Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O14576

- DC1I1_HUMAN

UniProt

O14576 - DC1I1_HUMAN

Protein

Cytoplasmic dynein 1 intermediate chain 1

Gene

DYNC1I1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 132 (01 Oct 2014)
      Sequence version 2 (01 May 1999)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. The intermediate chains mediate the binding of dynein to dynactin via its 150 kDa component (p150-glued) DCNT1. May play a role in mediating the interaction of cytoplasmic dynein with membranous organelles and kinetochores.

    GO - Molecular functioni

    1. microtubule binding Source: HGNC
    2. microtubule motor activity Source: HGNC
    3. motor activity Source: ProtInc
    4. protein binding Source: IntAct
    5. spectrin binding Source: MGI

    GO - Biological processi

    1. antigen processing and presentation of exogenous peptide antigen via MHC class II Source: Reactome
    2. metabolic process Source: GOC
    3. vesicle transport along microtubule Source: HGNC

    Keywords - Molecular functioni

    Motor protein

    Keywords - Biological processi

    Transport

    Enzyme and pathway databases

    ReactomeiREACT_121399. MHC class II antigen presentation.
    SignaLinkiO14576.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Cytoplasmic dynein 1 intermediate chain 1
    Alternative name(s):
    Cytoplasmic dynein intermediate chain 1
    Dynein intermediate chain 1, cytosolic
    Short name:
    DH IC-1
    Gene namesi
    Name:DYNC1I1
    Synonyms:DNCI1, DNCIC1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 7

    Organism-specific databases

    HGNCiHGNC:2963. DYNC1I1.

    Subcellular locationi

    Cytoplasm By similarity. Chromosomecentromerekinetochore 1 Publication. Cytoplasmcytoskeletonspindle pole 1 Publication

    GO - Cellular componenti

    1. condensed chromosome kinetochore Source: UniProtKB-SubCell
    2. cytoplasmic dynein complex Source: UniProtKB
    3. cytoplasmic ribonucleoprotein granule Source: ParkinsonsUK-UCL
    4. cytosol Source: Reactome
    5. kinetochore Source: UniProtKB
    6. microtubule Source: UniProtKB-KW
    7. perinuclear region of cytoplasm Source: HGNC
    8. spindle pole Source: UniProtKB
    9. vesicle Source: UniProtKB

    Keywords - Cellular componenti

    Centromere, Chromosome, Cytoplasm, Cytoskeleton, Dynein, Kinetochore, Microtubule

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA27434.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 645645Cytoplasmic dynein 1 intermediate chain 1PRO_0000114652Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei635 – 6351Phosphoserine1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiO14576.
    PaxDbiO14576.
    PRIDEiO14576.

    PTM databases

    PhosphoSiteiO14576.

    Expressioni

    Gene expression databases

    ArrayExpressiO14576.
    BgeeiO14576.
    CleanExiHS_DYNC1I1.
    GenevestigatoriO14576.

    Organism-specific databases

    HPAiHPA021315.

    Interactioni

    Subunit structurei

    Homodimer By similarity. The cytoplasmic dynein 1 complex consists of two catalytic heavy chains (HCs) and a number of non-catalytic subunits presented by intermediate chains (ICs), light intermediate chains (LICs) and light chains (LCs); the composition seems to vary in respect to the IC, LIC and LC composition. The heavy chain homodimer serves as a scaffold for the probable homodimeric assembly of the respective non-catalytic subunits. The ICs and LICs bind directly to the HC dimer and the LCs assemble on the IC dimer. Interacts with DYNC1H1. Interacts with DYNLT1 and DYNLT3. Interacts with DCNT1 By similarity.By similarity

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    Nde1Q9CZA62EBI-366267,EBI-309934From a different organism.

    Protein-protein interaction databases

    BioGridi108118. 39 interactions.
    IntActiO14576. 36 interactions.
    MINTiMINT-156403.
    STRINGi9606.ENSP00000320130.

    Structurei

    3D structure databases

    DisProtiDP00360.
    ProteinModelPortaliO14576.
    SMRiO14576. Positions 147-174, 341-566.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati285 – 33450WD 1Add
    BLAST
    Repeati338 – 37841WD 2Add
    BLAST
    Repeati387 – 42842WD 3Add
    BLAST
    Repeati437 – 47741WD 4Add
    BLAST
    Repeati482 – 52746WD 5Add
    BLAST
    Repeati530 – 57041WD 6Add
    BLAST
    Repeati576 – 61540WD 7Add
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni1 – 123123Interaction with DCTN1By similarityAdd
    BLAST

    Sequence similaritiesi

    Belongs to the dynein intermediate chain family.Curated
    Contains 7 WD repeats.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat, WD repeat

    Phylogenomic databases

    eggNOGiNOG308180.
    HOGENOMiHOG000116383.
    HOVERGENiHBG004083.
    InParanoidiO14576.
    KOiK10415.
    OMAiKVGHDSE.
    OrthoDBiEOG7FR7FX.
    PhylomeDBiO14576.
    TreeFamiTF300553.

    Family and domain databases

    Gene3Di2.130.10.10. 1 hit.
    InterProiIPR025956. Dynein_IC_1/2.
    IPR015943. WD40/YVTN_repeat-like_dom.
    IPR001680. WD40_repeat.
    IPR017986. WD40_repeat_dom.
    [Graphical view]
    PfamiPF11540. Dynein_IC2. 1 hit.
    PF00400. WD40. 1 hit.
    [Graphical view]
    SMARTiSM00320. WD40. 5 hits.
    [Graphical view]
    SUPFAMiSSF50978. SSF50978. 1 hit.
    PROSITEiPS50294. WD_REPEATS_REGION. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O14576-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSDKSDLKAE LERKKQRLAQ IREEKKRKEE ERKKKEADMQ QKKEPVQDDS    50
    DLDRKRRETE ALLQSIGISP EPPLVQPLHF LTWDTCYFHY LVPTPMSPSS 100
    KSVSTPSEAG SQDSGDLGPL TRTLQWDTDP SVLQLQSDSE LGRRLHKLGV 150
    SKVTQVDFLP REVVSYSKET QTPLATHQSE EDEEDEEMVE SKVGQDSELE 200
    NQDKKQEVKE APPRELTEEE KQQILHSEEF LIFFDRTIRV IERALAEDSD 250
    IFFDYSGREL EEKDGDVQAG ANLSFNRQFY DEHWSKHRVV TCMDWSLQYP 300
    ELMVASYNNN EDAPHEPDGV ALVWNMKFKK TTPEYVFHCQ SSVMSVCFAR 350
    FHPNLVVGGT YSGQIVLWDN RSHRRTPVQR TPLSAAAHTH PVYCVNVVGT 400
    QNAHNLITVS TDGKMCSWSL DMLSTPQESM ELVYNKSKPV AVTGMAFPTG 450
    DVNNFVVGSE EGTVYTACRH GSKAGIGEVF EGHQGPVTGI NCHMAVGPID 500
    FSHLFVTSSF DWTVKLWTTK HNKPLYSFED NADYVYDVMW SPVHPALFAC 550
    VDGMGRLDLW NLNNDTEVPT ASVAIEGASA LNRVRWAQAG KEVAVGDSEG 600
    RIWVYDVGEL AVPHNDEWTR FARTLVEIRA NRADSEEEGT VELSA 645
    Length:645
    Mass (Da):72,955
    Last modified:May 1, 1999 - v2
    Checksum:i55A6FF971E632DA0
    GO
    Isoform 2 (identifier: O14576-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         74-90: Missing.

    Show »
    Length:628
    Mass (Da):70,790
    Checksum:i0360B15D5295971F
    GO
    Isoform 3 (identifier: O14576-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         74-90: Missing.
         123-142: Missing.

    Show »
    Length:608
    Mass (Da):68,575
    Checksum:iD88D3EB3D1FC82B2
    GO
    Isoform 4 (identifier: O14576-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         74-90: Missing.
         123-142: Missing.
         610-645: LAVPHNDEWTRFARTLVEIRANRADSEEEGTVELSA → GLAMLPGWSQNSWTQAILLCWPPKVLGLQT

    Note: No experimental confirmation available.

    Show »
    Length:602
    Mass (Da):67,802
    Checksum:iC72E232C21BED944
    GO
    Isoform 5 (identifier: O14576-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         123-142: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:625
    Mass (Da):70,741
    Checksum:iE9675FAE856C56F1
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti254 – 2541D → G in BAG59855. (PubMed:14702039)Curated
    Sequence conflicti517 – 5171W → C in AAH22540. (PubMed:15489334)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti373 – 3731H → L Found in a renal cell carcinoma case; somatic mutation. 1 Publication
    VAR_064709
    Natural varianti582 – 5821N → T.
    Corresponds to variant rs35077523 [ dbSNP | Ensembl ].
    VAR_048905

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei74 – 9017Missing in isoform 2, isoform 3 and isoform 4. 2 PublicationsVSP_001332Add
    BLAST
    Alternative sequencei123 – 14220Missing in isoform 3, isoform 4 and isoform 5. 3 PublicationsVSP_001333Add
    BLAST
    Alternative sequencei610 – 64536LAVPH…VELSA → GLAMLPGWSQNSWTQAILLC WPPKVLGLQT in isoform 4. 1 PublicationVSP_054766Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF063228 mRNA. Translation: AAC33443.1.
    AF123074 mRNA. Translation: AAD26852.1.
    AK091339 mRNA. Translation: BAC03639.1.
    AK297427 mRNA. Translation: BAG59855.1.
    AC022261 Genomic DNA. No translation available.
    AC091779 Genomic DNA. No translation available.
    AC002452 Genomic DNA. Translation: AAB67047.2.
    AC002540 Genomic DNA. Translation: AAB70113.1.
    CH471091 Genomic DNA. Translation: EAW76753.1.
    BC022540 mRNA. Translation: AAH22540.1.
    CCDSiCCDS47645.1. [O14576-2]
    CCDS47646.1. [O14576-3]
    CCDS5644.1. [O14576-1]
    CCDS64718.1. [O14576-5]
    CCDS64719.1. [O14576-4]
    RefSeqiNP_001129028.1. NM_001135556.1. [O14576-2]
    NP_001129029.1. NM_001135557.1. [O14576-3]
    NP_001265350.1. NM_001278421.1. [O14576-5]
    NP_001265351.1. NM_001278422.1. [O14576-4]
    NP_004402.1. NM_004411.4. [O14576-1]
    UniGeneiHs.440364.

    Genome annotation databases

    EnsembliENST00000324972; ENSP00000320130; ENSG00000158560. [O14576-1]
    ENST00000359388; ENSP00000352348; ENSG00000158560. [O14576-3]
    ENST00000437599; ENSP00000398118; ENSG00000158560. [O14576-5]
    ENST00000447467; ENSP00000392337; ENSG00000158560. [O14576-2]
    ENST00000457059; ENSP00000412444; ENSG00000158560. [O14576-2]
    ENST00000537881; ENSP00000438377; ENSG00000158560. [O14576-4]
    GeneIDi1780.
    KEGGihsa:1780.
    UCSCiuc003uob.3. human. [O14576-3]
    uc003uoc.4. human. [O14576-1]
    uc003uod.4. human. [O14576-2]
    uc003uoe.4. human.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF063228 mRNA. Translation: AAC33443.1 .
    AF123074 mRNA. Translation: AAD26852.1 .
    AK091339 mRNA. Translation: BAC03639.1 .
    AK297427 mRNA. Translation: BAG59855.1 .
    AC022261 Genomic DNA. No translation available.
    AC091779 Genomic DNA. No translation available.
    AC002452 Genomic DNA. Translation: AAB67047.2 .
    AC002540 Genomic DNA. Translation: AAB70113.1 .
    CH471091 Genomic DNA. Translation: EAW76753.1 .
    BC022540 mRNA. Translation: AAH22540.1 .
    CCDSi CCDS47645.1. [O14576-2 ]
    CCDS47646.1. [O14576-3 ]
    CCDS5644.1. [O14576-1 ]
    CCDS64718.1. [O14576-5 ]
    CCDS64719.1. [O14576-4 ]
    RefSeqi NP_001129028.1. NM_001135556.1. [O14576-2 ]
    NP_001129029.1. NM_001135557.1. [O14576-3 ]
    NP_001265350.1. NM_001278421.1. [O14576-5 ]
    NP_001265351.1. NM_001278422.1. [O14576-4 ]
    NP_004402.1. NM_004411.4. [O14576-1 ]
    UniGenei Hs.440364.

    3D structure databases

    DisProti DP00360.
    ProteinModelPortali O14576.
    SMRi O14576. Positions 147-174, 341-566.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 108118. 39 interactions.
    IntActi O14576. 36 interactions.
    MINTi MINT-156403.
    STRINGi 9606.ENSP00000320130.

    PTM databases

    PhosphoSitei O14576.

    Proteomic databases

    MaxQBi O14576.
    PaxDbi O14576.
    PRIDEi O14576.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000324972 ; ENSP00000320130 ; ENSG00000158560 . [O14576-1 ]
    ENST00000359388 ; ENSP00000352348 ; ENSG00000158560 . [O14576-3 ]
    ENST00000437599 ; ENSP00000398118 ; ENSG00000158560 . [O14576-5 ]
    ENST00000447467 ; ENSP00000392337 ; ENSG00000158560 . [O14576-2 ]
    ENST00000457059 ; ENSP00000412444 ; ENSG00000158560 . [O14576-2 ]
    ENST00000537881 ; ENSP00000438377 ; ENSG00000158560 . [O14576-4 ]
    GeneIDi 1780.
    KEGGi hsa:1780.
    UCSCi uc003uob.3. human. [O14576-3 ]
    uc003uoc.4. human. [O14576-1 ]
    uc003uod.4. human. [O14576-2 ]
    uc003uoe.4. human.

    Organism-specific databases

    CTDi 1780.
    GeneCardsi GC07P095401.
    HGNCi HGNC:2963. DYNC1I1.
    HPAi HPA021315.
    MIMi 603772. gene.
    neXtProti NX_O14576.
    PharmGKBi PA27434.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG308180.
    HOGENOMi HOG000116383.
    HOVERGENi HBG004083.
    InParanoidi O14576.
    KOi K10415.
    OMAi KVGHDSE.
    OrthoDBi EOG7FR7FX.
    PhylomeDBi O14576.
    TreeFami TF300553.

    Enzyme and pathway databases

    Reactomei REACT_121399. MHC class II antigen presentation.
    SignaLinki O14576.

    Miscellaneous databases

    GeneWikii DYNC1I1.
    GenomeRNAii 1780.
    NextBioi 35473300.
    PROi O14576.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O14576.
    Bgeei O14576.
    CleanExi HS_DYNC1I1.
    Genevestigatori O14576.

    Family and domain databases

    Gene3Di 2.130.10.10. 1 hit.
    InterProi IPR025956. Dynein_IC_1/2.
    IPR015943. WD40/YVTN_repeat-like_dom.
    IPR001680. WD40_repeat.
    IPR017986. WD40_repeat_dom.
    [Graphical view ]
    Pfami PF11540. Dynein_IC2. 1 hit.
    PF00400. WD40. 1 hit.
    [Graphical view ]
    SMARTi SM00320. WD40. 5 hits.
    [Graphical view ]
    SUPFAMi SSF50978. SSF50978. 1 hit.
    PROSITEi PS50294. WD_REPEATS_REGION. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and characterization of two cytoplasmic dynein intermediate chain genes in mouse and human."
      Crackower M.A., Sinasac D.S., Xia J., Motoyama J., Prochazka M., Rommens J.M., Scherer S.W., Tsui L.-C.
      Genomics 55:257-267(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "Molecular cloning of a cytoplasmic dynein gene."
      Li G., Jin J., Hu S., Li W., Yuan J., Qiang B.
      Submitted (JAN-1999) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4).
      Tissue: Brain.
    4. "The DNA sequence of human chromosome 7."
      Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
      , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
      Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
      Tissue: Brain.
    7. "Dynein light intermediate chain 1 is required for progress through the spindle assembly checkpoint."
      Sivaram M.V., Wadzinski T.L., Redick S.D., Manna T., Doxsey S.J.
      EMBO J. 28:902-914(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION.
    8. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-635, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    9. Cited for: VARIANT LEU-373.

    Entry informationi

    Entry nameiDC1I1_HUMAN
    AccessioniPrimary (citable) accession number: O14576
    Secondary accession number(s): B4DME3
    , F5H050, G5E9K1, Q8TBF7, Q9Y2X1
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 30, 2000
    Last sequence update: May 1, 1999
    Last modified: October 1, 2014
    This is version 132 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 7
      Human chromosome 7: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3