Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cytoplasmic dynein 1 intermediate chain 1

Gene

DYNC1I1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. The intermediate chains mediate the binding of dynein to dynactin via its 150 kDa component (p150-glued) DCNT1. May play a role in mediating the interaction of cytoplasmic dynein with membranous organelles and kinetochores.

GO - Molecular functioni

  • microtubule binding Source: HGNC
  • microtubule motor activity Source: HGNC
  • motor activity Source: ProtInc
  • spectrin binding Source: MGI

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Motor protein

Keywords - Biological processi

Transport

Enzyme and pathway databases

BioCyciZFISH:ENSG00000158560-MONOMER.
ReactomeiR-HSA-2132295. MHC class II antigen presentation.
R-HSA-6807878. COPI-mediated anterograde transport.
R-HSA-6811436. COPI-independent Golgi-to-ER retrograde traffic.
SignaLinkiO14576.

Names & Taxonomyi

Protein namesi
Recommended name:
Cytoplasmic dynein 1 intermediate chain 1
Alternative name(s):
Cytoplasmic dynein intermediate chain 1
Dynein intermediate chain 1, cytosolic
Short name:
DH IC-1
Gene namesi
Name:DYNC1I1
Synonyms:DNCI1, DNCIC1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

HGNCiHGNC:2963. DYNC1I1.

Subcellular locationi

GO - Cellular componenti

  • condensed chromosome kinetochore Source: UniProtKB-SubCell
  • cytoplasm Source: AgBase
  • cytoplasmic dynein complex Source: UniProtKB
  • cytoplasmic ribonucleoprotein granule Source: ParkinsonsUK-UCL
  • cytosol Source: Reactome
  • kinetochore Source: UniProtKB
  • microtubule Source: UniProtKB-KW
  • nucleus Source: AgBase
  • perinuclear region of cytoplasm Source: HGNC
  • recycling endosome Source: UniProtKB
  • spindle pole Source: UniProtKB
  • vesicle Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Centromere, Chromosome, Cytoplasm, Cytoskeleton, Dynein, Kinetochore, Microtubule

Pathology & Biotechi

Organism-specific databases

DisGeNETi1780.
OpenTargetsiENSG00000158560.
PharmGKBiPA27434.

Polymorphism and mutation databases

BioMutaiDYNC1I1.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001146521 – 645Cytoplasmic dynein 1 intermediate chain 1Add BLAST645

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei50PhosphoserineBy similarity1
Modified residuei111PhosphoserineBy similarity1
Modified residuei114PhosphoserineBy similarity1
Modified residuei176PhosphothreonineBy similarity1
Modified residuei179PhosphoserineBy similarity1
Modified residuei197PhosphoserineBy similarity1
Modified residuei635PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiO14576.
MaxQBiO14576.
PaxDbiO14576.
PeptideAtlasiO14576.
PRIDEiO14576.
TopDownProteomicsiO14576-3. [O14576-3]

PTM databases

iPTMnetiO14576.
PhosphoSitePlusiO14576.

Expressioni

Gene expression databases

BgeeiENSG00000158560.
CleanExiHS_DYNC1I1.
ExpressionAtlasiO14576. baseline and differential.
GenevisibleiO14576. HS.

Organism-specific databases

HPAiHPA021315.
HPA061689.

Interactioni

Subunit structurei

Homodimer (By similarity). The cytoplasmic dynein 1 complex consists of two catalytic heavy chains (HCs) and a number of non-catalytic subunits presented by intermediate chains (ICs), light intermediate chains (LICs) and light chains (LCs); the composition seems to vary in respect to the IC, LIC and LC composition. The heavy chain homodimer serves as a scaffold for the probable homodimeric assembly of the respective non-catalytic subunits. The ICs and LICs bind directly to the HC dimer and the LCs assemble on the IC dimer. Interacts with DYNC1H1. Interacts with DYNLT1 and DYNLT3. Interacts with DCNT1 (By similarity).By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
Nde1Q9CZA62EBI-366267,EBI-309934From a different organism.

GO - Molecular functioni

  • microtubule binding Source: HGNC
  • spectrin binding Source: MGI

Protein-protein interaction databases

BioGridi108118. 55 interactors.
IntActiO14576. 36 interactors.
MINTiMINT-156403.
STRINGi9606.ENSP00000320130.

Structurei

3D structure databases

DisProtiDP00360.
ProteinModelPortaliO14576.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati285 – 334WD 1Add BLAST50
Repeati338 – 378WD 2Add BLAST41
Repeati387 – 428WD 3Add BLAST42
Repeati437 – 477WD 4Add BLAST41
Repeati482 – 527WD 5Add BLAST46
Repeati530 – 570WD 6Add BLAST41
Repeati576 – 615WD 7Add BLAST40

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 123Interaction with DCTN1By similarityAdd BLAST123

Sequence similaritiesi

Belongs to the dynein intermediate chain family.Curated
Contains 7 WD repeats.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

eggNOGiKOG1587. Eukaryota.
ENOG410XQ99. LUCA.
GeneTreeiENSGT00730000110228.
HOGENOMiHOG000116383.
HOVERGENiHBG004083.
InParanoidiO14576.
KOiK10415.
OMAiHNNEDSP.
OrthoDBiEOG091G038G.
PhylomeDBiO14576.
TreeFamiTF300553.

Family and domain databases

Gene3Di2.130.10.10. 1 hit.
InterProiIPR025956. DYNC1I1/DYNC1I2.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF11540. Dynein_IC2. 1 hit.
PF00400. WD40. 1 hit.
[Graphical view]
SMARTiSM00320. WD40. 5 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 1 hit.
PROSITEiPS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O14576-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSDKSDLKAE LERKKQRLAQ IREEKKRKEE ERKKKEADMQ QKKEPVQDDS
60 70 80 90 100
DLDRKRRETE ALLQSIGISP EPPLVQPLHF LTWDTCYFHY LVPTPMSPSS
110 120 130 140 150
KSVSTPSEAG SQDSGDLGPL TRTLQWDTDP SVLQLQSDSE LGRRLHKLGV
160 170 180 190 200
SKVTQVDFLP REVVSYSKET QTPLATHQSE EDEEDEEMVE SKVGQDSELE
210 220 230 240 250
NQDKKQEVKE APPRELTEEE KQQILHSEEF LIFFDRTIRV IERALAEDSD
260 270 280 290 300
IFFDYSGREL EEKDGDVQAG ANLSFNRQFY DEHWSKHRVV TCMDWSLQYP
310 320 330 340 350
ELMVASYNNN EDAPHEPDGV ALVWNMKFKK TTPEYVFHCQ SSVMSVCFAR
360 370 380 390 400
FHPNLVVGGT YSGQIVLWDN RSHRRTPVQR TPLSAAAHTH PVYCVNVVGT
410 420 430 440 450
QNAHNLITVS TDGKMCSWSL DMLSTPQESM ELVYNKSKPV AVTGMAFPTG
460 470 480 490 500
DVNNFVVGSE EGTVYTACRH GSKAGIGEVF EGHQGPVTGI NCHMAVGPID
510 520 530 540 550
FSHLFVTSSF DWTVKLWTTK HNKPLYSFED NADYVYDVMW SPVHPALFAC
560 570 580 590 600
VDGMGRLDLW NLNNDTEVPT ASVAIEGASA LNRVRWAQAG KEVAVGDSEG
610 620 630 640
RIWVYDVGEL AVPHNDEWTR FARTLVEIRA NRADSEEEGT VELSA
Length:645
Mass (Da):72,955
Last modified:May 1, 1999 - v2
Checksum:i55A6FF971E632DA0
GO
Isoform 2 (identifier: O14576-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     74-90: Missing.

Show »
Length:628
Mass (Da):70,790
Checksum:i0360B15D5295971F
GO
Isoform 3 (identifier: O14576-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     74-90: Missing.
     123-142: Missing.

Show »
Length:608
Mass (Da):68,575
Checksum:iD88D3EB3D1FC82B2
GO
Isoform 4 (identifier: O14576-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     74-90: Missing.
     123-142: Missing.
     610-645: LAVPHNDEWTRFARTLVEIRANRADSEEEGTVELSA → GLAMLPGWSQNSWTQAILLCWPPKVLGLQT

Note: No experimental confirmation available.
Show »
Length:602
Mass (Da):67,802
Checksum:iC72E232C21BED944
GO
Isoform 5 (identifier: O14576-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     123-142: Missing.

Note: No experimental confirmation available.
Show »
Length:625
Mass (Da):70,741
Checksum:iE9675FAE856C56F1
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti254D → G in BAG59855 (PubMed:14702039).Curated1
Sequence conflicti517W → C in AAH22540 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_064709373H → L Found in a renal cell carcinoma case; somatic mutation. 1 Publication1
Natural variantiVAR_048905582N → T.Corresponds to variant rs35077523dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_00133274 – 90Missing in isoform 2, isoform 3 and isoform 4. 2 PublicationsAdd BLAST17
Alternative sequenceiVSP_001333123 – 142Missing in isoform 3, isoform 4 and isoform 5. 3 PublicationsAdd BLAST20
Alternative sequenceiVSP_054766610 – 645LAVPH…VELSA → GLAMLPGWSQNSWTQAILLC WPPKVLGLQT in isoform 4. 1 PublicationAdd BLAST36

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF063228 mRNA. Translation: AAC33443.1.
AF123074 mRNA. Translation: AAD26852.1.
AK091339 mRNA. Translation: BAC03639.1.
AK297427 mRNA. Translation: BAG59855.1.
AC022261 Genomic DNA. No translation available.
AC091779 Genomic DNA. No translation available.
AC002452 Genomic DNA. Translation: AAB67047.2.
AC002540 Genomic DNA. Translation: AAB70113.1.
CH471091 Genomic DNA. Translation: EAW76753.1.
BC022540 mRNA. Translation: AAH22540.1.
CCDSiCCDS47645.1. [O14576-2]
CCDS47646.1. [O14576-3]
CCDS5644.1. [O14576-1]
CCDS64718.1. [O14576-5]
CCDS64719.1. [O14576-4]
RefSeqiNP_001129028.1. NM_001135556.1. [O14576-2]
NP_001129029.1. NM_001135557.1. [O14576-3]
NP_001265350.1. NM_001278421.1. [O14576-5]
NP_001265351.1. NM_001278422.1. [O14576-4]
NP_004402.1. NM_004411.4. [O14576-1]
XP_011514163.1. XM_011515861.1. [O14576-1]
XP_011514164.1. XM_011515862.1. [O14576-2]
XP_016867293.1. XM_017011804.1. [O14576-1]
XP_016867294.1. XM_017011805.1. [O14576-2]
UniGeneiHs.440364.

Genome annotation databases

EnsembliENST00000324972; ENSP00000320130; ENSG00000158560. [O14576-1]
ENST00000359388; ENSP00000352348; ENSG00000158560. [O14576-3]
ENST00000437599; ENSP00000398118; ENSG00000158560. [O14576-5]
ENST00000447467; ENSP00000392337; ENSG00000158560. [O14576-2]
ENST00000457059; ENSP00000412444; ENSG00000158560. [O14576-2]
ENST00000630942; ENSP00000486363; ENSG00000158560. [O14576-4]
GeneIDi1780.
KEGGihsa:1780.
UCSCiuc003uob.4. human. [O14576-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF063228 mRNA. Translation: AAC33443.1.
AF123074 mRNA. Translation: AAD26852.1.
AK091339 mRNA. Translation: BAC03639.1.
AK297427 mRNA. Translation: BAG59855.1.
AC022261 Genomic DNA. No translation available.
AC091779 Genomic DNA. No translation available.
AC002452 Genomic DNA. Translation: AAB67047.2.
AC002540 Genomic DNA. Translation: AAB70113.1.
CH471091 Genomic DNA. Translation: EAW76753.1.
BC022540 mRNA. Translation: AAH22540.1.
CCDSiCCDS47645.1. [O14576-2]
CCDS47646.1. [O14576-3]
CCDS5644.1. [O14576-1]
CCDS64718.1. [O14576-5]
CCDS64719.1. [O14576-4]
RefSeqiNP_001129028.1. NM_001135556.1. [O14576-2]
NP_001129029.1. NM_001135557.1. [O14576-3]
NP_001265350.1. NM_001278421.1. [O14576-5]
NP_001265351.1. NM_001278422.1. [O14576-4]
NP_004402.1. NM_004411.4. [O14576-1]
XP_011514163.1. XM_011515861.1. [O14576-1]
XP_011514164.1. XM_011515862.1. [O14576-2]
XP_016867293.1. XM_017011804.1. [O14576-1]
XP_016867294.1. XM_017011805.1. [O14576-2]
UniGeneiHs.440364.

3D structure databases

DisProtiDP00360.
ProteinModelPortaliO14576.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi108118. 55 interactors.
IntActiO14576. 36 interactors.
MINTiMINT-156403.
STRINGi9606.ENSP00000320130.

PTM databases

iPTMnetiO14576.
PhosphoSitePlusiO14576.

Polymorphism and mutation databases

BioMutaiDYNC1I1.

Proteomic databases

EPDiO14576.
MaxQBiO14576.
PaxDbiO14576.
PeptideAtlasiO14576.
PRIDEiO14576.
TopDownProteomicsiO14576-3. [O14576-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000324972; ENSP00000320130; ENSG00000158560. [O14576-1]
ENST00000359388; ENSP00000352348; ENSG00000158560. [O14576-3]
ENST00000437599; ENSP00000398118; ENSG00000158560. [O14576-5]
ENST00000447467; ENSP00000392337; ENSG00000158560. [O14576-2]
ENST00000457059; ENSP00000412444; ENSG00000158560. [O14576-2]
ENST00000630942; ENSP00000486363; ENSG00000158560. [O14576-4]
GeneIDi1780.
KEGGihsa:1780.
UCSCiuc003uob.4. human. [O14576-1]

Organism-specific databases

CTDi1780.
DisGeNETi1780.
GeneCardsiDYNC1I1.
HGNCiHGNC:2963. DYNC1I1.
HPAiHPA021315.
HPA061689.
MIMi603772. gene.
neXtProtiNX_O14576.
OpenTargetsiENSG00000158560.
PharmGKBiPA27434.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1587. Eukaryota.
ENOG410XQ99. LUCA.
GeneTreeiENSGT00730000110228.
HOGENOMiHOG000116383.
HOVERGENiHBG004083.
InParanoidiO14576.
KOiK10415.
OMAiHNNEDSP.
OrthoDBiEOG091G038G.
PhylomeDBiO14576.
TreeFamiTF300553.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000158560-MONOMER.
ReactomeiR-HSA-2132295. MHC class II antigen presentation.
R-HSA-6807878. COPI-mediated anterograde transport.
R-HSA-6811436. COPI-independent Golgi-to-ER retrograde traffic.
SignaLinkiO14576.

Miscellaneous databases

ChiTaRSiDYNC1I1. human.
GeneWikiiDYNC1I1.
GenomeRNAii1780.
PROiO14576.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000158560.
CleanExiHS_DYNC1I1.
ExpressionAtlasiO14576. baseline and differential.
GenevisibleiO14576. HS.

Family and domain databases

Gene3Di2.130.10.10. 1 hit.
InterProiIPR025956. DYNC1I1/DYNC1I2.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF11540. Dynein_IC2. 1 hit.
PF00400. WD40. 1 hit.
[Graphical view]
SMARTiSM00320. WD40. 5 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 1 hit.
PROSITEiPS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiDC1I1_HUMAN
AccessioniPrimary (citable) accession number: O14576
Secondary accession number(s): B4DME3
, F5H050, G5E9K1, Q8TBF7, Q9Y2X1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: May 1, 1999
Last modified: November 2, 2016
This is version 152 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.