Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O14576

- DC1I1_HUMAN

UniProt

O14576 - DC1I1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Cytoplasmic dynein 1 intermediate chain 1

Gene

DYNC1I1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. The intermediate chains mediate the binding of dynein to dynactin via its 150 kDa component (p150-glued) DCNT1. May play a role in mediating the interaction of cytoplasmic dynein with membranous organelles and kinetochores.

GO - Molecular functioni

  1. microtubule binding Source: HGNC
  2. microtubule motor activity Source: HGNC
  3. motor activity Source: ProtInc
  4. spectrin binding Source: MGI

GO - Biological processi

  1. antigen processing and presentation of exogenous peptide antigen via MHC class II Source: Reactome
  2. metabolic process Source: GOC
  3. vesicle transport along microtubule Source: HGNC
Complete GO annotation...

Keywords - Molecular functioni

Motor protein

Keywords - Biological processi

Transport

Enzyme and pathway databases

ReactomeiREACT_121399. MHC class II antigen presentation.
SignaLinkiO14576.

Names & Taxonomyi

Protein namesi
Recommended name:
Cytoplasmic dynein 1 intermediate chain 1
Alternative name(s):
Cytoplasmic dynein intermediate chain 1
Dynein intermediate chain 1, cytosolic
Short name:
DH IC-1
Gene namesi
Name:DYNC1I1
Synonyms:DNCI1, DNCIC1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 7

Organism-specific databases

HGNCiHGNC:2963. DYNC1I1.

Subcellular locationi

Cytoplasm By similarity. Chromosomecentromerekinetochore 1 Publication. Cytoplasmcytoskeletonspindle pole 1 Publication

GO - Cellular componenti

  1. cytoplasmic dynein complex Source: UniProtKB
  2. cytoplasmic ribonucleoprotein granule Source: ParkinsonsUK-UCL
  3. cytosol Source: Reactome
  4. kinetochore Source: UniProtKB
  5. microtubule Source: UniProtKB-KW
  6. perinuclear region of cytoplasm Source: HGNC
  7. spindle pole Source: UniProtKB
  8. vesicle Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Centromere, Chromosome, Cytoplasm, Cytoskeleton, Dynein, Kinetochore, Microtubule

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA27434.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 645645Cytoplasmic dynein 1 intermediate chain 1PRO_0000114652Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei635 – 6351Phosphoserine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiO14576.
PaxDbiO14576.
PRIDEiO14576.

PTM databases

PhosphoSiteiO14576.

Expressioni

Gene expression databases

BgeeiO14576.
CleanExiHS_DYNC1I1.
ExpressionAtlasiO14576. baseline and differential.
GenevestigatoriO14576.

Organism-specific databases

HPAiHPA021315.

Interactioni

Subunit structurei

Homodimer (By similarity). The cytoplasmic dynein 1 complex consists of two catalytic heavy chains (HCs) and a number of non-catalytic subunits presented by intermediate chains (ICs), light intermediate chains (LICs) and light chains (LCs); the composition seems to vary in respect to the IC, LIC and LC composition. The heavy chain homodimer serves as a scaffold for the probable homodimeric assembly of the respective non-catalytic subunits. The ICs and LICs bind directly to the HC dimer and the LCs assemble on the IC dimer. Interacts with DYNC1H1. Interacts with DYNLT1 and DYNLT3. Interacts with DCNT1 (By similarity).By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
Nde1Q9CZA62EBI-366267,EBI-309934From a different organism.

Protein-protein interaction databases

BioGridi108118. 43 interactions.
IntActiO14576. 36 interactions.
MINTiMINT-156403.
STRINGi9606.ENSP00000320130.

Structurei

3D structure databases

DisProtiDP00360.
ProteinModelPortaliO14576.
SMRiO14576. Positions 147-174, 341-566.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati285 – 33450WD 1Add
BLAST
Repeati338 – 37841WD 2Add
BLAST
Repeati387 – 42842WD 3Add
BLAST
Repeati437 – 47741WD 4Add
BLAST
Repeati482 – 52746WD 5Add
BLAST
Repeati530 – 57041WD 6Add
BLAST
Repeati576 – 61540WD 7Add
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 123123Interaction with DCTN1By similarityAdd
BLAST

Sequence similaritiesi

Belongs to the dynein intermediate chain family.Curated
Contains 7 WD repeats.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

eggNOGiNOG308180.
GeneTreeiENSGT00730000110228.
HOGENOMiHOG000116383.
HOVERGENiHBG004083.
InParanoidiO14576.
KOiK10415.
OMAiKVGHDSE.
OrthoDBiEOG7FR7FX.
PhylomeDBiO14576.
TreeFamiTF300553.

Family and domain databases

Gene3Di2.130.10.10. 1 hit.
InterProiIPR025956. Dynein_IC_1/2.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF11540. Dynein_IC2. 1 hit.
PF00400. WD40. 1 hit.
[Graphical view]
SMARTiSM00320. WD40. 5 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 1 hit.
PROSITEiPS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O14576-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSDKSDLKAE LERKKQRLAQ IREEKKRKEE ERKKKEADMQ QKKEPVQDDS
60 70 80 90 100
DLDRKRRETE ALLQSIGISP EPPLVQPLHF LTWDTCYFHY LVPTPMSPSS
110 120 130 140 150
KSVSTPSEAG SQDSGDLGPL TRTLQWDTDP SVLQLQSDSE LGRRLHKLGV
160 170 180 190 200
SKVTQVDFLP REVVSYSKET QTPLATHQSE EDEEDEEMVE SKVGQDSELE
210 220 230 240 250
NQDKKQEVKE APPRELTEEE KQQILHSEEF LIFFDRTIRV IERALAEDSD
260 270 280 290 300
IFFDYSGREL EEKDGDVQAG ANLSFNRQFY DEHWSKHRVV TCMDWSLQYP
310 320 330 340 350
ELMVASYNNN EDAPHEPDGV ALVWNMKFKK TTPEYVFHCQ SSVMSVCFAR
360 370 380 390 400
FHPNLVVGGT YSGQIVLWDN RSHRRTPVQR TPLSAAAHTH PVYCVNVVGT
410 420 430 440 450
QNAHNLITVS TDGKMCSWSL DMLSTPQESM ELVYNKSKPV AVTGMAFPTG
460 470 480 490 500
DVNNFVVGSE EGTVYTACRH GSKAGIGEVF EGHQGPVTGI NCHMAVGPID
510 520 530 540 550
FSHLFVTSSF DWTVKLWTTK HNKPLYSFED NADYVYDVMW SPVHPALFAC
560 570 580 590 600
VDGMGRLDLW NLNNDTEVPT ASVAIEGASA LNRVRWAQAG KEVAVGDSEG
610 620 630 640
RIWVYDVGEL AVPHNDEWTR FARTLVEIRA NRADSEEEGT VELSA
Length:645
Mass (Da):72,955
Last modified:May 1, 1999 - v2
Checksum:i55A6FF971E632DA0
GO
Isoform 2 (identifier: O14576-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     74-90: Missing.

Show »
Length:628
Mass (Da):70,790
Checksum:i0360B15D5295971F
GO
Isoform 3 (identifier: O14576-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     74-90: Missing.
     123-142: Missing.

Show »
Length:608
Mass (Da):68,575
Checksum:iD88D3EB3D1FC82B2
GO
Isoform 4 (identifier: O14576-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     74-90: Missing.
     123-142: Missing.
     610-645: LAVPHNDEWTRFARTLVEIRANRADSEEEGTVELSA → GLAMLPGWSQNSWTQAILLCWPPKVLGLQT

Note: No experimental confirmation available.

Show »
Length:602
Mass (Da):67,802
Checksum:iC72E232C21BED944
GO
Isoform 5 (identifier: O14576-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     123-142: Missing.

Note: No experimental confirmation available.

Show »
Length:625
Mass (Da):70,741
Checksum:iE9675FAE856C56F1
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti254 – 2541D → G in BAG59855. (PubMed:14702039)Curated
Sequence conflicti517 – 5171W → C in AAH22540. (PubMed:15489334)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti373 – 3731H → L Found in a renal cell carcinoma case; somatic mutation. 1 Publication
VAR_064709
Natural varianti582 – 5821N → T.
Corresponds to variant rs35077523 [ dbSNP | Ensembl ].
VAR_048905

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei74 – 9017Missing in isoform 2, isoform 3 and isoform 4. 2 PublicationsVSP_001332Add
BLAST
Alternative sequencei123 – 14220Missing in isoform 3, isoform 4 and isoform 5. 3 PublicationsVSP_001333Add
BLAST
Alternative sequencei610 – 64536LAVPH…VELSA → GLAMLPGWSQNSWTQAILLC WPPKVLGLQT in isoform 4. 1 PublicationVSP_054766Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF063228 mRNA. Translation: AAC33443.1.
AF123074 mRNA. Translation: AAD26852.1.
AK091339 mRNA. Translation: BAC03639.1.
AK297427 mRNA. Translation: BAG59855.1.
AC022261 Genomic DNA. No translation available.
AC091779 Genomic DNA. No translation available.
AC002452 Genomic DNA. Translation: AAB67047.2.
AC002540 Genomic DNA. Translation: AAB70113.1.
CH471091 Genomic DNA. Translation: EAW76753.1.
BC022540 mRNA. Translation: AAH22540.1.
CCDSiCCDS47645.1. [O14576-2]
CCDS47646.1. [O14576-3]
CCDS5644.1. [O14576-1]
CCDS64718.1. [O14576-5]
RefSeqiNP_001129028.1. NM_001135556.1. [O14576-2]
NP_001129029.1. NM_001135557.1. [O14576-3]
NP_001265350.1. NM_001278421.1. [O14576-5]
NP_001265351.1. NM_001278422.1. [O14576-4]
NP_004402.1. NM_004411.4. [O14576-1]
UniGeneiHs.440364.

Genome annotation databases

EnsembliENST00000324972; ENSP00000320130; ENSG00000158560. [O14576-1]
ENST00000359388; ENSP00000352348; ENSG00000158560. [O14576-3]
ENST00000437599; ENSP00000398118; ENSG00000158560. [O14576-5]
ENST00000447467; ENSP00000392337; ENSG00000158560. [O14576-2]
ENST00000457059; ENSP00000412444; ENSG00000158560. [O14576-2]
GeneIDi1780.
KEGGihsa:1780.
UCSCiuc003uob.3. human. [O14576-3]
uc003uoc.4. human. [O14576-1]
uc003uod.4. human. [O14576-2]
uc003uoe.4. human.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF063228 mRNA. Translation: AAC33443.1 .
AF123074 mRNA. Translation: AAD26852.1 .
AK091339 mRNA. Translation: BAC03639.1 .
AK297427 mRNA. Translation: BAG59855.1 .
AC022261 Genomic DNA. No translation available.
AC091779 Genomic DNA. No translation available.
AC002452 Genomic DNA. Translation: AAB67047.2 .
AC002540 Genomic DNA. Translation: AAB70113.1 .
CH471091 Genomic DNA. Translation: EAW76753.1 .
BC022540 mRNA. Translation: AAH22540.1 .
CCDSi CCDS47645.1. [O14576-2 ]
CCDS47646.1. [O14576-3 ]
CCDS5644.1. [O14576-1 ]
CCDS64718.1. [O14576-5 ]
RefSeqi NP_001129028.1. NM_001135556.1. [O14576-2 ]
NP_001129029.1. NM_001135557.1. [O14576-3 ]
NP_001265350.1. NM_001278421.1. [O14576-5 ]
NP_001265351.1. NM_001278422.1. [O14576-4 ]
NP_004402.1. NM_004411.4. [O14576-1 ]
UniGenei Hs.440364.

3D structure databases

DisProti DP00360.
ProteinModelPortali O14576.
SMRi O14576. Positions 147-174, 341-566.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 108118. 43 interactions.
IntActi O14576. 36 interactions.
MINTi MINT-156403.
STRINGi 9606.ENSP00000320130.

PTM databases

PhosphoSitei O14576.

Proteomic databases

MaxQBi O14576.
PaxDbi O14576.
PRIDEi O14576.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000324972 ; ENSP00000320130 ; ENSG00000158560 . [O14576-1 ]
ENST00000359388 ; ENSP00000352348 ; ENSG00000158560 . [O14576-3 ]
ENST00000437599 ; ENSP00000398118 ; ENSG00000158560 . [O14576-5 ]
ENST00000447467 ; ENSP00000392337 ; ENSG00000158560 . [O14576-2 ]
ENST00000457059 ; ENSP00000412444 ; ENSG00000158560 . [O14576-2 ]
GeneIDi 1780.
KEGGi hsa:1780.
UCSCi uc003uob.3. human. [O14576-3 ]
uc003uoc.4. human. [O14576-1 ]
uc003uod.4. human. [O14576-2 ]
uc003uoe.4. human.

Organism-specific databases

CTDi 1780.
GeneCardsi GC07P095401.
HGNCi HGNC:2963. DYNC1I1.
HPAi HPA021315.
MIMi 603772. gene.
neXtProti NX_O14576.
PharmGKBi PA27434.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG308180.
GeneTreei ENSGT00730000110228.
HOGENOMi HOG000116383.
HOVERGENi HBG004083.
InParanoidi O14576.
KOi K10415.
OMAi KVGHDSE.
OrthoDBi EOG7FR7FX.
PhylomeDBi O14576.
TreeFami TF300553.

Enzyme and pathway databases

Reactomei REACT_121399. MHC class II antigen presentation.
SignaLinki O14576.

Miscellaneous databases

ChiTaRSi DYNC1I1. human.
GeneWikii DYNC1I1.
GenomeRNAii 1780.
NextBioi 35473300.
PROi O14576.
SOURCEi Search...

Gene expression databases

Bgeei O14576.
CleanExi HS_DYNC1I1.
ExpressionAtlasi O14576. baseline and differential.
Genevestigatori O14576.

Family and domain databases

Gene3Di 2.130.10.10. 1 hit.
InterProi IPR025956. Dynein_IC_1/2.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR017986. WD40_repeat_dom.
[Graphical view ]
Pfami PF11540. Dynein_IC2. 1 hit.
PF00400. WD40. 1 hit.
[Graphical view ]
SMARTi SM00320. WD40. 5 hits.
[Graphical view ]
SUPFAMi SSF50978. SSF50978. 1 hit.
PROSITEi PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and characterization of two cytoplasmic dynein intermediate chain genes in mouse and human."
    Crackower M.A., Sinasac D.S., Xia J., Motoyama J., Prochazka M., Rommens J.M., Scherer S.W., Tsui L.-C.
    Genomics 55:257-267(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "Molecular cloning of a cytoplasmic dynein gene."
    Li G., Jin J., Hu S., Li W., Yuan J., Qiang B.
    Submitted (JAN-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4).
    Tissue: Brain.
  4. "The DNA sequence of human chromosome 7."
    Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
    , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
    Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
    Tissue: Brain.
  7. "Dynein light intermediate chain 1 is required for progress through the spindle assembly checkpoint."
    Sivaram M.V., Wadzinski T.L., Redick S.D., Manna T., Doxsey S.J.
    EMBO J. 28:902-914(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION.
  8. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-635, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  9. Cited for: VARIANT LEU-373.

Entry informationi

Entry nameiDC1I1_HUMAN
AccessioniPrimary (citable) accession number: O14576
Secondary accession number(s): B4DME3
, F5H050, G5E9K1, Q8TBF7, Q9Y2X1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: May 1, 1999
Last modified: November 26, 2014
This is version 134 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3