O14607 (UTY_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 119.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Histone demethylase UTY EC=1.14.11.- Alternative name(s): Ubiquitously-transcribed TPR protein on the Y chromosome Ubiquitously-transcribed Y chromosome tetratricopeptide repeat protein | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1347 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Histone demethylase By similarity. |
| Cofactor | Ascorbate By similarity. Fe2+ By similarity. |
| Subunit structure | Interacts with TLE1 and TLE2 By similarity. |
| Subcellular location | Nucleus Potential. |
| Sequence similarities | Belongs to the UTX family. Contains 1 JmjC domain. Contains 8 TPR repeats. |
Ontologies
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform 1 (identifier: O14607-1) Also known as: Long; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O14607-2) Also known as: Short; The sequence of this isoform differs from the canonical sequence as follows: 996-1079: EENEKRTQHK...GHTILGMNTV → AGMQWCDLSS...GITGVSHHAR 1080-1347: Missing. | ||||||
| Isoform 3 (identifier: O14607-3) The sequence of this isoform differs from the canonical sequence as follows: 1241-1347: Missing. | ||||||
| Isoform 4 (identifier: O14607-4) The sequence of this isoform differs from the canonical sequence as follows: 394-394: L → LQAQLCNLPQSSLQNKTKLLPSIEEAWSLPIPAELTSRQGAMNTAQ | ||||||
| Isoform 5 (identifier: O14607-5) The sequence of this isoform differs from the canonical sequence as follows: 394-394: L → LQAQLCNLPQSSLQNKTKLLPSIEEAWSLPIPAELTSRQGAMNTAQ 465-588: Missing. 1283-1339: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1347 | 1347 | Histone demethylase UTY | PRO_0000106411 | |||||
Regions | |||||||||
| Repeat | 90 – 123 | 34 | TPR 1 | ||||||
| Repeat | 127 – 160 | 34 | TPR 2 | ||||||
| Repeat | 167 – 196 | 30 | TPR 3 | ||||||
| Repeat | 202 – 235 | 34 | TPR 4 | ||||||
| Repeat | 247 – 280 | 34 | TPR 5 | ||||||
| Repeat | 281 – 314 | 34 | TPR 6 | ||||||
| Repeat | 315 – 348 | 34 | TPR 7 | ||||||
| Repeat | 349 – 382 | 34 | TPR 8 | ||||||
| Domain | 1042 – 1205 | 164 | JmjC | ||||||
Sites | |||||||||
| Metal binding | 1093 | 1 | Iron By similarity | ||||||
| Metal binding | 1095 | 1 | Iron By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 394 | 1 | L → LQAQLCNLPQSSLQNKTKLL PSIEEAWSLPIPAELTSRQG AMNTAQ in isoform 4 and isoform 5. | VSP_045611 | |||||
| Alternative sequence | 465 – 588 | 124 | Missing in isoform 5. | VSP_045612 | |||||
| Alternative sequence | 996 – 1079 | 84 | EENEK…GMNTV → AGMQWCDLSSLQPPPPGFKR FSHLSLPNSWNYRHLPSCPT NFCIFVETGFHHVGQACLEL LTSGGLLASASQSAGITGVS HHAR in isoform 2. | VSP_006556 | |||||
| Alternative sequence | 1080 – 1347 | 268 | Missing in isoform 2. | VSP_036783 | |||||
| Alternative sequence | 1241 – 1347 | 107 | Missing in isoform 3. | VSP_036784 | |||||
| Alternative sequence | 1283 – 1339 | 57 | Missing in isoform 5. | VSP_045613 | |||||
Experimental info | |||||||||
| Sequence conflict | 81 | 1 | I → L in ABA25871. Ref.2 | ||||||
| Sequence conflict | 86 | 1 | G → R in ABA25870. Ref.2 | ||||||
| Sequence conflict | 122 | 1 | D → G in ABA25870. Ref.2 | ||||||
| Sequence conflict | 218 | 1 | Y → C in ABA25871. Ref.2 | ||||||
| Sequence conflict | 297 | 1 | V → A in ABA25870. Ref.2 | ||||||
| Sequence conflict | 301 | 1 | F → S in BAF85547. Ref.3 | ||||||
| Sequence conflict | 302 | 1 | I → V in ABA25870. Ref.2 | ||||||
| Sequence conflict | 372 | 1 | Y → H in ABA25870. Ref.2 | ||||||
| Sequence conflict | 431 | 1 | L → P in ABA25870. Ref.2 | ||||||
| Sequence conflict | 625 | 1 | I → T in BAF85547. Ref.3 | ||||||
| Sequence conflict | 644 | 1 | A → V in ABA25870. Ref.2 | ||||||
| Sequence conflict | 793 | 1 | S → R in ABA25871. Ref.2 | ||||||
| Sequence conflict | 1177 | 1 | A → T in AAC51841. Ref.1 | ||||||
| Sequence conflict | 1177 | 1 | A → T in AAC51842. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Functional coherence of the human Y chromosome." Lahn B.T., Page D.C. Science 278:675-680(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3). |
| [2] | "Characterization of the human UTY gene." Laaser I., Kolb H.J., Adamski J. Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 4 AND 5). |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Trachea. |
| [4] | "The male-specific region of the human Y chromosome is a mosaic of discrete sequence classes." Skaletsky H., Kuroda-Kawaguchi T., Minx P.J., Cordum H.S., Hillier L.W., Brown L.G., Repping S., Pyntikova T., Ali J., Bieri T., Chinwalla A., Delehaunty A., Delehaunty K., Du H., Fewell G., Fulton L., Fulton R., Graves T.A. Page D.C.Nature 423:825-837(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides." Gevaert K., Goethals M., Martens L., Van Damme J., Staes A., Thomas G.R., Vandekerckhove J. Nat. Biotechnol. 21:566-569(2003) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 461-468. Tissue: Platelet. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF000994 mRNA. Translation: AAC51841.1. AF000995 mRNA. Translation: AAC51842.1. AF000996 mRNA. Translation: AAC51843.1. DQ140389 mRNA. Translation: ABA25870.1. DQ140390 mRNA. Translation: ABA25871.1. AK292858 mRNA. Translation: BAF85547.1. AC005820 Genomic DNA. No translation available. AC006376 Genomic DNA. No translation available. AC010877 Genomic DNA. No translation available. | ||||||||||||
| IPI | IPI00023013. IPI00218824. IPI00377009. IPI00973001. IPI00973329. | ||||||||||||
| PIR | T02214. | ||||||||||||
| RefSeq | NP_001245181.1. NM_001258252.1. NP_001245183.1. NM_001258254.1. NP_009056.3. NM_007125.4. NP_872600.1. NM_182659.1. NP_872601.1. NM_182660.1. | ||||||||||||
| UniGene | Hs.115277. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | O14607. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| DIP | DIP-48650N. | ||||||||||||
| IntAct | O14607. 1 interaction. | ||||||||||||
| STRING | 9606.ENSP00000328939. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | O14607. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | O14607. | ||||||||||||
| PRIDE | O14607. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 7404. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000329134; ENSP00000330446; ENSG00000183878. ENST00000331397; ENSP00000328939; ENSG00000183878. ENST00000362096; ENSP00000355420; ENSG00000183878. ENST00000382896; ENSP00000372352; ENSG00000183878. ENST00000537580; ENSP00000439922; ENSG00000183878. | ||||||||||||
| GeneID | 7404. | ||||||||||||
| KEGG | hsa:7404. | ||||||||||||
| UCSC | uc004fsw.1. human. uc004fsz.3. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 7404. | ||||||||||||
| GeneCards | GC0YM015360. | ||||||||||||
| H-InvDB | HIX0056663. | ||||||||||||
| HGNC | HGNC:12638. UTY. | ||||||||||||
| HPA | HPA000568. HPA001165. HPA002111. | ||||||||||||
| MIM | 400009. gene. | ||||||||||||
| neXtProt | NX_O14607. | ||||||||||||
| PharmGKB | PA37263. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | COG0457. | ||||||||||||
| HOGENOM | HOG000220834. | ||||||||||||
| HOVERGEN | HBG018063. | ||||||||||||
| KO | K11447. | ||||||||||||
| OrthoDB | EOG4M91QN. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | O14607. | ||||||||||||
| Bgee | O14607. | ||||||||||||
| CleanEx | HS_UTY. | ||||||||||||
| Genevestigator | O14607. | ||||||||||||
| GermOnline | ENSG00000183878. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 1.25.40.10. 1 hit. | ||||||||||||
| InterPro | IPR003347. JmjC_dom. IPR001440. TPR-1. IPR013026. TPR-contain_dom. IPR011990. TPR-like_helical. IPR019734. TPR_repeat. [Graphical view] | ||||||||||||
| Pfam | PF02373. JmjC. 1 hit. PF00515. TPR_1. 3 hits. PF13181. TPR_8. 1 hit. [Graphical view] | ||||||||||||
| SMART | SM00558. JmjC. 1 hit. SM00028. TPR. 6 hits. [Graphical view] | ||||||||||||
| PROSITE | PS51184. JMJC. 1 hit. PS50005. TPR. 7 hits. PS50293. TPR_REGION. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| GenomeRNAi | 7404. | ||||||||||||
| NextBio | 28984. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | UTY_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O14607 Secondary accession number(s): A8K9Z3 O14608 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome Y Human chromosome Y: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
