Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Pro-neuregulin-2, membrane-bound isoform

Gene

NRG2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. May also promote the heterodimerization with the EGF receptor.

GO - Molecular functioni

  • receptor binding Source: ProtInc

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Growth factor

Enzyme and pathway databases

ReactomeiREACT_115596. Signaling by ERBB4.
REACT_115662. Downregulation of ERBB2:ERBB3 signaling.
REACT_115755. Signaling by ERBB2.
REACT_115854. GRB2 events in ERBB2 signaling.
REACT_115896. GRB7 events in ERBB2 signaling.
REACT_115961. PI3K events in ERBB4 signaling.
REACT_115993. SHC1 events in ERBB2 signaling.
REACT_116005. SHC1 events in ERBB4 signaling.
REACT_116008. PI3K events in ERBB2 signaling.
REACT_116022. Nuclear signaling by ERBB4.
REACT_147727. Constitutive Signaling by Aberrant PI3K in Cancer.
REACT_75829. PIP3 activates AKT signaling.
SignaLinkiO14511.

Names & Taxonomyi

Protein namesi
Recommended name:
Pro-neuregulin-2, membrane-bound isoform
Short name:
Pro-NRG2
Cleaved into the following chain:
Neuregulin-2
Short name:
NRG-2
Alternative name(s):
Divergent of neuregulin-1
Short name:
DON-1
Neural- and thymus-derived activator for ERBB kinases
Short name:
NTAK
Gene namesi
Name:NRG2
Synonyms:NTAK
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 5

Organism-specific databases

HGNCiHGNC:7998. NRG2.

Subcellular locationi

Pro-neuregulin-2, membrane-bound isoform :
Neuregulin-2 :

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini112 – 405294ExtracellularSequence AnalysisAdd
BLAST
Transmembranei406 – 42621Helical; Note=Internal signal sequenceSequence AnalysisAdd
BLAST
Topological domaini427 – 850424CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA31777.

Polymorphism and mutation databases

BioMutaiNRG2.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Propeptidei1 – 111111By similarityPRO_0000019472Add
BLAST
Chaini112 – 850739Pro-neuregulin-2, membrane-bound isoformPRO_0000019473Add
BLAST
Chaini112 – 404293Neuregulin-2PRO_0000019474Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi52 – 521N-linked (GlcNAc...)Sequence Analysis
Glycosylationi53 – 531N-linked (GlcNAc...)Sequence Analysis
Glycosylationi147 – 1471N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi257 ↔ 311By similarity
Glycosylationi278 – 2781N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi345 ↔ 359By similarity
Glycosylationi346 – 3461N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi353 ↔ 370By similarity
Disulfide bondi372 ↔ 381By similarity

Post-translational modificationi

Proteolytic cleavage close to the plasma membrane on the external face leads to the release of the soluble growth factor form.By similarity
Extensive glycosylation precedes the proteolytic cleavage.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiO14511.
PRIDEiO14511.

PTM databases

PhosphoSiteiO14511.

Expressioni

Tissue specificityi

Restricted to the cerebellum in the adult.

Gene expression databases

BgeeiO14511.
CleanExiHS_NRG2.
ExpressionAtlasiO14511. baseline and differential.
GenevisibleiO14511. HS.

Organism-specific databases

HPAiHPA038935.
HPA047973.

Interactioni

Subunit structurei

Interacts with ERBB3 and ERBB4.1 Publication

Protein-protein interaction databases

BioGridi114917. 2 interactions.
STRINGi9606.ENSP00000354910.

Structurei

3D structure databases

ProteinModelPortaliO14511.
SMRiO14511. Positions 249-330, 339-381.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini237 – 33296Ig-like C2-typeAdd
BLAST
Domaini341 – 38242EGF-likePROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi10 – 134Poly-Pro
Compositional biasi20 – 3011Poly-SerAdd
BLAST
Compositional biasi33 – 4715Poly-SerAdd
BLAST
Compositional biasi87 – 904Poly-Ala
Compositional biasi330 – 34011Ser/Thr-richAdd
BLAST
Compositional biasi721 – 7277Poly-Pro

Domaini

The cytoplasmic domain may be involved in the regulation of trafficking and proteolytic processing. Regulation of the proteolytic processing involves initial intracellular domain dimerization (By similarity).By similarity
ERBB receptor binding is elicited entirely by the EGF-like domain.By similarity

Sequence similaritiesi

Belongs to the neuregulin family.Curated
Contains 1 EGF-like domain.PROSITE-ProRule annotation

Keywords - Domaini

EGF-like domain, Immunoglobulin domain, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG47801.
GeneTreeiENSGT00710000106660.
HOGENOMiHOG000273863.
HOVERGENiHBG006531.
InParanoidiO14511.
KOiK05456.
OMAiFGPRCLQ.
OrthoDBiEOG7F7W86.
PhylomeDBiO14511.
TreeFamiTF332469.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR000742. EG-like_dom.
IPR013032. EGF-like_CS.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003598. Ig_sub2.
IPR002154. Neuregulin_1_C.
[Graphical view]
PfamiPF07679. I-set. 1 hit.
PF02158. Neuregulin. 1 hit.
[Graphical view]
SMARTiSM00181. EGF. 1 hit.
SM00408. IGc2. 1 hit.
[Graphical view]
PROSITEiPS00022. EGF_1. 1 hit.
PS01186. EGF_2. 1 hit.
PS50026. EGF_3. 1 hit.
PS50835. IG_LIKE. 1 hit.
[Graphical view]

Sequences (8)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 8 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O14511-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRQVCCSALP PPPLEKGRCS SYSDSSSSSS ERSSSSSSSS SESGSSSRSS
60 70 80 90 100
SNNSSISRPA APPEPRPQQQ PQPRSPAARR AAARSRAAAA GGMRRDPAPG
110 120 130 140 150
FSMLLFGVSL ACYSPSLKSV QDQAYKAPVV VEGKVQGLVP AGGSSSNSTR
160 170 180 190 200
EPPASGRVAL VKVLDKWPLR SGGLQREQVI SVGSCVPLER NQRYIFFLEP
210 220 230 240 250
TEQPLVFKTA FAPLDTNGKN LKKEVGKILC TDCATRPKLK KMKSQTGQVG
260 270 280 290 300
EKQSLKCEAA AGNPQPSYRW FKDGKELNRS RDIRIKYGNG RKNSRLQFNK
310 320 330 340 350
VKVEDAGEYV CEAENILGKD TVRGRLYVNS VSTTLSSWSG HARKCNETAK
360 370 380 390 400
SYCVNGGVCY YIEGINQLSC KCPNGFFGQR CLEKLPLRLY MPDPKQKAEE
410 420 430 440 450
LYQKRVLTIT GICVALLVVG IVCVVAYCKT KKQRKQMHNH LRQNMCPAHQ
460 470 480 490 500
NRSLANGPSH PRLDPEEIQM ADYISKNVPA TDHVIRRETE TTFSGSHSCS
510 520 530 540 550
PSHHCSTATP TSSHRHESHT WSLERSESLT SDSQSGIMLS SVGTSKCNSP
560 570 580 590 600
ACVEARARRA AAYNLEERRR ATAPPYHDSV DSLRDSPHSE RYVSALTTPA
610 620 630 640 650
RLSPVDFHYS LATQVPTFEI TSPNSAHAVS LPPAAPISYR LAEQQPLLRH
660 670 680 690 700
PAPPGPGPGP GPGPGPGADM QRSYDSYYYP AAGPGPRRGT CALGGSLGSL
710 720 730 740 750
PASPFRIPED DEYETTQECA PPPPPRPRAR GASRRTSAGP RRWRRSRLNG
760 770 780 790 800
LAAQRARAAR DSLSLSSGSG GGSASASDDD ADDADGALAA ESTPFLGLRG
810 820 830 840 850
AHDALRSDSP PLCPAADSRT YYSLDSHSTR ASSRHSRGPP PRAKQDSAPL
Length:850
Mass (Da):91,679
Last modified:January 1, 1998 - v1
Checksum:i7124C089435FD2F4
GO
Isoform 2 (identifier: O14511-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     374-396: NGFFGQRCLEKLPLRLYMPDPKQ → VGYTGDRCQQFAMVNFS

Note: No experimental confirmation available.
Show »
Length:844
Mass (Da):90,851
Checksum:iA68F2D2C96C3C1C1
GO
Isoform 3 (identifier: O14511-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     397-397: K → KHLGFELKE

Note: No experimental confirmation available.
Show »
Length:858
Mass (Da):92,633
Checksum:i171976A9397EA0B1
GO
Isoform 4 (identifier: O14511-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     374-397: NGFFGQRCLEKLPLRLYMPDPKQK → VGYTGDRCQQFAMVNFSKHLGFELKE

Note: No experimental confirmation available.
Show »
Length:852
Mass (Da):91,805
Checksum:iFDE8AEB0E1C6F94B
GO
Isoform 5 (identifier: O14511-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     397-426: KAEELYQKRVLTITGICVALLVVGIVCVVA → SVLWDTPGTGVSSSQWSTSPKPRSCTRRGS
     427-850: Missing.

Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:426
Mass (Da):46,183
Checksum:iADC950AED919D5F4
GO
Isoform 6 (identifier: O14511-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     397-422: KAEELYQKRVLTITGICVALLVVGIV → SVLWDTPGTGVSSSQWSTSPSTLDLN
     423-850: Missing.

Note: No experimental confirmation available.
Show »
Length:422
Mass (Da):45,698
Checksum:i5CF05AF7A682310D
GO
Isoform DON-1B (identifier: O14511-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-241: Missing.
     397-397: K → KHLGFELKE

Show »
Length:617
Mass (Da):67,126
Checksum:i89A81CE27CE00B5C
GO
Isoform DON-1R (identifier: O14511-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-233: MRQVCCSALP...EVGKILCTDC → MSESRRRGRGRGKKHPEGRKREREPDPGEK

Show »
Length:647
Mass (Da):70,637
Checksum:iD1D5FDAF07CB3393
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 241241Missing in isoform DON-1B. 1 PublicationVSP_003452Add
BLAST
Alternative sequencei1 – 233233MRQVC…LCTDC → MSESRRRGRGRGKKHPEGRK REREPDPGEK in isoform DON-1R. 1 PublicationVSP_003451Add
BLAST
Alternative sequencei374 – 39724NGFFG…DPKQK → VGYTGDRCQQFAMVNFSKHL GFELKE in isoform 4. CuratedVSP_003454Add
BLAST
Alternative sequencei374 – 39623NGFFG…PDPKQ → VGYTGDRCQQFAMVNFS in isoform 2. CuratedVSP_003453Add
BLAST
Alternative sequencei397 – 42630KAEEL…VCVVA → SVLWDTPGTGVSSSQWSTSP KPRSCTRRGS in isoform 5. CuratedVSP_003458Add
BLAST
Alternative sequencei397 – 42226KAEEL…VVGIV → SVLWDTPGTGVSSSQWSTSP STLDLN in isoform 6. CuratedVSP_003456Add
BLAST
Alternative sequencei397 – 3971K → KHLGFELKE in isoform 3 and isoform DON-1B. 1 PublicationVSP_003455
Alternative sequencei423 – 850428Missing in isoform 6. CuratedVSP_003457Add
BLAST
Alternative sequencei427 – 850424Missing in isoform 5. CuratedVSP_003459Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB005060 mRNA. Translation: BAA23417.1.
AF119162
, AF119151, AF119152, AF119153, AF119154, AF119155, AF119158, AF119159, AF119160, AF119161 Genomic DNA. Translation: AAF28848.1.
AF119162
, AF119151, AF119152, AF119153, AF119154, AF119156, AF119158, AF119159, AF119160, AF119161 Genomic DNA. Translation: AAF28849.1.
AF119162
, AF119151, AF119152, AF119153, AF119154, AF119155, AF119157, AF119158, AF119159, AF119160, AF119161 Genomic DNA. Translation: AAF28850.1.
AF119162
, AF119151, AF119152, AF119153, AF119154, AF119156, AF119157, AF119158, AF119159, AF119160, AF119161 Genomic DNA. Translation: AAF28851.1.
AF119158
, AF119151, AF119152, AF119153, AF119154, AF119155, AF119156 Genomic DNA. Translation: AAF28852.1.
AF119157
, AF119151, AF119152, AF119153, AF119154, AF119155, AF119156 Genomic DNA. Translation: AAF28853.1.
CCDSiCCDS4217.1. [O14511-1]
PIRiJC5700.
RefSeqiNP_001171864.1. NM_001184935.1.
NP_004874.1. NM_004883.2. [O14511-1]
NP_053584.1. NM_013981.3. [O14511-2]
NP_053585.1. NM_013982.2. [O14511-3]
NP_053586.1. NM_013983.2. [O14511-4]
XP_006714871.1. XM_006714808.1. [O14511-8]
XP_006714873.1. XM_006714810.2. [O14511-6]
UniGeneiHs.408515.

Genome annotation databases

EnsembliENST00000289409; ENSP00000289409; ENSG00000158458. [O14511-2]
ENST00000289422; ENSP00000289422; ENSG00000158458. [O14511-3]
ENST00000340391; ENSP00000342660; ENSG00000158458. [O14511-8]
ENST00000358522; ENSP00000351323; ENSG00000158458. [O14511-4]
ENST00000361474; ENSP00000354910; ENSG00000158458. [O14511-1]
ENST00000378238; ENSP00000367483; ENSG00000158458. [O14511-5]
GeneIDi9542.
KEGGihsa:9542.
UCSCiuc003lev.2. human. [O14511-3]
uc003lew.2. human. [O14511-4]
uc003lex.2. human. [O14511-1]
uc003ley.2. human. [O14511-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB005060 mRNA. Translation: BAA23417.1.
AF119162
, AF119151, AF119152, AF119153, AF119154, AF119155, AF119158, AF119159, AF119160, AF119161 Genomic DNA. Translation: AAF28848.1.
AF119162
, AF119151, AF119152, AF119153, AF119154, AF119156, AF119158, AF119159, AF119160, AF119161 Genomic DNA. Translation: AAF28849.1.
AF119162
, AF119151, AF119152, AF119153, AF119154, AF119155, AF119157, AF119158, AF119159, AF119160, AF119161 Genomic DNA. Translation: AAF28850.1.
AF119162
, AF119151, AF119152, AF119153, AF119154, AF119156, AF119157, AF119158, AF119159, AF119160, AF119161 Genomic DNA. Translation: AAF28851.1.
AF119158
, AF119151, AF119152, AF119153, AF119154, AF119155, AF119156 Genomic DNA. Translation: AAF28852.1.
AF119157
, AF119151, AF119152, AF119153, AF119154, AF119155, AF119156 Genomic DNA. Translation: AAF28853.1.
CCDSiCCDS4217.1. [O14511-1]
PIRiJC5700.
RefSeqiNP_001171864.1. NM_001184935.1.
NP_004874.1. NM_004883.2. [O14511-1]
NP_053584.1. NM_013981.3. [O14511-2]
NP_053585.1. NM_013982.2. [O14511-3]
NP_053586.1. NM_013983.2. [O14511-4]
XP_006714871.1. XM_006714808.1. [O14511-8]
XP_006714873.1. XM_006714810.2. [O14511-6]
UniGeneiHs.408515.

3D structure databases

ProteinModelPortaliO14511.
SMRiO14511. Positions 249-330, 339-381.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114917. 2 interactions.
STRINGi9606.ENSP00000354910.

PTM databases

PhosphoSiteiO14511.

Polymorphism and mutation databases

BioMutaiNRG2.

Proteomic databases

PaxDbiO14511.
PRIDEiO14511.

Protocols and materials databases

DNASUi9542.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000289409; ENSP00000289409; ENSG00000158458. [O14511-2]
ENST00000289422; ENSP00000289422; ENSG00000158458. [O14511-3]
ENST00000340391; ENSP00000342660; ENSG00000158458. [O14511-8]
ENST00000358522; ENSP00000351323; ENSG00000158458. [O14511-4]
ENST00000361474; ENSP00000354910; ENSG00000158458. [O14511-1]
ENST00000378238; ENSP00000367483; ENSG00000158458. [O14511-5]
GeneIDi9542.
KEGGihsa:9542.
UCSCiuc003lev.2. human. [O14511-3]
uc003lew.2. human. [O14511-4]
uc003lex.2. human. [O14511-1]
uc003ley.2. human. [O14511-2]

Organism-specific databases

CTDi9542.
GeneCardsiGC05M139207.
HGNCiHGNC:7998. NRG2.
HPAiHPA038935.
HPA047973.
MIMi603818. gene.
neXtProtiNX_O14511.
PharmGKBiPA31777.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG47801.
GeneTreeiENSGT00710000106660.
HOGENOMiHOG000273863.
HOVERGENiHBG006531.
InParanoidiO14511.
KOiK05456.
OMAiFGPRCLQ.
OrthoDBiEOG7F7W86.
PhylomeDBiO14511.
TreeFamiTF332469.

Enzyme and pathway databases

ReactomeiREACT_115596. Signaling by ERBB4.
REACT_115662. Downregulation of ERBB2:ERBB3 signaling.
REACT_115755. Signaling by ERBB2.
REACT_115854. GRB2 events in ERBB2 signaling.
REACT_115896. GRB7 events in ERBB2 signaling.
REACT_115961. PI3K events in ERBB4 signaling.
REACT_115993. SHC1 events in ERBB2 signaling.
REACT_116005. SHC1 events in ERBB4 signaling.
REACT_116008. PI3K events in ERBB2 signaling.
REACT_116022. Nuclear signaling by ERBB4.
REACT_147727. Constitutive Signaling by Aberrant PI3K in Cancer.
REACT_75829. PIP3 activates AKT signaling.
SignaLinkiO14511.

Miscellaneous databases

GeneWikiiNRG2.
GenomeRNAii9542.
NextBioi35779.
PROiO14511.
SOURCEiSearch...

Gene expression databases

BgeeiO14511.
CleanExiHS_NRG2.
ExpressionAtlasiO14511. baseline and differential.
GenevisibleiO14511. HS.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR000742. EG-like_dom.
IPR013032. EGF-like_CS.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003598. Ig_sub2.
IPR002154. Neuregulin_1_C.
[Graphical view]
PfamiPF07679. I-set. 1 hit.
PF02158. Neuregulin. 1 hit.
[Graphical view]
SMARTiSM00181. EGF. 1 hit.
SM00408. IGc2. 1 hit.
[Graphical view]
PROSITEiPS00022. EGF_1. 1 hit.
PS01186. EGF_2. 1 hit.
PS50026. EGF_3. 1 hit.
PS50835. IG_LIKE. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "A novel brain-derived member of the epidermal growth factor family that interacts with ErbB3 and ErbB4."
    Higashiyama S., Horikawa M., Yamada K., Ichino N., Nakano N., Nakagawa T., Miyagawa J., Matsushita N., Nagatsu T., Taniguchi N., Ishiguro H.
    J. Biochem. 122:675-680(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Neuroblastoma.
  2. "Characterization of a neuregulin-related gene, Don-1, that is highly expressed in restricted regions of the cerebellum and hippocampus."
    Busfield S.J., Michnick D.A., Chickering T.W., Revett T.L., Ma J., Woolf E.A., Comrack C.A., Dussault B.J., Woolf J., Goodearl A.D.J., Gearing D.P.
    Mol. Cell. Biol. 17:4007-4014(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS DON-1B AND DON-1R).
    Tissue: Fetal brain.
  3. "The human neuregulin 2 (NRG2) gene: cloning, mapping and evaluation as a candidate for the autosomal recessive form of Charcot-Marie-Tooth disease linked to 5q."
    Ring H.Z., Chang H., Guilbot A., Brice A., LeGuern E., Francke U.
    Hum. Genet. 104:326-332(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORMS 1; 2; 3; 4; 5 AND 6).
    Tissue: Fetal brain and Lung.
  4. "Ligand discrimination in signaling through an ErbB4 receptor homodimer."
    Sweeney C., Lai C., Riese D.J. II, Diamonti A.J., Cantley L.C., Carraway K.L. III
    J. Biol. Chem. 275:19803-19807(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH ERBB4.

Entry informationi

Entry nameiNRG2_HUMAN
AccessioniPrimary (citable) accession number: O14511
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 15, 1998
Last sequence update: January 1, 1998
Last modified: June 24, 2015
This is version 137 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.