Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O14530

- TXND9_HUMAN

UniProt

O14530 - TXND9_HUMAN

Protein

Thioredoxin domain-containing protein 9

Gene

TXNDC9

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 121 (01 Oct 2014)
      Sequence version 2 (19 Sep 2002)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Significantly diminishes the chaperonin TCP1 complex ATPase activity, thus negatively impacts protein folding, including that of actin or tubulin.1 Publication

    GO - Molecular functioni

    1. protein binding Source: IntAct

    GO - Biological processi

    1. cell redox homeostasis Source: InterPro

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Thioredoxin domain-containing protein 9
    Alternative name(s):
    ATP-binding protein associated with cell differentiation
    Protein 1-4
    Gene namesi
    Name:TXNDC9
    Synonyms:APACD
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:24110. TXNDC9.

    Subcellular locationi

    GO - Cellular componenti

    1. centrosome Source: Ensembl
    2. cytoplasm Source: Ensembl
    3. midbody Source: Ensembl
    4. nucleus Source: Ensembl

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134957934.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 226226Thioredoxin domain-containing protein 9PRO_0000120166Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei188 – 1881Phosphoserine3 Publications
    Modified residuei221 – 2211Phosphoserine1 Publication
    Modified residuei223 – 2231Phosphoserine1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiO14530.
    PaxDbiO14530.
    PeptideAtlasiO14530.
    PRIDEiO14530.

    PTM databases

    PhosphoSiteiO14530.

    Expressioni

    Gene expression databases

    ArrayExpressiO14530.
    BgeeiO14530.
    CleanExiHS_TXNDC9.
    GenevestigatoriO14530.

    Organism-specific databases

    HPAiHPA031844.
    HPA031845.
    HPA031846.

    Interactioni

    Subunit structurei

    Forms ternary complexes with the chaperonin TCP1 complex, spanning the cylindrical chaperonin cavity and contacting at least 2 subunits.

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    FEZ1Q996892EBI-707554,EBI-396435

    Protein-protein interaction databases

    BioGridi115487. 22 interactions.
    IntActiO14530. 9 interactions.
    MINTiMINT-1374838.
    STRINGi9606.ENSP00000264255.

    Structurei

    3D structure databases

    ProteinModelPortaliO14530.
    SMRiO14530. Positions 71-189.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini74 – 180107ThioredoxinAdd
    BLAST

    Sequence similaritiesi

    Contains 1 thioredoxin domain.Curated

    Phylogenomic databases

    eggNOGiCOG0526.
    HOVERGENiHBG054120.
    InParanoidiO14530.
    OMAiMHLKILA.
    PhylomeDBiO14530.
    TreeFamiTF313442.

    Family and domain databases

    Gene3Di3.40.30.10. 1 hit.
    InterProiIPR012336. Thioredoxin-like_fold.
    IPR013766. Thioredoxin_domain.
    [Graphical view]
    PfamiPF00085. Thioredoxin. 1 hit.
    [Graphical view]
    SUPFAMiSSF52833. SSF52833. 1 hit.

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O14530-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MEADASVDMF SKVLEHQLLQ TTKLVEEHLD SEIQKLDQMD EDELERLKEK    50
    RLQALRKAQQ QKQEWLSKGH GEYREIPSER DFFQEVKESE NVVCHFYRDS 100
    TFRCKILDRH LAILSKKHLE TKFLKLNVEK APFLCERLHI KVIPTLALLK 150
    DGKTQDYVVG FTDLGNTDDF TTETLEWRLG SSDILNYSGN LMEPPFQNQK 200
    KFGTNFTKLE KKTIRGKKYD SDSDDD 226
    Length:226
    Mass (Da):26,534
    Last modified:September 19, 2002 - v2
    Checksum:i2735A2562D1143C3
    GO
    Isoform 2 (identifier: O14530-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         188-226: SGNLMEPPFQNQKKFGTNFTKLEKKTIRGKKYDSDSDDD → R

    Note: No experimental confirmation available.

    Show »
    Length:188
    Mass (Da):22,199
    Checksum:iB375C22E69DF6523
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti122 – 1221K → N in BAA21881. 1 PublicationCurated
    Sequence conflicti190 – 1901N → D in BAD96336. 1 PublicationCurated
    Sequence conflicti214 – 2141I → M in BAA21881. 1 PublicationCurated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti2 – 21E → G.
    Corresponds to variant rs11542366 [ dbSNP | Ensembl ].
    VAR_058327
    Natural varianti14 – 141L → Q.
    Corresponds to variant rs11542369 [ dbSNP | Ensembl ].
    VAR_058328
    Natural varianti38 – 381Q → R.
    Corresponds to variant rs11542371 [ dbSNP | Ensembl ].
    VAR_058329

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei188 – 22639SGNLM…DSDDD → R in isoform 2. 1 PublicationVSP_056553Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB006679 mRNA. Translation: BAA21881.1.
    AK313777 mRNA. Translation: BAG36515.1.
    CR456935 mRNA. Translation: CAG33216.1.
    AK222616 mRNA. Translation: BAD96336.1.
    AB451403 mRNA. Translation: BAG70217.1.
    AC079447 Genomic DNA. Translation: AAX93257.1.
    CH471127 Genomic DNA. Translation: EAX01869.1.
    CH471127 Genomic DNA. Translation: EAX01870.1.
    CH471127 Genomic DNA. Translation: EAX01871.1.
    BC005968 mRNA. Translation: AAH05968.1.
    BC022864 mRNA. Translation: AAH22864.1.
    BC024223 mRNA. Translation: AAH24223.2.
    BC070183 mRNA. Translation: AAH70183.2.
    CCDSiCCDS2044.1.
    RefSeqiNP_005774.2. NM_005783.3.
    UniGeneiHs.536122.

    Genome annotation databases

    EnsembliENST00000264255; ENSP00000264255; ENSG00000115514.
    ENST00000409434; ENSP00000387275; ENSG00000115514.
    GeneIDi10190.
    KEGGihsa:10190.
    UCSCiuc002szz.3. human.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB006679 mRNA. Translation: BAA21881.1 .
    AK313777 mRNA. Translation: BAG36515.1 .
    CR456935 mRNA. Translation: CAG33216.1 .
    AK222616 mRNA. Translation: BAD96336.1 .
    AB451403 mRNA. Translation: BAG70217.1 .
    AC079447 Genomic DNA. Translation: AAX93257.1 .
    CH471127 Genomic DNA. Translation: EAX01869.1 .
    CH471127 Genomic DNA. Translation: EAX01870.1 .
    CH471127 Genomic DNA. Translation: EAX01871.1 .
    BC005968 mRNA. Translation: AAH05968.1 .
    BC022864 mRNA. Translation: AAH22864.1 .
    BC024223 mRNA. Translation: AAH24223.2 .
    BC070183 mRNA. Translation: AAH70183.2 .
    CCDSi CCDS2044.1.
    RefSeqi NP_005774.2. NM_005783.3.
    UniGenei Hs.536122.

    3D structure databases

    ProteinModelPortali O14530.
    SMRi O14530. Positions 71-189.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 115487. 22 interactions.
    IntActi O14530. 9 interactions.
    MINTi MINT-1374838.
    STRINGi 9606.ENSP00000264255.

    PTM databases

    PhosphoSitei O14530.

    Proteomic databases

    MaxQBi O14530.
    PaxDbi O14530.
    PeptideAtlasi O14530.
    PRIDEi O14530.

    Protocols and materials databases

    DNASUi 10190.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000264255 ; ENSP00000264255 ; ENSG00000115514 .
    ENST00000409434 ; ENSP00000387275 ; ENSG00000115514 .
    GeneIDi 10190.
    KEGGi hsa:10190.
    UCSCi uc002szz.3. human.

    Organism-specific databases

    CTDi 10190.
    GeneCardsi GC02M099921.
    HGNCi HGNC:24110. TXNDC9.
    HPAi HPA031844.
    HPA031845.
    HPA031846.
    MIMi 612564. gene.
    neXtProti NX_O14530.
    PharmGKBi PA134957934.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0526.
    HOVERGENi HBG054120.
    InParanoidi O14530.
    OMAi MHLKILA.
    PhylomeDBi O14530.
    TreeFami TF313442.

    Miscellaneous databases

    GeneWikii TXNDC9.
    GenomeRNAii 10190.
    NextBioi 38568.
    PROi O14530.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O14530.
    Bgeei O14530.
    CleanExi HS_TXNDC9.
    Genevestigatori O14530.

    Family and domain databases

    Gene3Di 3.40.30.10. 1 hit.
    InterProi IPR012336. Thioredoxin-like_fold.
    IPR013766. Thioredoxin_domain.
    [Graphical view ]
    Pfami PF00085. Thioredoxin. 1 hit.
    [Graphical view ]
    SUPFAMi SSF52833. SSF52833. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Differential expression of 1-4 gene in functionally distinct ME-1 subclones."
      Shiosaka T.
      Submitted (AUG-1997) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Leukemia.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Testis.
    3. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
      Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
      Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    4. Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
      Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Cerebellum.
    5. "Human protein factory for converting the transcriptome into an in vitro-expressed proteome."
      Goshima N., Kawamura Y., Fukumoto A., Miura A., Honma R., Satoh R., Wakamatsu A., Yamamoto J., Kimura K., Nishikawa T., Andoh T., Iida Y., Ishikawa K., Ito E., Kagawa N., Kaminaga C., Kanehori K., Kawakami B.
      , Kenmochi K., Kimura R., Kobayashi M., Kuroita T., Kuwayama H., Maruyama Y., Matsuo K., Minami K., Mitsubori M., Mori M., Morishita R., Murase A., Nishikawa A., Nishikawa S., Okamoto T., Sakagami N., Sakamoto Y., Sasaki Y., Seki T., Sono S., Sugiyama A., Sumiya T., Takayama T., Takayama Y., Takeda H., Togashi T., Yahata K., Yamada H., Yanagisawa Y., Endo Y., Imamoto F., Kisu Y., Tanaka S., Isogai T., Imai J., Watanabe S., Nomura N.
      Nat. Methods 5:1011-1017(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    6. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Bone marrow, Brain and Kidney.
    9. "PhLP3 modulates CCT-mediated actin and tubulin folding via ternary complexes with substrates."
      Stirling P.C., Cuellar J., Alfaro G.A., El Khadali F., Beh C.T., Valpuesta J.M., Melki R., Leroux M.R.
      J. Biol. Chem. 281:7012-7021(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH TCP1 COMPLEX.
    10. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-188, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    11. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-188, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    12. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-188, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    13. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    14. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-221 AND SER-223, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiTXND9_HUMAN
    AccessioniPrimary (citable) accession number: O14530
    Secondary accession number(s): B2R9G8
    , D3DVI4, Q53HG4, Q53RV8, Q6NSF5, Q8TB70, Q9BRU6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 15, 1999
    Last sequence update: September 19, 2002
    Last modified: October 1, 2014
    This is version 121 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families
    6. Uncharacterized protein families (UPF)
      List of uncharacterized protein family (UPF) entries

    External Data

    Dasty 3