Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O14607

- UTY_HUMAN

UniProt

O14607 - UTY_HUMAN

Protein

Histone demethylase UTY

Gene

UTY

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 133 (01 Oct 2014)
      Sequence version 2 (14 Apr 2009)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Histone demethylase.By similarity

    Cofactori

    Ascorbate.By similarity
    Fe2+.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Metal bindingi1093 – 10931IronBy similarity
    Metal bindingi1095 – 10951IronBy similarity

    GO - Molecular functioni

    1. histone demethylase activity (H3-K36 specific) Source: Ensembl
    2. metal ion binding Source: UniProtKB-KW
    3. RNA polymerase II core promoter proximal region sequence-specific DNA binding Source: Ensembl

    GO - Biological processi

    1. canonical Wnt signaling pathway Source: Ensembl
    2. cardiac muscle cell contraction Source: Ensembl
    3. establishment of protein localization Source: Ensembl
    4. heart development Source: Ensembl
    5. in utero embryonic development Source: Ensembl
    6. regulation of chromatin silencing Source: Ensembl

    Keywords - Molecular functioni

    Chromatin regulator, Dioxygenase, Oxidoreductase

    Keywords - Ligandi

    Iron, Metal-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Histone demethylase UTY (EC:1.14.11.-)
    Alternative name(s):
    Ubiquitously-transcribed TPR protein on the Y chromosome
    Ubiquitously-transcribed Y chromosome tetratricopeptide repeat protein
    Gene namesi
    Name:UTY
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome Y

    Organism-specific databases

    HGNCiHGNC:12638. UTY.

    Subcellular locationi

    Nucleus Curated

    GO - Cellular componenti

    1. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA37263.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 13471347Histone demethylase UTYPRO_0000106411Add
    BLAST

    Proteomic databases

    MaxQBiO14607.
    PaxDbiO14607.
    PRIDEiO14607.

    PTM databases

    PhosphoSiteiO14607.

    Expressioni

    Gene expression databases

    ArrayExpressiO14607.
    BgeeiO14607.
    CleanExiHS_UTY.
    GenevestigatoriO14607.

    Organism-specific databases

    HPAiHPA000568.
    HPA001165.
    HPA002111.

    Interactioni

    Subunit structurei

    Interacts with TLE1 and TLE2.By similarity

    Protein-protein interaction databases

    BioGridi113247. 4 interactions.
    DIPiDIP-48650N.
    IntActiO14607. 1 interaction.
    STRINGi9606.ENSP00000328939.

    Structurei

    Secondary structure

    1
    1347
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi881 – 8833
    Beta strandi889 – 8913
    Helixi895 – 8995
    Helixi901 – 9088
    Beta strandi913 – 9186
    Helixi920 – 9245
    Helixi928 – 9314
    Helixi933 – 9397
    Beta strandi944 – 9518
    Beta strandi963 – 9664
    Beta strandi972 – 9787
    Helixi979 – 99719
    Beta strandi1028 – 10369
    Turni1040 – 10423
    Helixi1044 – 10507
    Helixi1055 – 10573
    Beta strandi1058 – 10603
    Helixi1065 – 10684
    Turni1074 – 10763
    Beta strandi1080 – 10845
    Beta strandi1089 – 10935
    Helixi1096 – 10983
    Beta strandi1100 – 110910
    Beta strandi1111 – 11166
    Helixi1118 – 11203
    Helixi1121 – 113010
    Turni1135 – 11373
    Helixi1144 – 11496
    Beta strandi1155 – 11595
    Beta strandi1164 – 11674
    Beta strandi1172 – 118817
    Beta strandi1190 – 11923
    Helixi1193 – 120816
    Helixi1217 – 122711
    Helixi1233 – 125927
    Beta strandi1264 – 12663
    Turni1279 – 12813
    Beta strandi1287 – 12926
    Helixi1293 – 12975
    Helixi1306 – 13127
    Beta strandi1319 – 13257
    Helixi1327 – 13359

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    3ZLIX-ray1.80A/B878-1347[»]
    3ZPOX-ray2.00A/B878-1347[»]
    ProteinModelPortaliO14607.
    SMRiO14607. Positions 131-375, 833-1344.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati90 – 12334TPR 1Add
    BLAST
    Repeati127 – 16034TPR 2Add
    BLAST
    Repeati167 – 19630TPR 3Add
    BLAST
    Repeati202 – 23534TPR 4Add
    BLAST
    Repeati247 – 28034TPR 5Add
    BLAST
    Repeati281 – 31434TPR 6Add
    BLAST
    Repeati315 – 34834TPR 7Add
    BLAST
    Repeati349 – 38234TPR 8Add
    BLAST
    Domaini1042 – 1205164JmjCPROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Belongs to the UTX family.Curated
    Contains 1 JmjC domain.PROSITE-ProRule annotation
    Contains 8 TPR repeats.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat, TPR repeat

    Phylogenomic databases

    eggNOGiCOG0457.
    HOGENOMiHOG000220834.
    HOVERGENiHBG018063.
    KOiK11447.
    OMAiNCIAGSE.
    OrthoDBiEOG7CG6Z5.
    PhylomeDBiO14607.
    TreeFamiTF317405.

    Family and domain databases

    Gene3Di1.25.40.10. 1 hit.
    InterProiIPR003347. JmjC_dom.
    IPR029516. KDM6C.
    IPR013026. TPR-contain_dom.
    IPR011990. TPR-like_helical.
    IPR001440. TPR_1.
    IPR019734. TPR_repeat.
    [Graphical view]
    PANTHERiPTHR14017:SF17. PTHR14017:SF17. 1 hit.
    PfamiPF02373. JmjC. 1 hit.
    PF00515. TPR_1. 3 hits.
    PF13181. TPR_8. 1 hit.
    [Graphical view]
    SMARTiSM00558. JmjC. 1 hit.
    SM00028. TPR. 6 hits.
    [Graphical view]
    PROSITEiPS51184. JMJC. 1 hit.
    PS50005. TPR. 7 hits.
    PS50293. TPR_REGION. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Note: Additional isoforms seem to exist.

    Isoform 1 (identifier: O14607-1) [UniParc]FASTAAdd to Basket

    Also known as: Long

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MKSCAVSLTT AAVAFGDEAK KMAEGKASRE SEEESVSLTV EEREALGGMD     50
    SRLFGFVRLH EDGARTKTLL GKAVRCYESL ILKAEGKVES DFFCQLGHFN 100
    LLLEDYSKAL SAYQRYYSLQ ADYWKNAAFL YGLGLVYFYY NAFHWAIKAF 150
    QDVLYVDPSF CRAKEIHLRL GLMFKVNTDY KSSLKHFQLA LIDCNPCTLS 200
    NAEIQFHIAH LYETQRKYHS AKEAYEQLLQ TENLPAQVKA TVLQQLGWMH 250
    HNMDLVGDKA TKESYAIQYL QKSLEADPNS GQSWYFLGRC YSSIGKVQDA 300
    FISYRQSIDK SEASADTWCS IGVLYQQQNQ PMDALQAYIC AVQLDHGHAA 350
    AWMDLGTLYE SCNQPQDAIK CYLNAARSKR CSNTSTLAAR IKFLQNGSDN 400
    WNGGQSLSHH PVQQVYSLCL TPQKLQHLEQ LRANRDNLNP AQKHQLEQLE 450
    SQFVLMQQMR HKEVAQVRTT GIHNGAITDS SLPTNSVSNR QPHGALTRVS 500
    SVSQPGVRPA CVEKLLSSGA FSAGCIPCGT SKILGSTDTI LLGSNCIAGS 550
    ESNGNVPYLQ QNTHTLPHNH TDLNSSTEEP WRKQLSNSAQ GLHKSQSSCL 600
    SGPNEEQPLF STGSAQYHQA TSTGIKKANE HLTLPSNSVP QGDADSHLSC 650
    HTATSGGQQG IMFTKESKPS KNRSLVPETS RHTGDTSNGC ADVKGLSNHV 700
    HQLIADAVSS PNHGDSPNLL IADNPQLSAL LIGKANGNVG TGTCDKVNNI 750
    HPAVHTKTDH SVASSPSSAI STATPSPKST EQRSINSVTS LNSPHSGLHT 800
    VNGEGLGKSQ SSTKVDLPLA SHRSTSQILP SMSVSICPSS TEVLKACRNP 850
    GKNGLSNSCI LLDKCPPPRP PTSPYPPLPK DKLNPPTPSI YLENKRDAFF 900
    PPLHQFCTNP KNPVTVIRGL AGALKLDLGL FSTKTLVEAN NEHMVEVRTQ 950
    LLQPADENWD PTGTKKIWRC ESNRSHTTIA KYAQYQASSF QESLREENEK 1000
    RTQHKDHSDN ESTSSENSGR RRKGPFKTIK FGTNIDLSDN KKWKLQLHEL 1050
    TKLPAFARVV SAGNLLTHVG HTILGMNTVQ LYMKVPGSRT PGHQENNNFC 1100
    SVNINIGPGD CEWFVVPEDY WGVLNDFCEK NNLNFLMSSW WPNLEDLYEA 1150
    NVPVYRFIQR PGDLVWINAG TVHWVQAVGW CNNIAWNVGP LTACQYKLAV 1200
    ERYEWNKLKS VKSPVPMVHL SWNMARNIKV SDPKLFEMIK YCLLKILKQY 1250
    QTLREALVAA GKEVIWHGRT NDEPAHYCSI CEVEVFNLLF VTNESNTQKT 1300
    YIVHCHDCAR KTSKSLENFV VLEQYKMEDL IQVYDQFTLA LSLSSSS 1347
    Length:1,347
    Mass (Da):149,548
    Last modified:April 14, 2009 - v2
    Checksum:iD83B8CAB861BCE60
    GO
    Isoform 2 (identifier: O14607-2) [UniParc]FASTAAdd to Basket

    Also known as: Short

    The sequence of this isoform differs from the canonical sequence as follows:
         996-1079: EENEKRTQHK...GHTILGMNTV → AGMQWCDLSS...GITGVSHHAR
         1080-1347: Missing.

    Show »
    Length:1,079
    Mass (Da):118,074
    Checksum:iB48FF0FAFFED5998
    GO
    Isoform 3 (identifier: O14607-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1241-1347: Missing.

    Show »
    Length:1,240
    Mass (Da):137,213
    Checksum:i38B414FFA5AC7C07
    GO
    Isoform 4 (identifier: O14607-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         394-394: L → LQAQLCNLPQSSLQNKTKLLPSIEEAWSLPIPAELTSRQGAMNTAQ

    Show »
    Length:1,392
    Mass (Da):154,437
    Checksum:iF49723B217462AD0
    GO
    Isoform 5 (identifier: O14607-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         394-394: L → LQAQLCNLPQSSLQNKTKLLPSIEEAWSLPIPAELTSRQGAMNTAQ
         465-588: Missing.
         1283-1339: Missing.

    Show »
    Length:1,211
    Mass (Da):134,762
    Checksum:iC429C9E257FD074A
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti81 – 811I → L in ABA25871. 1 PublicationCurated
    Sequence conflicti86 – 861G → R in ABA25870. 1 PublicationCurated
    Sequence conflicti122 – 1221D → G in ABA25870. 1 PublicationCurated
    Sequence conflicti218 – 2181Y → C in ABA25871. 1 PublicationCurated
    Sequence conflicti297 – 2971V → A in ABA25870. 1 PublicationCurated
    Sequence conflicti301 – 3011F → S in BAF85547. (PubMed:14702039)Curated
    Sequence conflicti302 – 3021I → V in ABA25870. 1 PublicationCurated
    Sequence conflicti372 – 3721Y → H in ABA25870. 1 PublicationCurated
    Sequence conflicti431 – 4311L → P in ABA25870. 1 PublicationCurated
    Sequence conflicti625 – 6251I → T in BAF85547. (PubMed:14702039)Curated
    Sequence conflicti644 – 6441A → V in ABA25870. 1 PublicationCurated
    Sequence conflicti793 – 7931S → R in ABA25871. 1 PublicationCurated
    Sequence conflicti1177 – 11771A → T in AAC51841. (PubMed:9381176)Curated
    Sequence conflicti1177 – 11771A → T in AAC51842. (PubMed:9381176)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei394 – 3941L → LQAQLCNLPQSSLQNKTKLL PSIEEAWSLPIPAELTSRQG AMNTAQ in isoform 4 and isoform 5. 1 PublicationVSP_045611
    Alternative sequencei465 – 588124Missing in isoform 5. 1 PublicationVSP_045612Add
    BLAST
    Alternative sequencei996 – 107984EENEK…GMNTV → AGMQWCDLSSLQPPPPGFKR FSHLSLPNSWNYRHLPSCPT NFCIFVETGFHHVGQACLEL LTSGGLLASASQSAGITGVS HHAR in isoform 2. 2 PublicationsVSP_006556Add
    BLAST
    Alternative sequencei1080 – 1347268Missing in isoform 2. 2 PublicationsVSP_036783Add
    BLAST
    Alternative sequencei1241 – 1347107Missing in isoform 3. 1 PublicationVSP_036784Add
    BLAST
    Alternative sequencei1283 – 133957Missing in isoform 5. 1 PublicationVSP_045613Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF000994 mRNA. Translation: AAC51841.1.
    AF000995 mRNA. Translation: AAC51842.1.
    AF000996 mRNA. Translation: AAC51843.1.
    DQ140389 mRNA. Translation: ABA25870.1.
    DQ140390 mRNA. Translation: ABA25871.1.
    AK292858 mRNA. Translation: BAF85547.1.
    AC005820 Genomic DNA. No translation available.
    AC006376 Genomic DNA. No translation available.
    AC010877 Genomic DNA. No translation available.
    CCDSiCCDS14783.1. [O14607-1]
    CCDS14784.1. [O14607-3]
    CCDS14785.1. [O14607-2]
    CCDS59184.1. [O14607-4]
    CCDS59185.1. [O14607-5]
    PIRiT02214.
    RefSeqiNP_001245181.1. NM_001258252.1. [O14607-4]
    NP_001245183.1. NM_001258254.1. [O14607-5]
    NP_009056.3. NM_007125.4. [O14607-1]
    NP_872600.1. NM_182659.1. [O14607-3]
    NP_872601.1. NM_182660.1. [O14607-2]
    UniGeneiHs.115277.

    Genome annotation databases

    EnsembliENST00000329134; ENSP00000330446; ENSG00000183878. [O14607-2]
    ENST00000331397; ENSP00000328939; ENSG00000183878. [O14607-1]
    ENST00000362096; ENSP00000355420; ENSG00000183878. [O14607-3]
    ENST00000382896; ENSP00000372352; ENSG00000183878. [O14607-4]
    ENST00000537580; ENSP00000439922; ENSG00000183878. [O14607-5]
    GeneIDi7404.
    KEGGihsa:7404.
    UCSCiuc004fsw.1. human. [O14607-1]
    uc004fsz.3. human. [O14607-2]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF000994 mRNA. Translation: AAC51841.1 .
    AF000995 mRNA. Translation: AAC51842.1 .
    AF000996 mRNA. Translation: AAC51843.1 .
    DQ140389 mRNA. Translation: ABA25870.1 .
    DQ140390 mRNA. Translation: ABA25871.1 .
    AK292858 mRNA. Translation: BAF85547.1 .
    AC005820 Genomic DNA. No translation available.
    AC006376 Genomic DNA. No translation available.
    AC010877 Genomic DNA. No translation available.
    CCDSi CCDS14783.1. [O14607-1 ]
    CCDS14784.1. [O14607-3 ]
    CCDS14785.1. [O14607-2 ]
    CCDS59184.1. [O14607-4 ]
    CCDS59185.1. [O14607-5 ]
    PIRi T02214.
    RefSeqi NP_001245181.1. NM_001258252.1. [O14607-4 ]
    NP_001245183.1. NM_001258254.1. [O14607-5 ]
    NP_009056.3. NM_007125.4. [O14607-1 ]
    NP_872600.1. NM_182659.1. [O14607-3 ]
    NP_872601.1. NM_182660.1. [O14607-2 ]
    UniGenei Hs.115277.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    3ZLI X-ray 1.80 A/B 878-1347 [» ]
    3ZPO X-ray 2.00 A/B 878-1347 [» ]
    ProteinModelPortali O14607.
    SMRi O14607. Positions 131-375, 833-1344.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 113247. 4 interactions.
    DIPi DIP-48650N.
    IntActi O14607. 1 interaction.
    STRINGi 9606.ENSP00000328939.

    PTM databases

    PhosphoSitei O14607.

    Proteomic databases

    MaxQBi O14607.
    PaxDbi O14607.
    PRIDEi O14607.

    Protocols and materials databases

    DNASUi 7404.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000329134 ; ENSP00000330446 ; ENSG00000183878 . [O14607-2 ]
    ENST00000331397 ; ENSP00000328939 ; ENSG00000183878 . [O14607-1 ]
    ENST00000362096 ; ENSP00000355420 ; ENSG00000183878 . [O14607-3 ]
    ENST00000382896 ; ENSP00000372352 ; ENSG00000183878 . [O14607-4 ]
    ENST00000537580 ; ENSP00000439922 ; ENSG00000183878 . [O14607-5 ]
    GeneIDi 7404.
    KEGGi hsa:7404.
    UCSCi uc004fsw.1. human. [O14607-1 ]
    uc004fsz.3. human. [O14607-2 ]

    Organism-specific databases

    CTDi 7404.
    GeneCardsi GC0YM015360.
    H-InvDB HIX0056663.
    HGNCi HGNC:12638. UTY.
    HPAi HPA000568.
    HPA001165.
    HPA002111.
    MIMi 400009. gene.
    neXtProti NX_O14607.
    PharmGKBi PA37263.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0457.
    HOGENOMi HOG000220834.
    HOVERGENi HBG018063.
    KOi K11447.
    OMAi NCIAGSE.
    OrthoDBi EOG7CG6Z5.
    PhylomeDBi O14607.
    TreeFami TF317405.

    Miscellaneous databases

    GeneWikii UTY_(gene).
    GenomeRNAii 7404.
    NextBioi 28984.
    PROi O14607.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O14607.
    Bgeei O14607.
    CleanExi HS_UTY.
    Genevestigatori O14607.

    Family and domain databases

    Gene3Di 1.25.40.10. 1 hit.
    InterProi IPR003347. JmjC_dom.
    IPR029516. KDM6C.
    IPR013026. TPR-contain_dom.
    IPR011990. TPR-like_helical.
    IPR001440. TPR_1.
    IPR019734. TPR_repeat.
    [Graphical view ]
    PANTHERi PTHR14017:SF17. PTHR14017:SF17. 1 hit.
    Pfami PF02373. JmjC. 1 hit.
    PF00515. TPR_1. 3 hits.
    PF13181. TPR_8. 1 hit.
    [Graphical view ]
    SMARTi SM00558. JmjC. 1 hit.
    SM00028. TPR. 6 hits.
    [Graphical view ]
    PROSITEi PS51184. JMJC. 1 hit.
    PS50005. TPR. 7 hits.
    PS50293. TPR_REGION. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Functional coherence of the human Y chromosome."
      Lahn B.T., Page D.C.
      Science 278:675-680(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3).
    2. "Characterization of the human UTY gene."
      Laaser I., Kolb H.J., Adamski J.
      Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 4 AND 5).
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Trachea.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides."
      Gevaert K., Goethals M., Martens L., Van Damme J., Staes A., Thomas G.R., Vandekerckhove J.
      Nat. Biotechnol. 21:566-569(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: PROTEIN SEQUENCE OF 461-468.
      Tissue: Platelet.

    Entry informationi

    Entry nameiUTY_HUMAN
    AccessioniPrimary (citable) accession number: O14607
    Secondary accession number(s): A8K9Z3
    , E1U199, E1U1A0, F5H4V7, F8W8R7, O14608
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 15, 1999
    Last sequence update: April 14, 2009
    Last modified: October 1, 2014
    This is version 133 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human chromosome Y
      Human chromosome Y: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3