Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Histone demethylase UTY

Gene

UTY

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Male-specific histone demethylase that catalyzes trimethylated 'Lys-27' (H3K27me3) demethylation in histone H3. Has relatively low lysine demethylase activity.1 Publication

Cofactori

Protein has several cofactor binding sites:

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi1093 – 10931Iron1 Publication
Metal bindingi1095 – 10951Iron1 Publication
Metal bindingi1173 – 11731Iron1 Publication
Metal bindingi1278 – 12781Zinc1 Publication
Metal bindingi1281 – 12811Zinc1 Publication
Metal bindingi1305 – 13051Zinc1 Publication
Metal bindingi1308 – 13081Zinc1 Publication

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Chromatin regulator, Dioxygenase, Oxidoreductase

Keywords - Ligandi

Iron, Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Histone demethylase UTY (EC:1.14.11.-)
Alternative name(s):
Ubiquitously-transcribed TPR protein on the Y chromosome
Ubiquitously-transcribed Y chromosome tetratricopeptide repeat protein
Gene namesi
Name:UTY
Synonyms:KDM6C
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome Y

Organism-specific databases

HGNCiHGNC:12638. UTY.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi1093 – 10931H → A: Abolishes lysine demethylase activity. 1 Publication
Mutagenesisi1138 – 11381S → G: No effect on lysine demethylase activity. 1 Publication
Mutagenesisi1214 – 12141P → I: Significantly higher lysine demethylase activity. 1 Publication

Organism-specific databases

PharmGKBiPA37263.

Polymorphism and mutation databases

BioMutaiUTY.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 13471347Histone demethylase UTYPRO_0000106411Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei887 – 8871Phosphothreonine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiO14607.
PaxDbiO14607.
PRIDEiO14607.

PTM databases

PhosphoSiteiO14607.

Expressioni

Gene expression databases

BgeeiO14607.
CleanExiHS_UTY.
ExpressionAtlasiO14607. baseline and differential.
GenevisibleiO14607. HS.

Organism-specific databases

HPAiHPA000568.
HPA001165.

Interactioni

Subunit structurei

Interacts with TLE1 and TLE2.By similarity

Protein-protein interaction databases

BioGridi113247. 4 interactions.
DIPiDIP-48650N.
IntActiO14607. 1 interaction.
STRINGi9606.ENSP00000328939.

Structurei

Secondary structure

1
1347
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi881 – 8833Combined sources
Beta strandi889 – 8913Combined sources
Helixi895 – 8995Combined sources
Helixi901 – 9088Combined sources
Beta strandi913 – 9186Combined sources
Helixi920 – 9245Combined sources
Helixi928 – 9314Combined sources
Helixi933 – 9408Combined sources
Beta strandi944 – 9518Combined sources
Beta strandi963 – 9664Combined sources
Beta strandi972 – 9787Combined sources
Helixi979 – 99719Combined sources
Beta strandi1028 – 10369Combined sources
Turni1040 – 10423Combined sources
Helixi1044 – 10496Combined sources
Helixi1050 – 10523Combined sources
Helixi1055 – 10573Combined sources
Beta strandi1058 – 10603Combined sources
Helixi1065 – 10684Combined sources
Turni1074 – 10763Combined sources
Beta strandi1080 – 10845Combined sources
Beta strandi1089 – 10935Combined sources
Helixi1096 – 10983Combined sources
Beta strandi1100 – 110910Combined sources
Beta strandi1111 – 11166Combined sources
Helixi1118 – 11203Combined sources
Helixi1121 – 113010Combined sources
Turni1135 – 11373Combined sources
Helixi1144 – 11496Combined sources
Beta strandi1155 – 11595Combined sources
Beta strandi1164 – 11674Combined sources
Beta strandi1172 – 118817Combined sources
Beta strandi1190 – 11923Combined sources
Helixi1193 – 120816Combined sources
Helixi1217 – 122711Combined sources
Helixi1233 – 125927Combined sources
Beta strandi1264 – 12663Combined sources
Turni1279 – 12813Combined sources
Beta strandi1287 – 12926Combined sources
Helixi1293 – 12975Combined sources
Helixi1306 – 13127Combined sources
Beta strandi1319 – 13257Combined sources
Helixi1327 – 13359Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3ZLIX-ray1.80A/B878-1347[»]
3ZPOX-ray2.00A/B878-1347[»]
4UF0X-ray1.78A/B878-1347[»]
ProteinModelPortaliO14607.
SMRiO14607. Positions 833-1344.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati90 – 12334TPR 1Add
BLAST
Repeati127 – 16034TPR 2Add
BLAST
Repeati167 – 19630TPR 3Add
BLAST
Repeati202 – 23534TPR 4Add
BLAST
Repeati247 – 28034TPR 5Add
BLAST
Repeati281 – 31434TPR 6Add
BLAST
Repeati315 – 34834TPR 7Add
BLAST
Repeati349 – 38234TPR 8Add
BLAST
Domaini1042 – 1205164JmjCPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Belongs to the UTX family.Curated
Contains 1 JmjC domain.PROSITE-ProRule annotation
Contains 8 TPR repeats.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, TPR repeat

Phylogenomic databases

eggNOGiCOG0457.
GeneTreeiENSGT00410000025758.
HOGENOMiHOG000220834.
HOVERGENiHBG018063.
InParanoidiO14607.
KOiK11447.
OMAiNCIAGSE.
OrthoDBiEOG7CG6Z5.
PhylomeDBiO14607.
TreeFamiTF317405.

Family and domain databases

Gene3Di1.25.40.10. 1 hit.
InterProiIPR003347. JmjC_dom.
IPR029516. KDM6C.
IPR013026. TPR-contain_dom.
IPR011990. TPR-like_helical_dom.
IPR001440. TPR_1.
IPR019734. TPR_repeat.
[Graphical view]
PANTHERiPTHR14017:SF17. PTHR14017:SF17. 1 hit.
PfamiPF02373. JmjC. 1 hit.
PF00515. TPR_1. 3 hits.
PF13181. TPR_8. 1 hit.
[Graphical view]
SMARTiSM00558. JmjC. 1 hit.
SM00028. TPR. 6 hits.
[Graphical view]
PROSITEiPS51184. JMJC. 1 hit.
PS50005. TPR. 7 hits.
PS50293. TPR_REGION. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.

Isoform 1 (identifier: O14607-1) [UniParc]FASTAAdd to basket

Also known as: Long

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKSCAVSLTT AAVAFGDEAK KMAEGKASRE SEEESVSLTV EEREALGGMD
60 70 80 90 100
SRLFGFVRLH EDGARTKTLL GKAVRCYESL ILKAEGKVES DFFCQLGHFN
110 120 130 140 150
LLLEDYSKAL SAYQRYYSLQ ADYWKNAAFL YGLGLVYFYY NAFHWAIKAF
160 170 180 190 200
QDVLYVDPSF CRAKEIHLRL GLMFKVNTDY KSSLKHFQLA LIDCNPCTLS
210 220 230 240 250
NAEIQFHIAH LYETQRKYHS AKEAYEQLLQ TENLPAQVKA TVLQQLGWMH
260 270 280 290 300
HNMDLVGDKA TKESYAIQYL QKSLEADPNS GQSWYFLGRC YSSIGKVQDA
310 320 330 340 350
FISYRQSIDK SEASADTWCS IGVLYQQQNQ PMDALQAYIC AVQLDHGHAA
360 370 380 390 400
AWMDLGTLYE SCNQPQDAIK CYLNAARSKR CSNTSTLAAR IKFLQNGSDN
410 420 430 440 450
WNGGQSLSHH PVQQVYSLCL TPQKLQHLEQ LRANRDNLNP AQKHQLEQLE
460 470 480 490 500
SQFVLMQQMR HKEVAQVRTT GIHNGAITDS SLPTNSVSNR QPHGALTRVS
510 520 530 540 550
SVSQPGVRPA CVEKLLSSGA FSAGCIPCGT SKILGSTDTI LLGSNCIAGS
560 570 580 590 600
ESNGNVPYLQ QNTHTLPHNH TDLNSSTEEP WRKQLSNSAQ GLHKSQSSCL
610 620 630 640 650
SGPNEEQPLF STGSAQYHQA TSTGIKKANE HLTLPSNSVP QGDADSHLSC
660 670 680 690 700
HTATSGGQQG IMFTKESKPS KNRSLVPETS RHTGDTSNGC ADVKGLSNHV
710 720 730 740 750
HQLIADAVSS PNHGDSPNLL IADNPQLSAL LIGKANGNVG TGTCDKVNNI
760 770 780 790 800
HPAVHTKTDH SVASSPSSAI STATPSPKST EQRSINSVTS LNSPHSGLHT
810 820 830 840 850
VNGEGLGKSQ SSTKVDLPLA SHRSTSQILP SMSVSICPSS TEVLKACRNP
860 870 880 890 900
GKNGLSNSCI LLDKCPPPRP PTSPYPPLPK DKLNPPTPSI YLENKRDAFF
910 920 930 940 950
PPLHQFCTNP KNPVTVIRGL AGALKLDLGL FSTKTLVEAN NEHMVEVRTQ
960 970 980 990 1000
LLQPADENWD PTGTKKIWRC ESNRSHTTIA KYAQYQASSF QESLREENEK
1010 1020 1030 1040 1050
RTQHKDHSDN ESTSSENSGR RRKGPFKTIK FGTNIDLSDN KKWKLQLHEL
1060 1070 1080 1090 1100
TKLPAFARVV SAGNLLTHVG HTILGMNTVQ LYMKVPGSRT PGHQENNNFC
1110 1120 1130 1140 1150
SVNINIGPGD CEWFVVPEDY WGVLNDFCEK NNLNFLMSSW WPNLEDLYEA
1160 1170 1180 1190 1200
NVPVYRFIQR PGDLVWINAG TVHWVQAVGW CNNIAWNVGP LTACQYKLAV
1210 1220 1230 1240 1250
ERYEWNKLKS VKSPVPMVHL SWNMARNIKV SDPKLFEMIK YCLLKILKQY
1260 1270 1280 1290 1300
QTLREALVAA GKEVIWHGRT NDEPAHYCSI CEVEVFNLLF VTNESNTQKT
1310 1320 1330 1340
YIVHCHDCAR KTSKSLENFV VLEQYKMEDL IQVYDQFTLA LSLSSSS
Length:1,347
Mass (Da):149,548
Last modified:April 14, 2009 - v2
Checksum:iD83B8CAB861BCE60
GO
Isoform 2 (identifier: O14607-2) [UniParc]FASTAAdd to basket

Also known as: Short

The sequence of this isoform differs from the canonical sequence as follows:
     996-1079: EENEKRTQHK...GHTILGMNTV → AGMQWCDLSS...GITGVSHHAR
     1080-1347: Missing.

Show »
Length:1,079
Mass (Da):118,074
Checksum:iB48FF0FAFFED5998
GO
Isoform 3 (identifier: O14607-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1241-1347: Missing.

Show »
Length:1,240
Mass (Da):137,213
Checksum:i38B414FFA5AC7C07
GO
Isoform 4 (identifier: O14607-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     394-394: L → LQAQLCNLPQSSLQNKTKLLPSIEEAWSLPIPAELTSRQGAMNTAQ

Show »
Length:1,392
Mass (Da):154,437
Checksum:iF49723B217462AD0
GO
Isoform 5 (identifier: O14607-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     394-394: L → LQAQLCNLPQSSLQNKTKLLPSIEEAWSLPIPAELTSRQGAMNTAQ
     465-588: Missing.
     1283-1339: Missing.

Show »
Length:1,211
Mass (Da):134,762
Checksum:iC429C9E257FD074A
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti81 – 811I → L in ABA25871 (Ref. 2) Curated
Sequence conflicti86 – 861G → R in ABA25870 (Ref. 2) Curated
Sequence conflicti122 – 1221D → G in ABA25870 (Ref. 2) Curated
Sequence conflicti218 – 2181Y → C in ABA25871 (Ref. 2) Curated
Sequence conflicti297 – 2971V → A in ABA25870 (Ref. 2) Curated
Sequence conflicti301 – 3011F → S in BAF85547 (PubMed:14702039).Curated
Sequence conflicti302 – 3021I → V in ABA25870 (Ref. 2) Curated
Sequence conflicti372 – 3721Y → H in ABA25870 (Ref. 2) Curated
Sequence conflicti431 – 4311L → P in ABA25870 (Ref. 2) Curated
Sequence conflicti625 – 6251I → T in BAF85547 (PubMed:14702039).Curated
Sequence conflicti644 – 6441A → V in ABA25870 (Ref. 2) Curated
Sequence conflicti793 – 7931S → R in ABA25871 (Ref. 2) Curated
Sequence conflicti1177 – 11771A → T in AAC51841 (PubMed:9381176).Curated
Sequence conflicti1177 – 11771A → T in AAC51842 (PubMed:9381176).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei394 – 3941L → LQAQLCNLPQSSLQNKTKLL PSIEEAWSLPIPAELTSRQG AMNTAQ in isoform 4 and isoform 5. 1 PublicationVSP_045611
Alternative sequencei465 – 588124Missing in isoform 5. 1 PublicationVSP_045612Add
BLAST
Alternative sequencei996 – 107984EENEK…GMNTV → AGMQWCDLSSLQPPPPGFKR FSHLSLPNSWNYRHLPSCPT NFCIFVETGFHHVGQACLEL LTSGGLLASASQSAGITGVS HHAR in isoform 2. 2 PublicationsVSP_006556Add
BLAST
Alternative sequencei1080 – 1347268Missing in isoform 2. 2 PublicationsVSP_036783Add
BLAST
Alternative sequencei1241 – 1347107Missing in isoform 3. 1 PublicationVSP_036784Add
BLAST
Alternative sequencei1283 – 133957Missing in isoform 5. 1 PublicationVSP_045613Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF000994 mRNA. Translation: AAC51841.1.
AF000995 mRNA. Translation: AAC51842.1.
AF000996 mRNA. Translation: AAC51843.1.
DQ140389 mRNA. Translation: ABA25870.1.
DQ140390 mRNA. Translation: ABA25871.1.
AK292858 mRNA. Translation: BAF85547.1.
AC005820 Genomic DNA. No translation available.
AC006376 Genomic DNA. No translation available.
AC010877 Genomic DNA. No translation available.
CCDSiCCDS14783.1. [O14607-1]
CCDS14784.1. [O14607-3]
CCDS14785.1. [O14607-2]
CCDS59184.1. [O14607-4]
PIRiT02214.
RefSeqiNP_001245181.1. NM_001258252.1. [O14607-4]
NP_001245183.1. NM_001258254.1. [O14607-5]
NP_009056.3. NM_007125.4. [O14607-1]
NP_872600.1. NM_182659.1. [O14607-3]
NP_872601.1. NM_182660.1. [O14607-2]
UniGeneiHs.115277.

Genome annotation databases

EnsembliENST00000329134; ENSP00000330446; ENSG00000183878. [O14607-2]
ENST00000331397; ENSP00000328939; ENSG00000183878. [O14607-1]
ENST00000362096; ENSP00000355420; ENSG00000183878. [O14607-3]
ENST00000382896; ENSP00000372352; ENSG00000183878. [O14607-4]
ENST00000624098; ENSP00000485539; ENSG00000183878. [O14607-5]
GeneIDi7404.
KEGGihsa:7404.
UCSCiuc004fsw.1. human. [O14607-1]
uc004fsz.3. human. [O14607-2]
uc022ckp.2. human.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF000994 mRNA. Translation: AAC51841.1.
AF000995 mRNA. Translation: AAC51842.1.
AF000996 mRNA. Translation: AAC51843.1.
DQ140389 mRNA. Translation: ABA25870.1.
DQ140390 mRNA. Translation: ABA25871.1.
AK292858 mRNA. Translation: BAF85547.1.
AC005820 Genomic DNA. No translation available.
AC006376 Genomic DNA. No translation available.
AC010877 Genomic DNA. No translation available.
CCDSiCCDS14783.1. [O14607-1]
CCDS14784.1. [O14607-3]
CCDS14785.1. [O14607-2]
CCDS59184.1. [O14607-4]
PIRiT02214.
RefSeqiNP_001245181.1. NM_001258252.1. [O14607-4]
NP_001245183.1. NM_001258254.1. [O14607-5]
NP_009056.3. NM_007125.4. [O14607-1]
NP_872600.1. NM_182659.1. [O14607-3]
NP_872601.1. NM_182660.1. [O14607-2]
UniGeneiHs.115277.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3ZLIX-ray1.80A/B878-1347[»]
3ZPOX-ray2.00A/B878-1347[»]
4UF0X-ray1.78A/B878-1347[»]
ProteinModelPortaliO14607.
SMRiO14607. Positions 833-1344.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi113247. 4 interactions.
DIPiDIP-48650N.
IntActiO14607. 1 interaction.
STRINGi9606.ENSP00000328939.

PTM databases

PhosphoSiteiO14607.

Polymorphism and mutation databases

BioMutaiUTY.

Proteomic databases

MaxQBiO14607.
PaxDbiO14607.
PRIDEiO14607.

Protocols and materials databases

DNASUi7404.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000329134; ENSP00000330446; ENSG00000183878. [O14607-2]
ENST00000331397; ENSP00000328939; ENSG00000183878. [O14607-1]
ENST00000362096; ENSP00000355420; ENSG00000183878. [O14607-3]
ENST00000382896; ENSP00000372352; ENSG00000183878. [O14607-4]
ENST00000624098; ENSP00000485539; ENSG00000183878. [O14607-5]
GeneIDi7404.
KEGGihsa:7404.
UCSCiuc004fsw.1. human. [O14607-1]
uc004fsz.3. human. [O14607-2]
uc022ckp.2. human.

Organism-specific databases

CTDi7404.
GeneCardsiGC0YM015360.
H-InvDBHIX0056663.
HGNCiHGNC:12638. UTY.
HPAiHPA000568.
HPA001165.
MIMi400009. gene.
neXtProtiNX_O14607.
PharmGKBiPA37263.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiCOG0457.
GeneTreeiENSGT00410000025758.
HOGENOMiHOG000220834.
HOVERGENiHBG018063.
InParanoidiO14607.
KOiK11447.
OMAiNCIAGSE.
OrthoDBiEOG7CG6Z5.
PhylomeDBiO14607.
TreeFamiTF317405.

Miscellaneous databases

ChiTaRSiUTY. human.
GeneWikiiUTY_(gene).
GenomeRNAii7404.
NextBioi28984.
PROiO14607.
SOURCEiSearch...

Gene expression databases

BgeeiO14607.
CleanExiHS_UTY.
ExpressionAtlasiO14607. baseline and differential.
GenevisibleiO14607. HS.

Family and domain databases

Gene3Di1.25.40.10. 1 hit.
InterProiIPR003347. JmjC_dom.
IPR029516. KDM6C.
IPR013026. TPR-contain_dom.
IPR011990. TPR-like_helical_dom.
IPR001440. TPR_1.
IPR019734. TPR_repeat.
[Graphical view]
PANTHERiPTHR14017:SF17. PTHR14017:SF17. 1 hit.
PfamiPF02373. JmjC. 1 hit.
PF00515. TPR_1. 3 hits.
PF13181. TPR_8. 1 hit.
[Graphical view]
SMARTiSM00558. JmjC. 1 hit.
SM00028. TPR. 6 hits.
[Graphical view]
PROSITEiPS51184. JMJC. 1 hit.
PS50005. TPR. 7 hits.
PS50293. TPR_REGION. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Functional coherence of the human Y chromosome."
    Lahn B.T., Page D.C.
    Science 278:675-680(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3).
  2. "Characterization of the human UTY gene."
    Laaser I., Kolb H.J., Adamski J.
    Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 4 AND 5).
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Trachea.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides."
    Gevaert K., Goethals M., Martens L., Van Damme J., Staes A., Thomas G.R., Vandekerckhove J.
    Nat. Biotechnol. 21:566-569(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 461-468.
    Tissue: Platelet.
  6. Cited for: X-RAY CRYSTALLOGRAPHY (1.8 ANGSTROMS) OF 878-1347 IN COMPLEX WITH 2-OG AND INHIBITOR, IRON-BINDING SITES, ZINC-BINDING SITES, FUNCTION, PHOSPHORYLATION AT THR-887, MUTAGENESIS OF HIS-1093; SER-1138 AND PRO-1214.

Entry informationi

Entry nameiUTY_HUMAN
AccessioniPrimary (citable) accession number: O14607
Secondary accession number(s): A8K9Z3
, E1U199, E1U1A0, F5H4V7, F8W8R7, O14608
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: April 14, 2009
Last modified: June 24, 2015
This is version 141 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome Y
    Human chromosome Y: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.