O14511 (NRG2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 117.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Pro-neuregulin-2, membrane-bound isoform Short name=Pro-NRG2 Cleaved into the following chain:
| ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 850 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. May also promote the heterodimerization with the EGF receptor. |
| Subunit structure | Interacts with ERBB3 and ERBB4. Ref.4 |
| Subcellular location | Pro-neuregulin-2, membrane-bound isoform: Cell membrane; Single-pass type I membrane protein By similarity. Note: Does not seem to be active By similarity. Neuregulin-2: Secreted By similarity. |
| Tissue specificity | Restricted to the cerebellum in the adult. |
| Domain | The cytoplasmic domain may be involved in the regulation of trafficking and proteolytic processing. Regulation of the proteolytic processing involves initial intracellular domain dimerization By similarity. ERBB receptor binding is elicited entirely by the EGF-like domain By similarity. |
| Post-translational modification | Proteolytic cleavage close to the plasma membrane on the external face leads to the release of the soluble growth factor form By similarity. Extensive glycosylation precedes the proteolytic cleavage By similarity. |
| Sequence similarities | Belongs to the neuregulin family. Contains 1 EGF-like domain. Contains 1 Ig-like C2-type (immunoglobulin-like) domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell membrane Membrane Secreted |
| Coding sequence diversity | Alternative splicing |
| Domain | EGF-like domain Immunoglobulin domain Transmembrane Transmembrane helix |
| Molecular function | Growth factor |
| PTM | Disulfide bond Glycoprotein Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | embryo development Inferred from electronic annotation. Source: InterPro signal transductionTraceable author statement PubMed 9168114PubMed 9168115. Source: ProtInc |
| Cellular_component | extracellular region Traceable author statement. Source: Reactome integral to membraneInferred from electronic annotation. Source: UniProtKB-KW plasma membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | receptor binding Traceable author statement PubMed 9168114. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 8 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O14511-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O14511-2) The sequence of this isoform differs from the canonical sequence as follows: 374-396: NGFFGQRCLEKLPLRLYMPDPKQ → VGYTGDRCQQFAMVNFS | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: O14511-3) The sequence of this isoform differs from the canonical sequence as follows: 397-397: K → KHLGFELKE | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: O14511-4) The sequence of this isoform differs from the canonical sequence as follows: 374-397: NGFFGQRCLEKLPLRLYMPDPKQK → VGYTGDRCQQFAMVNFSKHLGFELKE | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 5 (identifier: O14511-5) The sequence of this isoform differs from the canonical sequence as follows: 397-426: KAEELYQKRVLTITGICVALLVVGIVCVVA → SVLWDTPGTGVSSSQWSTSPKPRSCTRRGS 427-850: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 6 (identifier: O14511-6) The sequence of this isoform differs from the canonical sequence as follows: 397-422: KAEELYQKRVLTITGICVALLVVGIV → SVLWDTPGTGVSSSQWSTSPSTLDLN 423-850: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform DON-1B (identifier: O14511-7) The sequence of this isoform differs from the canonical sequence as follows: 1-241: Missing. 397-397: K → KHLGFELKE | ||||||
| Isoform DON-1R (identifier: O14511-8) The sequence of this isoform differs from the canonical sequence as follows: 1-233: MRQVCCSALP...EVGKILCTDC → MSESRRRGRGRGKKHPEGRKREREPDPGEK |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Propeptide | 1 – 111 | 111 | By similarity | PRO_0000019472 | |||||||
| Chain | 112 – 850 | 739 | Pro-neuregulin-2, membrane-bound isoform | PRO_0000019473 | |||||||
| Chain | 112 – 404 | 293 | Neuregulin-2 | PRO_0000019474 | |||||||
Regions | |||||||||||
| Topological domain | 112 – 405 | 294 | Extracellular Potential | ||||||||
| Transmembrane | 406 – 426 | 21 | Helical; Note=Internal signal sequence; Potential | ||||||||
| Topological domain | 427 – 850 | 424 | Cytoplasmic Potential | ||||||||
| Domain | 237 – 332 | 96 | Ig-like C2-type | ||||||||
| Domain | 341 – 382 | 42 | EGF-like | ||||||||
| Compositional bias | 10 – 13 | 4 | Poly-Pro | ||||||||
| Compositional bias | 20 – 30 | 11 | Poly-Ser | ||||||||
| Compositional bias | 33 – 47 | 15 | Poly-Ser | ||||||||
| Compositional bias | 87 – 90 | 4 | Poly-Ala | ||||||||
| Compositional bias | 330 – 340 | 11 | Ser/Thr-rich | ||||||||
| Compositional bias | 721 – 727 | 7 | Poly-Pro | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 809 | 1 | Phosphoserine By similarity | ||||||||
| Glycosylation | 52 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 53 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 147 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 278 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 346 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 257 ↔ 311 | By similarity | |||||||||
| Disulfide bond | 345 ↔ 359 | By similarity | |||||||||
| Disulfide bond | 353 ↔ 370 | By similarity | |||||||||
| Disulfide bond | 372 ↔ 381 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 241 | 241 | Missing in isoform DON-1B. | VSP_003452 | |||||||
| Alternative sequence | 1 – 233 | 233 | MRQVC…LCTDC → MSESRRRGRGRGKKHPEGRK REREPDPGEK in isoform DON-1R. | VSP_003451 | |||||||
| Alternative sequence | 374 – 397 | 24 | NGFFG…DPKQK → VGYTGDRCQQFAMVNFSKHL GFELKE in isoform 4. | VSP_003454 | |||||||
| Alternative sequence | 374 – 396 | 23 | NGFFG…PDPKQ → VGYTGDRCQQFAMVNFS in isoform 2. | VSP_003453 | |||||||
| Alternative sequence | 397 – 426 | 30 | KAEEL…VCVVA → SVLWDTPGTGVSSSQWSTSP KPRSCTRRGS in isoform 5. | VSP_003458 | |||||||
| Alternative sequence | 397 – 422 | 26 | KAEEL…VVGIV → SVLWDTPGTGVSSSQWSTSP STLDLN in isoform 6. | VSP_003456 | |||||||
| Alternative sequence | 397 | 1 | K → KHLGFELKE in isoform 3 and isoform DON-1B. | VSP_003455 | |||||||
| Alternative sequence | 423 – 850 | 428 | Missing in isoform 6. | VSP_003457 | |||||||
| Alternative sequence | 427 – 850 | 424 | Missing in isoform 5. | VSP_003459 | |||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| [1] | "A novel brain-derived member of the epidermal growth factor family that interacts with ErbB3 and ErbB4." Higashiyama S., Horikawa M., Yamada K., Ichino N., Nakano N., Nakagawa T., Miyagawa J., Matsushita N., Nagatsu T., Taniguchi N., Ishiguro H. J. Biochem. 122:675-680(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Neuroblastoma. |
| [2] | "Characterization of a neuregulin-related gene, Don-1, that is highly expressed in restricted regions of the cerebellum and hippocampus." Busfield S.J., Michnick D.A., Chickering T.W., Revett T.L., Ma J., Woolf E.A., Comrack C.A., Dussault B.J., Woolf J., Goodearl A.D.J., Gearing D.P. Mol. Cell. Biol. 17:4007-4014(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS DON-1B AND DON-1R). Tissue: Fetal brain. |
| [3] | "The human neuregulin 2 (NRG2) gene: cloning, mapping and evaluation as a candidate for the autosomal recessive form of Charcot-Marie-Tooth disease linked to 5q." Ring H.Z., Chang H., Guilbot A., Brice A., LeGuern E., Francke U. Hum. Genet. 104:326-332(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORMS 1; 2; 3; 4; 5 AND 6). Tissue: Fetal brain and Lung. |
| [4] | "Ligand discrimination in signaling through an ErbB4 receptor homodimer." Sweeney C., Lai C., Riese D.J. II, Diamonti A.J., Cantley L.C., Carraway K.L. III J. Biol. Chem. 275:19803-19807(2000) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH ERBB4. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB005060 mRNA. Translation: BAA23417.1. AF119162 AF119161 Genomic DNA. Translation: AAF28848.1.AF119162 AF119161 Genomic DNA. Translation: AAF28849.1.AF119162 AF119161 Genomic DNA. Translation: AAF28850.1.AF119162 AF119161 Genomic DNA. Translation: AAF28851.1.AF119158 AF119156 Genomic DNA. Translation: AAF28852.1.AF119157 AF119156 Genomic DNA. Translation: AAF28853.1. |
| IPI | IPI00003044. IPI00022325. IPI00217570. IPI00217571. IPI00217572. IPI00217573. IPI00217574. IPI00477848. |
| PIR | JC5700. |
| RefSeq | NP_001171864.1. NM_001184935.1. NP_004874.1. NM_004883.2. NP_053584.1. NM_013981.3. NP_053585.1. NM_013982.2. NP_053586.1. NM_013983.2. |
| UniGene | Hs.408515. |
3D structure databases | |
| ProteinModelPortal | O14511. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000289422. |
PTM databases | |
| PhosphoSite | O14511. |
Proteomic databases | |
| PaxDb | O14511. |
| PRIDE | O14511. |
Protocols and materials databases | |
| DNASU | 9542. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000289409; ENSP00000289409; ENSG00000158458. ENST00000289422; ENSP00000289422; ENSG00000158458. ENST00000340391; ENSP00000342660; ENSG00000158458. ENST00000358522; ENSP00000351323; ENSG00000158458. ENST00000361474; ENSP00000354910; ENSG00000158458. ENST00000378238; ENSP00000367483; ENSG00000158458. ENST00000394770; ENSP00000378251; ENSG00000158458. |
| GeneID | 9542. |
| KEGG | hsa:9542. |
| UCSC | uc003lev.2. human. uc003lew.2. human. uc003lex.2. human. uc003ley.2. human. |
Organism-specific databases | |
| CTD | 9542. |
| GeneCards | GC05M139207. |
| HGNC | HGNC:7998. NRG2. |
| HPA | HPA038935. |
| MIM | 603818. gene. |
| neXtProt | NX_O14511. |
| PharmGKB | PA31777. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG47801. |
| HOGENOM | HOG000273863. |
| HOVERGEN | HBG006531. |
| KO | K05456. |
| OMA | KAGGMRL. |
| OrthoDB | EOG4J9MZF. |
Enzyme and pathway databases | |
| Reactome | REACT_111102. Signal Transduction. REACT_116125. Disease. REACT_6900. Immune System. |
Gene expression databases | |
| ArrayExpress | O14511. |
| Bgee | O14511. |
| CleanEx | HS_NRG2. |
| Genevestigator | O14511. |
| GermOnline | ENSG00000158458. Homo sapiens. |
Family and domain databases | |
| Gene3D | 2.60.40.10. 1 hit. |
| InterPro | IPR000742. EG-like_dom. IPR013032. EGF-like_CS. IPR007110. Ig-like_dom. IPR013783. Ig-like_fold. IPR013098. Ig_I-set. IPR003598. Ig_sub2. IPR002154. Neuregulin_1_C. [Graphical view] |
| Pfam | PF07679. I-set. 1 hit. PF02158. Neuregulin. 1 hit. [Graphical view] |
| SMART | SM00181. EGF. 1 hit. SM00408. IGc2. 1 hit. [Graphical view] |
| PROSITE | PS00022. EGF_1. 1 hit. PS01186. EGF_2. 1 hit. PS50026. EGF_3. 1 hit. PS50835. IG_LIKE. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 9542. |
| NextBio | 35779. |
| SOURCE | Search... |
Entry information
| Entry name | NRG2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O14511 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 5 Human chromosome 5: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
