Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O14511

- NRG2_HUMAN

UniProt

O14511 - NRG2_HUMAN

Protein

Pro-neuregulin-2, membrane-bound isoform

Gene

NRG2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 131 (01 Oct 2014)
      Sequence version 1 (01 Jan 1998)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. May also promote the heterodimerization with the EGF receptor.

    GO - Molecular functioni

    1. receptor binding Source: ProtInc

    GO - Biological processi

    1. embryo development Source: InterPro
    2. epidermal growth factor receptor signaling pathway Source: Reactome
    3. Fc-epsilon receptor signaling pathway Source: Reactome
    4. fibroblast growth factor receptor signaling pathway Source: Reactome
    5. innate immune response Source: Reactome
    6. neurotrophin TRK receptor signaling pathway Source: Reactome
    7. phosphatidylinositol-mediated signaling Source: Reactome
    8. signal transduction Source: ProtInc

    Keywords - Molecular functioni

    Growth factor

    Enzyme and pathway databases

    ReactomeiREACT_115596. Signaling by ERBB4.
    REACT_115662. Downregulation of ERBB2:ERBB3 signaling.
    REACT_115755. Signaling by ERBB2.
    REACT_115854. GRB2 events in ERBB2 signaling.
    REACT_115896. GRB7 events in ERBB2 signaling.
    REACT_115961. PI3K events in ERBB4 signaling.
    REACT_115993. SHC1 events in ERBB2 signaling.
    REACT_116005. SHC1 events in ERBB4 signaling.
    REACT_116008. PI3K events in ERBB2 signaling.
    REACT_116022. Nuclear signaling by ERBB4.
    REACT_147727. Constitutive PI3K/AKT Signaling in Cancer.
    REACT_75829. PIP3 activates AKT signaling.
    SignaLinkiO14511.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Pro-neuregulin-2, membrane-bound isoform
    Short name:
    Pro-NRG2
    Cleaved into the following chain:
    Neuregulin-2
    Short name:
    NRG-2
    Alternative name(s):
    Divergent of neuregulin-1
    Short name:
    DON-1
    Neural- and thymus-derived activator for ERBB kinases
    Short name:
    NTAK
    Gene namesi
    Name:NRG2
    Synonyms:NTAK
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 5

    Organism-specific databases

    HGNCiHGNC:7998. NRG2.

    Subcellular locationi

    Chain Pro-neuregulin-2, membrane-bound isoform : Cell membrane By similarity; Single-pass type I membrane protein By similarity
    Note: Does not seem to be active.By similarity

    GO - Cellular componenti

    1. extracellular region Source: Reactome
    2. integral component of membrane Source: UniProtKB-KW
    3. plasma membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell membrane, Membrane, Secreted

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA31777.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Propeptidei1 – 111111By similarityPRO_0000019472Add
    BLAST
    Chaini112 – 850739Pro-neuregulin-2, membrane-bound isoformPRO_0000019473Add
    BLAST
    Chaini112 – 404293Neuregulin-2PRO_0000019474Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi52 – 521N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi53 – 531N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi147 – 1471N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi257 ↔ 311By similarity
    Glycosylationi278 – 2781N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi345 ↔ 359By similarity
    Glycosylationi346 – 3461N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi353 ↔ 370By similarity
    Disulfide bondi372 ↔ 381By similarity

    Post-translational modificationi

    Proteolytic cleavage close to the plasma membrane on the external face leads to the release of the soluble growth factor form.By similarity
    Extensive glycosylation precedes the proteolytic cleavage.By similarity

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PaxDbiO14511.
    PRIDEiO14511.

    PTM databases

    PhosphoSiteiO14511.

    Expressioni

    Tissue specificityi

    Restricted to the cerebellum in the adult.

    Gene expression databases

    ArrayExpressiO14511.
    BgeeiO14511.
    CleanExiHS_NRG2.
    GenevestigatoriO14511.

    Organism-specific databases

    HPAiHPA038935.
    HPA047973.

    Interactioni

    Subunit structurei

    Interacts with ERBB3 and ERBB4.1 Publication

    Protein-protein interaction databases

    BioGridi114917. 2 interactions.
    STRINGi9606.ENSP00000289422.

    Structurei

    3D structure databases

    ProteinModelPortaliO14511.
    SMRiO14511. Positions 244-381.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini112 – 405294ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini427 – 850424CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei406 – 42621Helical; Note=Internal signal sequenceSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini237 – 33296Ig-like C2-typeAdd
    BLAST
    Domaini341 – 38242EGF-likePROSITE-ProRule annotationAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi10 – 134Poly-Pro
    Compositional biasi20 – 3011Poly-SerAdd
    BLAST
    Compositional biasi33 – 4715Poly-SerAdd
    BLAST
    Compositional biasi87 – 904Poly-Ala
    Compositional biasi330 – 34011Ser/Thr-richAdd
    BLAST
    Compositional biasi721 – 7277Poly-Pro

    Domaini

    The cytoplasmic domain may be involved in the regulation of trafficking and proteolytic processing. Regulation of the proteolytic processing involves initial intracellular domain dimerization By similarity.By similarity
    ERBB receptor binding is elicited entirely by the EGF-like domain.By similarity

    Sequence similaritiesi

    Belongs to the neuregulin family.Curated
    Contains 1 EGF-like domain.PROSITE-ProRule annotation

    Keywords - Domaini

    EGF-like domain, Immunoglobulin domain, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG47801.
    HOGENOMiHOG000273863.
    HOVERGENiHBG006531.
    KOiK05456.
    OMAiKAGGMRL.
    OrthoDBiEOG7F7W86.
    PhylomeDBiO14511.
    TreeFamiTF332469.

    Family and domain databases

    Gene3Di2.60.40.10. 1 hit.
    InterProiIPR000742. EG-like_dom.
    IPR013032. EGF-like_CS.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR013098. Ig_I-set.
    IPR003598. Ig_sub2.
    IPR002154. Neuregulin_1_C.
    [Graphical view]
    PfamiPF07679. I-set. 1 hit.
    PF02158. Neuregulin. 1 hit.
    [Graphical view]
    SMARTiSM00181. EGF. 1 hit.
    SM00408. IGc2. 1 hit.
    [Graphical view]
    PROSITEiPS00022. EGF_1. 1 hit.
    PS01186. EGF_2. 1 hit.
    PS50026. EGF_3. 1 hit.
    PS50835. IG_LIKE. 1 hit.
    [Graphical view]

    Sequences (8)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 8 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O14511-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MRQVCCSALP PPPLEKGRCS SYSDSSSSSS ERSSSSSSSS SESGSSSRSS    50
    SNNSSISRPA APPEPRPQQQ PQPRSPAARR AAARSRAAAA GGMRRDPAPG 100
    FSMLLFGVSL ACYSPSLKSV QDQAYKAPVV VEGKVQGLVP AGGSSSNSTR 150
    EPPASGRVAL VKVLDKWPLR SGGLQREQVI SVGSCVPLER NQRYIFFLEP 200
    TEQPLVFKTA FAPLDTNGKN LKKEVGKILC TDCATRPKLK KMKSQTGQVG 250
    EKQSLKCEAA AGNPQPSYRW FKDGKELNRS RDIRIKYGNG RKNSRLQFNK 300
    VKVEDAGEYV CEAENILGKD TVRGRLYVNS VSTTLSSWSG HARKCNETAK 350
    SYCVNGGVCY YIEGINQLSC KCPNGFFGQR CLEKLPLRLY MPDPKQKAEE 400
    LYQKRVLTIT GICVALLVVG IVCVVAYCKT KKQRKQMHNH LRQNMCPAHQ 450
    NRSLANGPSH PRLDPEEIQM ADYISKNVPA TDHVIRRETE TTFSGSHSCS 500
    PSHHCSTATP TSSHRHESHT WSLERSESLT SDSQSGIMLS SVGTSKCNSP 550
    ACVEARARRA AAYNLEERRR ATAPPYHDSV DSLRDSPHSE RYVSALTTPA 600
    RLSPVDFHYS LATQVPTFEI TSPNSAHAVS LPPAAPISYR LAEQQPLLRH 650
    PAPPGPGPGP GPGPGPGADM QRSYDSYYYP AAGPGPRRGT CALGGSLGSL 700
    PASPFRIPED DEYETTQECA PPPPPRPRAR GASRRTSAGP RRWRRSRLNG 750
    LAAQRARAAR DSLSLSSGSG GGSASASDDD ADDADGALAA ESTPFLGLRG 800
    AHDALRSDSP PLCPAADSRT YYSLDSHSTR ASSRHSRGPP PRAKQDSAPL 850
    Length:850
    Mass (Da):91,679
    Last modified:January 1, 1998 - v1
    Checksum:i7124C089435FD2F4
    GO
    Isoform 2 (identifier: O14511-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         374-396: NGFFGQRCLEKLPLRLYMPDPKQ → VGYTGDRCQQFAMVNFS

    Note: No experimental confirmation available.

    Show »
    Length:844
    Mass (Da):90,851
    Checksum:iA68F2D2C96C3C1C1
    GO
    Isoform 3 (identifier: O14511-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         397-397: K → KHLGFELKE

    Note: No experimental confirmation available.

    Show »
    Length:858
    Mass (Da):92,633
    Checksum:i171976A9397EA0B1
    GO
    Isoform 4 (identifier: O14511-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         374-397: NGFFGQRCLEKLPLRLYMPDPKQK → VGYTGDRCQQFAMVNFSKHLGFELKE

    Note: No experimental confirmation available.

    Show »
    Length:852
    Mass (Da):91,805
    Checksum:iFDE8AEB0E1C6F94B
    GO
    Isoform 5 (identifier: O14511-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         397-426: KAEELYQKRVLTITGICVALLVVGIVCVVA → SVLWDTPGTGVSSSQWSTSPKPRSCTRRGS
         427-850: Missing.

    Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:426
    Mass (Da):46,183
    Checksum:iADC950AED919D5F4
    GO
    Isoform 6 (identifier: O14511-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         397-422: KAEELYQKRVLTITGICVALLVVGIV → SVLWDTPGTGVSSSQWSTSPSTLDLN
         423-850: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:422
    Mass (Da):45,698
    Checksum:i5CF05AF7A682310D
    GO
    Isoform DON-1B (identifier: O14511-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-241: Missing.
         397-397: K → KHLGFELKE

    Show »
    Length:617
    Mass (Da):67,126
    Checksum:i89A81CE27CE00B5C
    GO
    Isoform DON-1R (identifier: O14511-8) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-233: MRQVCCSALP...EVGKILCTDC → MSESRRRGRGRGKKHPEGRKREREPDPGEK

    Show »
    Length:647
    Mass (Da):70,637
    Checksum:iD1D5FDAF07CB3393
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 241241Missing in isoform DON-1B. 1 PublicationVSP_003452Add
    BLAST
    Alternative sequencei1 – 233233MRQVC…LCTDC → MSESRRRGRGRGKKHPEGRK REREPDPGEK in isoform DON-1R. 1 PublicationVSP_003451Add
    BLAST
    Alternative sequencei374 – 39724NGFFG…DPKQK → VGYTGDRCQQFAMVNFSKHL GFELKE in isoform 4. CuratedVSP_003454Add
    BLAST
    Alternative sequencei374 – 39623NGFFG…PDPKQ → VGYTGDRCQQFAMVNFS in isoform 2. CuratedVSP_003453Add
    BLAST
    Alternative sequencei397 – 42630KAEEL…VCVVA → SVLWDTPGTGVSSSQWSTSP KPRSCTRRGS in isoform 5. CuratedVSP_003458Add
    BLAST
    Alternative sequencei397 – 42226KAEEL…VVGIV → SVLWDTPGTGVSSSQWSTSP STLDLN in isoform 6. CuratedVSP_003456Add
    BLAST
    Alternative sequencei397 – 3971K → KHLGFELKE in isoform 3 and isoform DON-1B. 1 PublicationVSP_003455
    Alternative sequencei423 – 850428Missing in isoform 6. CuratedVSP_003457Add
    BLAST
    Alternative sequencei427 – 850424Missing in isoform 5. CuratedVSP_003459Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB005060 mRNA. Translation: BAA23417.1.
    AF119162
    , AF119151, AF119152, AF119153, AF119154, AF119155, AF119158, AF119159, AF119160, AF119161 Genomic DNA. Translation: AAF28848.1.
    AF119162
    , AF119151, AF119152, AF119153, AF119154, AF119156, AF119158, AF119159, AF119160, AF119161 Genomic DNA. Translation: AAF28849.1.
    AF119162
    , AF119151, AF119152, AF119153, AF119154, AF119155, AF119157, AF119158, AF119159, AF119160, AF119161 Genomic DNA. Translation: AAF28850.1.
    AF119162
    , AF119151, AF119152, AF119153, AF119154, AF119156, AF119157, AF119158, AF119159, AF119160, AF119161 Genomic DNA. Translation: AAF28851.1.
    AF119158
    , AF119151, AF119152, AF119153, AF119154, AF119155, AF119156 Genomic DNA. Translation: AAF28852.1.
    AF119157
    , AF119151, AF119152, AF119153, AF119154, AF119155, AF119156 Genomic DNA. Translation: AAF28853.1.
    CCDSiCCDS4217.1. [O14511-1]
    PIRiJC5700.
    RefSeqiNP_001171864.1. NM_001184935.1.
    NP_004874.1. NM_004883.2. [O14511-1]
    NP_053584.1. NM_013981.3. [O14511-2]
    NP_053585.1. NM_013982.2. [O14511-3]
    NP_053586.1. NM_013983.2. [O14511-4]
    XP_006714871.1. XM_006714808.1. [O14511-8]
    XP_006714873.1. XM_006714810.1. [O14511-6]
    UniGeneiHs.408515.

    Genome annotation databases

    EnsembliENST00000289409; ENSP00000289409; ENSG00000158458. [O14511-2]
    ENST00000289422; ENSP00000289422; ENSG00000158458. [O14511-3]
    ENST00000340391; ENSP00000342660; ENSG00000158458. [O14511-8]
    ENST00000358522; ENSP00000351323; ENSG00000158458. [O14511-4]
    ENST00000361474; ENSP00000354910; ENSG00000158458. [O14511-1]
    ENST00000378238; ENSP00000367483; ENSG00000158458. [O14511-5]
    GeneIDi9542.
    KEGGihsa:9542.
    UCSCiuc003lev.2. human. [O14511-3]
    uc003lew.2. human. [O14511-4]
    uc003lex.2. human. [O14511-1]
    uc003ley.2. human. [O14511-2]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB005060 mRNA. Translation: BAA23417.1 .
    AF119162
    , AF119151 , AF119152 , AF119153 , AF119154 , AF119155 , AF119158 , AF119159 , AF119160 , AF119161 Genomic DNA. Translation: AAF28848.1 .
    AF119162
    , AF119151 , AF119152 , AF119153 , AF119154 , AF119156 , AF119158 , AF119159 , AF119160 , AF119161 Genomic DNA. Translation: AAF28849.1 .
    AF119162
    , AF119151 , AF119152 , AF119153 , AF119154 , AF119155 , AF119157 , AF119158 , AF119159 , AF119160 , AF119161 Genomic DNA. Translation: AAF28850.1 .
    AF119162
    , AF119151 , AF119152 , AF119153 , AF119154 , AF119156 , AF119157 , AF119158 , AF119159 , AF119160 , AF119161 Genomic DNA. Translation: AAF28851.1 .
    AF119158
    , AF119151 , AF119152 , AF119153 , AF119154 , AF119155 , AF119156 Genomic DNA. Translation: AAF28852.1 .
    AF119157
    , AF119151 , AF119152 , AF119153 , AF119154 , AF119155 , AF119156 Genomic DNA. Translation: AAF28853.1 .
    CCDSi CCDS4217.1. [O14511-1 ]
    PIRi JC5700.
    RefSeqi NP_001171864.1. NM_001184935.1.
    NP_004874.1. NM_004883.2. [O14511-1 ]
    NP_053584.1. NM_013981.3. [O14511-2 ]
    NP_053585.1. NM_013982.2. [O14511-3 ]
    NP_053586.1. NM_013983.2. [O14511-4 ]
    XP_006714871.1. XM_006714808.1. [O14511-8 ]
    XP_006714873.1. XM_006714810.1. [O14511-6 ]
    UniGenei Hs.408515.

    3D structure databases

    ProteinModelPortali O14511.
    SMRi O14511. Positions 244-381.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 114917. 2 interactions.
    STRINGi 9606.ENSP00000289422.

    PTM databases

    PhosphoSitei O14511.

    Proteomic databases

    PaxDbi O14511.
    PRIDEi O14511.

    Protocols and materials databases

    DNASUi 9542.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000289409 ; ENSP00000289409 ; ENSG00000158458 . [O14511-2 ]
    ENST00000289422 ; ENSP00000289422 ; ENSG00000158458 . [O14511-3 ]
    ENST00000340391 ; ENSP00000342660 ; ENSG00000158458 . [O14511-8 ]
    ENST00000358522 ; ENSP00000351323 ; ENSG00000158458 . [O14511-4 ]
    ENST00000361474 ; ENSP00000354910 ; ENSG00000158458 . [O14511-1 ]
    ENST00000378238 ; ENSP00000367483 ; ENSG00000158458 . [O14511-5 ]
    GeneIDi 9542.
    KEGGi hsa:9542.
    UCSCi uc003lev.2. human. [O14511-3 ]
    uc003lew.2. human. [O14511-4 ]
    uc003lex.2. human. [O14511-1 ]
    uc003ley.2. human. [O14511-2 ]

    Organism-specific databases

    CTDi 9542.
    GeneCardsi GC05M139207.
    HGNCi HGNC:7998. NRG2.
    HPAi HPA038935.
    HPA047973.
    MIMi 603818. gene.
    neXtProti NX_O14511.
    PharmGKBi PA31777.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG47801.
    HOGENOMi HOG000273863.
    HOVERGENi HBG006531.
    KOi K05456.
    OMAi KAGGMRL.
    OrthoDBi EOG7F7W86.
    PhylomeDBi O14511.
    TreeFami TF332469.

    Enzyme and pathway databases

    Reactomei REACT_115596. Signaling by ERBB4.
    REACT_115662. Downregulation of ERBB2:ERBB3 signaling.
    REACT_115755. Signaling by ERBB2.
    REACT_115854. GRB2 events in ERBB2 signaling.
    REACT_115896. GRB7 events in ERBB2 signaling.
    REACT_115961. PI3K events in ERBB4 signaling.
    REACT_115993. SHC1 events in ERBB2 signaling.
    REACT_116005. SHC1 events in ERBB4 signaling.
    REACT_116008. PI3K events in ERBB2 signaling.
    REACT_116022. Nuclear signaling by ERBB4.
    REACT_147727. Constitutive PI3K/AKT Signaling in Cancer.
    REACT_75829. PIP3 activates AKT signaling.
    SignaLinki O14511.

    Miscellaneous databases

    GeneWikii NRG2.
    GenomeRNAii 9542.
    NextBioi 35779.
    PROi O14511.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O14511.
    Bgeei O14511.
    CleanExi HS_NRG2.
    Genevestigatori O14511.

    Family and domain databases

    Gene3Di 2.60.40.10. 1 hit.
    InterProi IPR000742. EG-like_dom.
    IPR013032. EGF-like_CS.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR013098. Ig_I-set.
    IPR003598. Ig_sub2.
    IPR002154. Neuregulin_1_C.
    [Graphical view ]
    Pfami PF07679. I-set. 1 hit.
    PF02158. Neuregulin. 1 hit.
    [Graphical view ]
    SMARTi SM00181. EGF. 1 hit.
    SM00408. IGc2. 1 hit.
    [Graphical view ]
    PROSITEi PS00022. EGF_1. 1 hit.
    PS01186. EGF_2. 1 hit.
    PS50026. EGF_3. 1 hit.
    PS50835. IG_LIKE. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "A novel brain-derived member of the epidermal growth factor family that interacts with ErbB3 and ErbB4."
      Higashiyama S., Horikawa M., Yamada K., Ichino N., Nakano N., Nakagawa T., Miyagawa J., Matsushita N., Nagatsu T., Taniguchi N., Ishiguro H.
      J. Biochem. 122:675-680(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Neuroblastoma.
    2. "Characterization of a neuregulin-related gene, Don-1, that is highly expressed in restricted regions of the cerebellum and hippocampus."
      Busfield S.J., Michnick D.A., Chickering T.W., Revett T.L., Ma J., Woolf E.A., Comrack C.A., Dussault B.J., Woolf J., Goodearl A.D.J., Gearing D.P.
      Mol. Cell. Biol. 17:4007-4014(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS DON-1B AND DON-1R).
      Tissue: Fetal brain.
    3. "The human neuregulin 2 (NRG2) gene: cloning, mapping and evaluation as a candidate for the autosomal recessive form of Charcot-Marie-Tooth disease linked to 5q."
      Ring H.Z., Chang H., Guilbot A., Brice A., LeGuern E., Francke U.
      Hum. Genet. 104:326-332(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORMS 1; 2; 3; 4; 5 AND 6).
      Tissue: Fetal brain and Lung.
    4. "Ligand discrimination in signaling through an ErbB4 receptor homodimer."
      Sweeney C., Lai C., Riese D.J. II, Diamonti A.J., Cantley L.C., Carraway K.L. III
      J. Biol. Chem. 275:19803-19807(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH ERBB4.

    Entry informationi

    Entry nameiNRG2_HUMAN
    AccessioniPrimary (citable) accession number: O14511
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 15, 1998
    Last sequence update: January 1, 1998
    Last modified: October 1, 2014
    This is version 131 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 5
      Human chromosome 5: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3