Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

O14490 (DLGP1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified March 19, 2014. Version 112. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Disks large-associated protein 1

Short name=DAP-1
Alternative name(s):
Guanylate kinase-associated protein
Short name=hGKAP
PSD-95/SAP90-binding protein 1
SAP90/PSD-95-associated protein 1
Short name=SAPAP1
Gene names
Name:DLGAP1
Synonyms:DAP1, GKAP
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length977 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Part of the postsynaptic scaffold in neuronal cells.

Subunit structure

Interacts with guanylate kinase-like domain of DLG1, DLG2, DLG3, DLG4 and AIP1. Interacts with the PDZ domain of SHANK1, SHANK2 and SHANK3. Found in a complex with DLG4 and SHANK1, SHANK2 or SHANK3. Found in a complex with DLG4 and BEGAIN. Interacts with DYL2 and LRFN1 By similarity.

Subcellular location

Cell membrane; Peripheral membrane protein By similarity. Cell junctionsynapsepostsynaptic cell membranepostsynaptic density By similarity. Cell junctionsynapse By similarity.

Tissue specificity

Expressed in brain.

Sequence similarities

Belongs to the SAPAP family.

Binary interactions

Alternative products

This entry describes 7 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: O14490-1)

Also known as: DAP1-alpha;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: O14490-2)

Also known as: DAP1-beta;

The sequence of this isoform differs from the canonical sequence as follows:
     1-302: Missing.
     303-319: MVKSESCQQERSCQYLQ → MNLIFHKDILFGIPANK
Isoform 3 (identifier: O14490-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-302: Missing.
     303-319: MVKSESCQQERSCQYLQ → MNLIFHKDILFGIPANK
     909-929: ERRAPPPVPKKPAKGPAPLIR → VEQCRFCMVHLKTCTNTGQSK
     930-977: Missing.
Isoform 4 (identifier: O14490-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-24: MKGLSGSRSHHHGVTCDSACDSLS → MIDLFKAEWVSSVCVQVSRNGRTD
     25-318: Missing.
Note: No experimental confirmation available.
Isoform 5 (identifier: O14490-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1-31: MKGLSGSRSHHHGVTCDSACDSLSHHSDRKP → MDLKTLKLFNSQLRCGWLLYIWNKAFMAHLR
     32-319: Missing.
     530-557: Missing.
Note: No experimental confirmation available.
Isoform 6 (identifier: O14490-6)

The sequence of this isoform differs from the canonical sequence as follows:
     1-17: MKGLSGSRSHHHGVTCD → MNLIFHKDILFGIPANK
     18-31: Missing.
     32-319: Missing.
     530-530: T → TGVIKLSSAVE
Note: No experimental confirmation available.
Isoform 7 (identifier: O14490-7)

The sequence of this isoform differs from the canonical sequence as follows:
     909-929: ERRAPPPVPKKPAKGPAPLIR → VEQCRFCMVHLKTCTNTGQSK
     930-977: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 977977Disks large-associated protein 1
PRO_0000174288

Regions

Region650 – 66112Interaction with DYL2 By similarity
Region672 – 68312Interaction with DYL2 By similarity
Motif975 – 9773PDZ-binding By similarity
Compositional bias622 – 6309Poly-Thr

Amino acid modifications

Modified residue3561Phosphoserine By similarity
Modified residue5031Phosphoserine By similarity
Modified residue5101Phosphoserine By similarity
Modified residue9321Phosphoserine By similarity

Natural variations

Alternative sequence1 – 302302Missing in isoform 2 and isoform 3.
VSP_006003
Alternative sequence1 – 3131MKGLS…SDRKP → MDLKTLKLFNSQLRCGWLLY IWNKAFMAHLR in isoform 5.
VSP_043718
Alternative sequence1 – 2424MKGLS…CDSLS → MIDLFKAEWVSSVCVQVSRN GRTD in isoform 4.
VSP_043222
Alternative sequence1 – 1717MKGLS…GVTCD → MNLIFHKDILFGIPANK in isoform 6.
VSP_043719
Alternative sequence18 – 3114Missing in isoform 6.
VSP_043720
Alternative sequence25 – 318294Missing in isoform 4.
VSP_043223
Alternative sequence32 – 319288Missing in isoform 5 and isoform 6.
VSP_043721
Alternative sequence303 – 31917MVKSE…CQYLQ → MNLIFHKDILFGIPANK in isoform 2 and isoform 3.
VSP_006004
Alternative sequence530 – 55728Missing in isoform 5.
VSP_043722
Alternative sequence5301T → TGVIKLSSAVE in isoform 6.
VSP_043723
Alternative sequence909 – 92921ERRAP…APLIR → VEQCRFCMVHLKTCTNTGQS K in isoform 3 and isoform 7.
VSP_006005
Alternative sequence930 – 97748Missing in isoform 3 and isoform 7.
VSP_006006
Natural variant8161R → Q.
Corresponds to variant rs35822832 [ dbSNP | Ensembl ].
VAR_053648

Experimental info

Sequence conflict7341A → P in AAC51119. Ref.2
Sequence conflict7401S → T in AAC51119. Ref.2
Sequence conflict752 – 7532AA → SP in AAC51119. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (DAP1-alpha) [UniParc].

Last modified January 1, 1998. Version 1.
Checksum: 670F72B17D9BE667

FASTA977108,873
        10         20         30         40         50         60 
MKGLSGSRSH HHGVTCDSAC DSLSHHSDRK PYLLSPVEHH PADHPYYTQR NSFQAECVGP 

        70         80         90        100        110        120 
FSDPLASSTF PRRHYTSQQE LKDECALVPR TLATKANRIP ANLLDQFERQ LPLSRDGYHT 

       130        140        150        160        170        180 
LQYKRTAVEH RSDSPGRIRH LVHSVQKLFT KSHSLEGPSK GSVNGGKASP DEAQAARYGK 

       190        200        210        220        230        240 
RSKSKERRAE PKARPSTSPG WWSSDDNLDG DMCIYHAPSG VMTMGRCPDR SASQYFLEAY 

       250        260        270        280        290        300 
NTISEQAVKA SRSNNDVKCS TCANLPVSLD TPLLKKSAWS STLTVSRARE VYQKASVNMD 

       310        320        330        340        350        360 
QAMVKSESCQ QERSCQYLQV PQDEWTGYTP RGKDDEIPCR RMRSGSYIKA MGDEDSGDSD 

       370        380        390        400        410        420 
TSPKPSPKVA ARRESYLKAT QPSLTELTTL KISNEHSPKL QIRSHSYLRA VSEVSINRSL 

       430        440        450        460        470        480 
DSLDPAGLLT SPKFRSRNES YMRAMSTISQ VSEMEVNGQF ESVCESVFSE LESQAVEALD 

       490        500        510        520        530        540 
LPMPGCFRMR SHSYVRAIEK GCSQDDECVS LRSSSPPRTT TTVRTIQSST VSSCITTYKK 

       550        560        570        580        590        600 
TPPPVPPRTT TKPFISITAQ SSTESAQDAY MDGQGQRGDI ISQSGLSNST ESLDSMKALT 

       610        620        630        640        650        660 
AAIEAANAQI HGPASQHMGN NTATVTTTTT IATVTTEDRK KDHFKKNRCL SIGIQVDDAE 

       670        680        690        700        710        720 
EPDKTGENKA PSKFQSVGVQ VEEEKCFRRF TRSNSVTTAV QADLDFHDNL ENSLESIEDN 

       730        740        750        760        770        780 
SCPGPMARQF SRDASTSTVS IQGSGNHYHA CAADDDFDTD FDPSILPPPD PWIDSITEDP 

       790        800        810        820        830        840 
LEAVQRSVCH RDGHWFLKLL QAERDRMEGW CQQMEREERE NNLPEDILGK IRTAVGSAQL 

       850        860        870        880        890        900 
LMAQKFYQFR ELCEENLNPN AHPRPTSQDL AGFWDMLQLS IENISMKFDE LHQLKANNWK 

       910        920        930        940        950        960 
QMDPLDKKER RAPPPVPKKP AKGPAPLIRE RSLESSQRQE ARKRLMAAKR AASVRQNSAT 

       970 
ESAESIEIYI PEAQTRL 

« Hide

Isoform 2 (DAP1-beta) [UniParc].

Checksum: A88274F7F3D9F5ED
Show »

FASTA67575,261
Isoform 3 [UniParc].

Checksum: 2326123341316726
Show »

FASTA62769,969
Isoform 4 [UniParc].

Checksum: 8F23FC02956683BE
Show »

FASTA68376,159
Isoform 5 [UniParc].

Checksum: 5A96B64BA7D70469
Show »

FASTA66174,058
Isoform 6 [UniParc].

Checksum: ACBD1D7BB4CC8756
Show »

FASTA68576,245
Isoform 7 [UniParc].

Checksum: 00E65FE3F36B7D6B
Show »

FASTA929103,581

References

« Hide 'large scale' references
[1]"DAP-1, a novel protein that interacts with the guanylate kinase-like domains of hDLG and PSD-95."
Satoh K., Yanai H., Senda T., Kohu K., Nakamura T., Okumura N., Matsumine A., Kobayashi S., Toyoshima K., Akiyama T.
Genes Cells 2:415-424(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
Tissue: Brain.
[2]"GKAP, a novel synaptic protein that interacts with the guanylate kinase-like domain of the PSD-95/SAP90 family of channel clustering molecules."
Kim E., Naisbitt S., Hsueh Y.-P., Rao A., Rothschild A., Craig A.M., Sheng M.
J. Cell Biol. 136:669-678(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4; 5; 6 AND 7).
Tissue: Brain and Thalamus.
[4]"DNA sequence and analysis of human chromosome 18."
Nusbaum C., Zody M.C., Borowsky M.L., Kamal M., Kodira C.D., Taylor T.D., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Abouelleil A., Allen N.R., Anderson S., Bloom T., Bugalter B., Butler J. expand/collapse author list , Cook A., DeCaprio D., Engels R., Garber M., Gnirke A., Hafez N., Hall J.L., Norman C.H., Itoh T., Jaffe D.B., Kuroki Y., Lehoczky J., Lui A., Macdonald P., Mauceli E., Mikkelsen T.S., Naylor J.W., Nicol R., Nguyen C., Noguchi H., O'Leary S.B., Piqani B., Smith C.L., Talamas J.A., Topham K., Totoki Y., Toyoda A., Wain H.M., Young S.K., Zeng Q., Zimmer A.R., Fujiyama A., Hattori M., Birren B.W., Sakaki Y., Lander E.S.
Nature 437:551-555(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Brain and Testis.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB000277 mRNA. Translation: BAA23258.1.
AB000276 mRNA. Translation: BAA23257.1.
U67988 mRNA. Translation: AAC51119.1.
AK294717 mRNA. Translation: BAH11858.1.
AK294747 mRNA. Translation: BAH11868.1.
AK299880 mRNA. Translation: BAH13160.1.
AK316099 mRNA. Translation: BAH14470.1.
AP002472 Genomic DNA. No translation available.
AP002478 Genomic DNA. No translation available.
AP005130 Genomic DNA. No translation available.
AP005204 Genomic DNA. No translation available.
AP005241 Genomic DNA. No translation available.
CH471113 Genomic DNA. Translation: EAX01654.1.
CH471113 Genomic DNA. Translation: EAX01658.1.
CH471113 Genomic DNA. Translation: EAX01659.1.
BC136453 mRNA. Translation: AAI36454.1.
BC136454 mRNA. Translation: AAI36455.1.
PIRT00014.
RefSeqNP_001003809.1. NM_001003809.2.
NP_001229690.1. NM_001242761.1.
NP_001229691.1. NM_001242762.1.
NP_001229692.1. NM_001242763.1.
NP_001229693.1. NM_001242764.1.
NP_001229694.1. NM_001242765.1.
NP_001229695.1. NM_001242766.1.
NP_004737.2. NM_004746.3.
UniGeneHs.594640.
Hs.654793.

3D structure databases

ProteinModelPortalO14490.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid114660. 18 interactions.
IntActO14490. 12 interactions.
MINTMINT-2795054.
STRING9606.ENSP00000316377.

PTM databases

PhosphoSiteO14490.

Proteomic databases

PaxDbO14490.
PRIDEO14490.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000315677; ENSP00000316377; ENSG00000170579. [O14490-1]
ENST00000400145; ENSP00000383010; ENSG00000170579. [O14490-3]
ENST00000400147; ENSP00000383011; ENSG00000170579. [O14490-2]
ENST00000400155; ENSP00000383019; ENSG00000170579. [O14490-4]
ENST00000515196; ENSP00000445973; ENSG00000170579. [O14490-7]
ENST00000534970; ENSP00000437817; ENSG00000170579. [O14490-5]
ENST00000539435; ENSP00000446312; ENSG00000170579. [O14490-6]
ENST00000581527; ENSP00000463864; ENSG00000170579. [O14490-7]
ENST00000581699; ENSP00000462848; ENSG00000170579. [O14490-4]
ENST00000584874; ENSP00000462882; ENSG00000170579. [O14490-1]
GeneID9229.
KEGGhsa:9229.
UCSCuc002kme.2. human. [O14490-2]
uc002kmf.3. human. [O14490-1]
uc002kmg.3. human. [O14490-3]
uc010dkn.3. human. [O14490-6]
uc010wyw.2. human. [O14490-4]
uc010wyy.2. human. [O14490-5]
uc010wyz.2. human. [O14490-7]

Organism-specific databases

CTD9229.
GeneCardsGC18M003488.
HGNCHGNC:2905. DLGAP1.
HPAHPA040963.
MIM605445. gene.
neXtProtNX_O14490.
PharmGKBPA27361.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG277836.
HOGENOMHOG000015346.
HOVERGENHBG018957.
InParanoidO14490.
KOK15008.
OMAAVEVSSC.
OrthoDBEOG75QR37.
PhylomeDBO14490.
TreeFamTF321382.

Gene expression databases

ArrayExpressO14490.
BgeeO14490.
CleanExHS_DLGAP1.
GenevestigatorO14490.

Family and domain databases

InterProIPR005026. GKAP.
[Graphical view]
PfamPF03359. GKAP. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSDLGAP1. human.
GeneWikiDLGAP1.
GenomeRNAi9229.
NextBio34591.
PROO14490.
SOURCESearch...

Entry information

Entry nameDLGP1_HUMAN
AccessionPrimary (citable) accession number: O14490
Secondary accession number(s): A8MWN8 expand/collapse secondary AC list , B2RMU8, B7WPA1, B7Z2H2, B7Z2I2, B7Z9Y4, O14489, P78335
Entry history
Integrated into UniProtKB/Swiss-Prot: September 26, 2001
Last sequence update: January 1, 1998
Last modified: March 19, 2014
This is version 112 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 18

Human chromosome 18: entries, gene names and cross-references to MIM