2. "Characterization of the human UTY gene."
    Laaser I., Kolb H.J., Adamski J.
    Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 4 AND 5).
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Trachea.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides."
    Gevaert K., Goethals M., Martens L., Van Damme J., Staes A., Thomas G.R., Vandekerckhove J.
    Nat. Biotechnol. 21:566-569(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 461-468.
    Tissue: Platelet.

Entry informationi

Entry nameiUTY_HUMAN
AccessioniPrimary (citable) accession number: O14607
Secondary accession number(s): A8K9Z3
, E1U199, E1U1A0, F5H4V7, F8W8R7, O14608
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: April 14, 2009
Last modified: September 3, 2014
This is version 132 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome Y
    Human chromosome Y: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi