Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

O14607 (UTY_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 128. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Histone demethylase UTY

EC=1.14.11.-
Alternative name(s):
Ubiquitously-transcribed TPR protein on the Y chromosome
Ubiquitously-transcribed Y chromosome tetratricopeptide repeat protein
Gene names
Name:UTY
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1347 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Histone demethylase By similarity.

Cofactor

Ascorbate By similarity.

Fe2+ By similarity.

Subunit structure

Interacts with TLE1 and TLE2 By similarity.

Subcellular location

Nucleus Potential.

Sequence similarities

Belongs to the UTX family.

Contains 1 JmjC domain.

Contains 8 TPR repeats.

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]

Note: Additional isoforms seem to exist.
Isoform 1 (identifier: O14607-1)

Also known as: Long;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: O14607-2)

Also known as: Short;

The sequence of this isoform differs from the canonical sequence as follows:
     996-1079: EENEKRTQHK...GHTILGMNTV → AGMQWCDLSS...GITGVSHHAR
     1080-1347: Missing.
Isoform 3 (identifier: O14607-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1241-1347: Missing.
Isoform 4 (identifier: O14607-4)

The sequence of this isoform differs from the canonical sequence as follows:
     394-394: L → LQAQLCNLPQSSLQNKTKLLPSIEEAWSLPIPAELTSRQGAMNTAQ
Isoform 5 (identifier: O14607-5)

The sequence of this isoform differs from the canonical sequence as follows:
     394-394: L → LQAQLCNLPQSSLQNKTKLLPSIEEAWSLPIPAELTSRQGAMNTAQ
     465-588: Missing.
     1283-1339: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 13471347Histone demethylase UTY
PRO_0000106411

Regions

Repeat90 – 12334TPR 1
Repeat127 – 16034TPR 2
Repeat167 – 19630TPR 3
Repeat202 – 23534TPR 4
Repeat247 – 28034TPR 5
Repeat281 – 31434TPR 6
Repeat315 – 34834TPR 7
Repeat349 – 38234TPR 8
Domain1042 – 1205164JmjC

Sites

Metal binding10931Iron By similarity
Metal binding10951Iron By similarity

Natural variations

Alternative sequence3941L → LQAQLCNLPQSSLQNKTKLL PSIEEAWSLPIPAELTSRQG AMNTAQ in isoform 4 and isoform 5.
VSP_045611
Alternative sequence465 – 588124Missing in isoform 5.
VSP_045612
Alternative sequence996 – 107984EENEK…GMNTV → AGMQWCDLSSLQPPPPGFKR FSHLSLPNSWNYRHLPSCPT NFCIFVETGFHHVGQACLEL LTSGGLLASASQSAGITGVS HHAR in isoform 2.
VSP_006556
Alternative sequence1080 – 1347268Missing in isoform 2.
VSP_036783
Alternative sequence1241 – 1347107Missing in isoform 3.
VSP_036784
Alternative sequence1283 – 133957Missing in isoform 5.
VSP_045613

Experimental info

Sequence conflict811I → L in ABA25871. Ref.2
Sequence conflict861G → R in ABA25870. Ref.2
Sequence conflict1221D → G in ABA25870. Ref.2
Sequence conflict2181Y → C in ABA25871. Ref.2
Sequence conflict2971V → A in ABA25870. Ref.2
Sequence conflict3011F → S in BAF85547. Ref.3
Sequence conflict3021I → V in ABA25870. Ref.2
Sequence conflict3721Y → H in ABA25870. Ref.2
Sequence conflict4311L → P in ABA25870. Ref.2
Sequence conflict6251I → T in BAF85547. Ref.3
Sequence conflict6441A → V in ABA25870. Ref.2
Sequence conflict7931S → R in ABA25871. Ref.2
Sequence conflict11771A → T in AAC51841. Ref.1
Sequence conflict11771A → T in AAC51842. Ref.1

Secondary structure

................................................................................ 1347
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (Long) [UniParc].

Last modified April 14, 2009. Version 2.
Checksum: D83B8CAB861BCE60

FASTA1,347149,548
        10         20         30         40         50         60 
MKSCAVSLTT AAVAFGDEAK KMAEGKASRE SEEESVSLTV EEREALGGMD SRLFGFVRLH 

        70         80         90        100        110        120 
EDGARTKTLL GKAVRCYESL ILKAEGKVES DFFCQLGHFN LLLEDYSKAL SAYQRYYSLQ 

       130        140        150        160        170        180 
ADYWKNAAFL YGLGLVYFYY NAFHWAIKAF QDVLYVDPSF CRAKEIHLRL GLMFKVNTDY 

       190        200        210        220        230        240 
KSSLKHFQLA LIDCNPCTLS NAEIQFHIAH LYETQRKYHS AKEAYEQLLQ TENLPAQVKA 

       250        260        270        280        290        300 
TVLQQLGWMH HNMDLVGDKA TKESYAIQYL QKSLEADPNS GQSWYFLGRC YSSIGKVQDA 

       310        320        330        340        350        360 
FISYRQSIDK SEASADTWCS IGVLYQQQNQ PMDALQAYIC AVQLDHGHAA AWMDLGTLYE 

       370        380        390        400        410        420 
SCNQPQDAIK CYLNAARSKR CSNTSTLAAR IKFLQNGSDN WNGGQSLSHH PVQQVYSLCL 

       430        440        450        460        470        480 
TPQKLQHLEQ LRANRDNLNP AQKHQLEQLE SQFVLMQQMR HKEVAQVRTT GIHNGAITDS 

       490        500        510        520        530        540 
SLPTNSVSNR QPHGALTRVS SVSQPGVRPA CVEKLLSSGA FSAGCIPCGT SKILGSTDTI 

       550        560        570        580        590        600 
LLGSNCIAGS ESNGNVPYLQ QNTHTLPHNH TDLNSSTEEP WRKQLSNSAQ GLHKSQSSCL 

       610        620        630        640        650        660 
SGPNEEQPLF STGSAQYHQA TSTGIKKANE HLTLPSNSVP QGDADSHLSC HTATSGGQQG 

       670        680        690        700        710        720 
IMFTKESKPS KNRSLVPETS RHTGDTSNGC ADVKGLSNHV HQLIADAVSS PNHGDSPNLL 

       730        740        750        760        770        780 
IADNPQLSAL LIGKANGNVG TGTCDKVNNI HPAVHTKTDH SVASSPSSAI STATPSPKST 

       790        800        810        820        830        840 
EQRSINSVTS LNSPHSGLHT VNGEGLGKSQ SSTKVDLPLA SHRSTSQILP SMSVSICPSS 

       850        860        870        880        890        900 
TEVLKACRNP GKNGLSNSCI LLDKCPPPRP PTSPYPPLPK DKLNPPTPSI YLENKRDAFF 

       910        920        930        940        950        960 
PPLHQFCTNP KNPVTVIRGL AGALKLDLGL FSTKTLVEAN NEHMVEVRTQ LLQPADENWD 

       970        980        990       1000       1010       1020 
PTGTKKIWRC ESNRSHTTIA KYAQYQASSF QESLREENEK RTQHKDHSDN ESTSSENSGR 

      1030       1040       1050       1060       1070       1080 
RRKGPFKTIK FGTNIDLSDN KKWKLQLHEL TKLPAFARVV SAGNLLTHVG HTILGMNTVQ 

      1090       1100       1110       1120       1130       1140 
LYMKVPGSRT PGHQENNNFC SVNINIGPGD CEWFVVPEDY WGVLNDFCEK NNLNFLMSSW 

      1150       1160       1170       1180       1190       1200 
WPNLEDLYEA NVPVYRFIQR PGDLVWINAG TVHWVQAVGW CNNIAWNVGP LTACQYKLAV 

      1210       1220       1230       1240       1250       1260 
ERYEWNKLKS VKSPVPMVHL SWNMARNIKV SDPKLFEMIK YCLLKILKQY QTLREALVAA 

      1270       1280       1290       1300       1310       1320 
GKEVIWHGRT NDEPAHYCSI CEVEVFNLLF VTNESNTQKT YIVHCHDCAR KTSKSLENFV 

      1330       1340 
VLEQYKMEDL IQVYDQFTLA LSLSSSS 

« Hide

Isoform 2 (Short) [UniParc].

Checksum: B48FF0FAFFED5998
Show »

FASTA1,079118,074
Isoform 3 [UniParc].

Checksum: 38B414FFA5AC7C07
Show »

FASTA1,240137,213
Isoform 4 [UniParc].

Checksum: F49723B217462AD0
Show »

FASTA1,392154,437
Isoform 5 [UniParc].

Checksum: C429C9E257FD074A
Show »

FASTA1,211134,762

References

« Hide 'large scale' references
[1]"Functional coherence of the human Y chromosome."
Lahn B.T., Page D.C.
Science 278:675-680(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3).
[2]"Characterization of the human UTY gene."
Laaser I., Kolb H.J., Adamski J.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 4 AND 5).
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Trachea.
[4]"The male-specific region of the human Y chromosome is a mosaic of discrete sequence classes."
Skaletsky H., Kuroda-Kawaguchi T., Minx P.J., Cordum H.S., Hillier L.W., Brown L.G., Repping S., Pyntikova T., Ali J., Bieri T., Chinwalla A., Delehaunty A., Delehaunty K., Du H., Fewell G., Fulton L., Fulton R., Graves T.A. expand/collapse author list , Hou S.-F., Latrielle P., Leonard S., Mardis E., Maupin R., McPherson J., Miner T., Nash W., Nguyen C., Ozersky P., Pepin K., Rock S., Rohlfing T., Scott K., Schultz B., Strong C., Tin-Wollam A., Yang S.-P., Waterston R.H., Wilson R.K., Rozen S., Page D.C.
Nature 423:825-837(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides."
Gevaert K., Goethals M., Martens L., Van Damme J., Staes A., Thomas G.R., Vandekerckhove J.
Nat. Biotechnol. 21:566-569(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: PROTEIN SEQUENCE OF 461-468.
Tissue: Platelet.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF000994 mRNA. Translation: AAC51841.1.
AF000995 mRNA. Translation: AAC51842.1.
AF000996 mRNA. Translation: AAC51843.1.
DQ140389 mRNA. Translation: ABA25870.1.
DQ140390 mRNA. Translation: ABA25871.1.
AK292858 mRNA. Translation: BAF85547.1.
AC005820 Genomic DNA. No translation available.
AC006376 Genomic DNA. No translation available.
AC010877 Genomic DNA. No translation available.
PIRT02214.
RefSeqNP_001245181.1. NM_001258252.1.
NP_001245183.1. NM_001258254.1.
NP_009056.3. NM_007125.4.
NP_872600.1. NM_182659.1.
NP_872601.1. NM_182660.1.
UniGeneHs.115277.

3D structure databases

PDBe
RCSB PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
3ZLIX-ray1.80A/B878-1347[»]
3ZPOX-ray2.00A/B878-1347[»]
ProteinModelPortalO14607.
SMRO14607. Positions 105-375, 833-1344.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid113247. 4 interactions.
DIPDIP-48650N.
IntActO14607. 1 interaction.
STRING9606.ENSP00000328939.

PTM databases

PhosphoSiteO14607.

Proteomic databases

PaxDbO14607.
PRIDEO14607.

Protocols and materials databases

DNASU7404.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000329134; ENSP00000330446; ENSG00000183878. [O14607-2]
ENST00000331397; ENSP00000328939; ENSG00000183878. [O14607-1]
ENST00000362096; ENSP00000355420; ENSG00000183878. [O14607-3]
ENST00000382896; ENSP00000372352; ENSG00000183878. [O14607-4]
ENST00000537580; ENSP00000439922; ENSG00000183878. [O14607-5]
GeneID7404.
KEGGhsa:7404.
UCSCuc004fsw.1. human. [O14607-1]
uc004fsz.3. human. [O14607-2]

Organism-specific databases

CTD7404.
GeneCardsGC0YM015360.
H-InvDBHIX0056663.
HGNCHGNC:12638. UTY.
HPAHPA000568.
HPA001165.
HPA002111.
MIM400009. gene.
neXtProtNX_O14607.
PharmGKBPA37263.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG0457.
HOGENOMHOG000220834.
HOVERGENHBG018063.
KOK11447.
OMANCIAGSE.
OrthoDBEOG7CG6Z5.
PhylomeDBO14607.
TreeFamTF317405.

Gene expression databases

ArrayExpressO14607.
BgeeO14607.
CleanExHS_UTY.
GenevestigatorO14607.

Family and domain databases

Gene3D1.25.40.10. 1 hit.
InterProIPR003347. JmjC_dom.
IPR013026. TPR-contain_dom.
IPR011990. TPR-like_helical.
IPR001440. TPR_1.
IPR019734. TPR_repeat.
[Graphical view]
PfamPF02373. JmjC. 1 hit.
PF00515. TPR_1. 3 hits.
PF13181. TPR_8. 1 hit.
[Graphical view]
SMARTSM00558. JmjC. 1 hit.
SM00028. TPR. 6 hits.
[Graphical view]
PROSITEPS51184. JMJC. 1 hit.
PS50005. TPR. 7 hits.
PS50293. TPR_REGION. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiUTY_(gene).
GenomeRNAi7404.
NextBio28984.
PROO14607.
SOURCESearch...

Entry information

Entry nameUTY_HUMAN
AccessionPrimary (citable) accession number: O14607
Secondary accession number(s): A8K9Z3 expand/collapse secondary AC list , E1U199, E1U1A0, F5H4V7, F8W8R7, O14608
Entry history
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: April 14, 2009
Last modified: April 16, 2014
This is version 128 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome Y

Human chromosome Y: entries, gene names and cross-references to MIM