Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Thioredoxin domain-containing protein 9

Gene

TXNDC9

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Significantly diminishes the chaperonin TCP1 complex ATPase activity, thus negatively impacts protein folding, including that of actin or tubulin.1 Publication

GO - Molecular functioni

  • cadherin binding Source: BHF-UCL

GO - Biological processi

Names & Taxonomyi

Protein namesi
Recommended name:
Thioredoxin domain-containing protein 9
Alternative name(s):
ATP-binding protein associated with cell differentiation
Protein 1-4
Gene namesi
Name:TXNDC9
Synonyms:APACD
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000115514.11.
HGNCiHGNC:24110. TXNDC9.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Nucleus

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000115514.
PharmGKBiPA134957934.

Polymorphism and mutation databases

BioMutaiTXNDC9.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001201661 – 226Thioredoxin domain-containing protein 9Add BLAST226

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei188PhosphoserineCombined sources1
Modified residuei221PhosphoserineCombined sources1
Modified residuei223PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiO14530.
MaxQBiO14530.
PaxDbiO14530.
PeptideAtlasiO14530.
PRIDEiO14530.

PTM databases

iPTMnetiO14530.
PhosphoSitePlusiO14530.

Expressioni

Gene expression databases

BgeeiENSG00000115514.
CleanExiHS_TXNDC9.
ExpressionAtlasiO14530. baseline and differential.
GenevisibleiO14530. HS.

Organism-specific databases

HPAiHPA031844.
HPA031845.
HPA031846.

Interactioni

Subunit structurei

Forms ternary complexes with the chaperonin TCP1 complex, spanning the cylindrical chaperonin cavity and contacting at least 2 subunits.

Binary interactionsi

Show more details

GO - Molecular functioni

  • cadherin binding Source: BHF-UCL

Protein-protein interaction databases

BioGridi115487. 80 interactors.
IntActiO14530. 43 interactors.
MINTiMINT-1374838.
STRINGi9606.ENSP00000264255.

Structurei

3D structure databases

ProteinModelPortaliO14530.
SMRiO14530.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini74 – 180ThioredoxinAdd BLAST107

Phylogenomic databases

eggNOGiKOG1672. Eukaryota.
COG0526. LUCA.
GeneTreeiENSGT00390000015645.
HOVERGENiHBG054120.
InParanoidiO14530.
OMAiVVCHFYK.
OrthoDBiEOG091G0RBF.
PhylomeDBiO14530.
TreeFamiTF313442.

Family and domain databases

InterProiView protein in InterPro
IPR036249. Thioredoxin-like_sf.
IPR013766. Thioredoxin_domain.
PfamiView protein in Pfam
PF00085. Thioredoxin. 1 hit.
SUPFAMiSSF52833. SSF52833. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O14530-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEADASVDMF SKVLEHQLLQ TTKLVEEHLD SEIQKLDQMD EDELERLKEK
60 70 80 90 100
RLQALRKAQQ QKQEWLSKGH GEYREIPSER DFFQEVKESE NVVCHFYRDS
110 120 130 140 150
TFRCKILDRH LAILSKKHLE TKFLKLNVEK APFLCERLHI KVIPTLALLK
160 170 180 190 200
DGKTQDYVVG FTDLGNTDDF TTETLEWRLG SSDILNYSGN LMEPPFQNQK
210 220
KFGTNFTKLE KKTIRGKKYD SDSDDD
Length:226
Mass (Da):26,534
Last modified:September 19, 2002 - v2
Checksum:i2735A2562D1143C3
GO
Isoform 2 (identifier: O14530-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     188-226: SGNLMEPPFQNQKKFGTNFTKLEKKTIRGKKYDSDSDDD → R

Note: No experimental confirmation available.
Show »
Length:188
Mass (Da):22,199
Checksum:iB375C22E69DF6523
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti122K → N in BAA21881 (Ref. 1) Curated1
Sequence conflicti190N → D in BAD96336 (Ref. 4) Curated1
Sequence conflicti214I → M in BAA21881 (Ref. 1) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05832814L → Q. Corresponds to variant dbSNP:rs11542369Ensembl.1
Natural variantiVAR_05832938Q → R. Corresponds to variant dbSNP:rs11542371Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_056553188 – 226SGNLM…DSDDD → R in isoform 2. 1 PublicationAdd BLAST39

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB006679 mRNA. Translation: BAA21881.1.
AK313777 mRNA. Translation: BAG36515.1.
CR456935 mRNA. Translation: CAG33216.1.
AK222616 mRNA. Translation: BAD96336.1.
AB451403 mRNA. Translation: BAG70217.1.
AC079447 Genomic DNA. Translation: AAX93257.1.
CH471127 Genomic DNA. Translation: EAX01869.1.
CH471127 Genomic DNA. Translation: EAX01870.1.
CH471127 Genomic DNA. Translation: EAX01871.1.
BC005968 mRNA. Translation: AAH05968.1.
BC022864 mRNA. Translation: AAH22864.1.
BC024223 mRNA. Translation: AAH24223.2.
BC070183 mRNA. Translation: AAH70183.2.
CCDSiCCDS2044.1. [O14530-1]
RefSeqiNP_005774.2. NM_005783.3. [O14530-1]
UniGeneiHs.536122.

Genome annotation databases

EnsembliENST00000264255; ENSP00000264255; ENSG00000115514. [O14530-1]
ENST00000409434; ENSP00000387275; ENSG00000115514. [O14530-2]
GeneIDi10190.
KEGGihsa:10190.
UCSCiuc002szz.4. human. [O14530-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiTXND9_HUMAN
AccessioniPrimary (citable) accession number: O14530
Secondary accession number(s): B2R9G8
, D3DVI4, Q53HG4, Q53RV8, Q6NSF5, Q8TB70, Q9BRU6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: September 19, 2002
Last modified: October 25, 2017
This is version 150 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Uncharacterized protein families (UPF)
    List of uncharacterized protein family (UPF) entries