O14490 (DLGP1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 103.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Disks large-associated protein 1 Short name=DAP-1 Alternative name(s): Guanylate kinase-associated protein Short name=hGKAP PSD-95/SAP90-binding protein 1 SAP90/PSD-95-associated protein 1 Short name=SAPAP1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 977 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Part of the postsynaptic scaffold in neuronal cells. |
| Subunit structure | Interacts with guanylate kinase-like domain of DLG1, DLG2, DLG3, DLG4 and AIP1. Interacts with the PDZ domain of SHANK1, SHANK2 and SHANK3. Found in a complex with DLG4 and SHANK1, SHANK2 or SHANK3. Found in a complex with DLG4 and BEGAIN. Interacts with DYL2 and LRFN1 By similarity. |
| Subcellular location | Cell membrane; Peripheral membrane protein By similarity. Cell junction › synapse › postsynaptic cell membrane › postsynaptic density By similarity. Cell junction › synapse By similarity. Note: Found in postsynaptic density of neuronal cells By similarity. |
| Tissue specificity | Expressed in brain. |
| Sequence similarities | Belongs to the SAPAP family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell junction Cell membrane Membrane Postsynaptic cell membrane Synapse |
| Coding sequence diversity | Alternative splicing Polymorphism |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | synaptic transmission Non-traceable author statement Ref.1. Source: UniProtKB |
| Cellular_component | cell junction Inferred from electronic annotation. Source: UniProtKB-KW plasma membraneInferred from electronic annotation. Source: UniProtKB-SubCell postsynaptic densityInferred from electronic annotation. Source: UniProtKB-SubCell postsynaptic membraneInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| GRB2 | P62993 | 3 | EBI-1753207,EBI-401755 | |
| NCK1 | P16333 | 4 | EBI-1753207,EBI-389883 |
Alternative products
| This entry describes 7 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O14490-1) Also known as: DAP1-alpha; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O14490-2) Also known as: DAP1-beta; The sequence of this isoform differs from the canonical sequence as follows: 1-302: Missing. 303-319: MVKSESCQQERSCQYLQ → MNLIFHKDILFGIPANK | ||||||
| Isoform 3 (identifier: O14490-3) The sequence of this isoform differs from the canonical sequence as follows: 1-302: Missing. 303-319: MVKSESCQQERSCQYLQ → MNLIFHKDILFGIPANK 909-929: ERRAPPPVPKKPAKGPAPLIR → VEQCRFCMVHLKTCTNTGQSK 930-977: Missing. | ||||||
| Isoform 4 (identifier: O14490-4) The sequence of this isoform differs from the canonical sequence as follows: 1-24: MKGLSGSRSHHHGVTCDSACDSLS → MIDLFKAEWVSSVCVQVSRNGRTD 25-318: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 5 (identifier: O14490-5) The sequence of this isoform differs from the canonical sequence as follows: 1-31: MKGLSGSRSHHHGVTCDSACDSLSHHSDRKP → MDLKTLKLFNSQLRCGWLLYIWNKAFMAHLR 32-319: Missing. 530-557: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 6 (identifier: O14490-6) The sequence of this isoform differs from the canonical sequence as follows: 1-17: MKGLSGSRSHHHGVTCD → MNLIFHKDILFGIPANK 18-31: Missing. 32-319: Missing. 530-530: T → TGVIKLSSAVE | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 7 (identifier: O14490-7) The sequence of this isoform differs from the canonical sequence as follows: 909-929: ERRAPPPVPKKPAKGPAPLIR → VEQCRFCMVHLKTCTNTGQSK 930-977: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 977 | 977 | Disks large-associated protein 1 | PRO_0000174288 | |||||
Regions | |||||||||
| Region | 650 – 661 | 12 | Interaction with DYL2 By similarity | ||||||
| Region | 672 – 683 | 12 | Interaction with DYL2 By similarity | ||||||
| Motif | 975 – 977 | 3 | PDZ-binding By similarity | ||||||
| Compositional bias | 622 – 630 | 9 | Poly-Thr | ||||||
Amino acid modifications | |||||||||
| Modified residue | 123 | 1 | Phosphotyrosine By similarity | ||||||
| Modified residue | 134 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 346 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 356 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 383 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 406 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 415 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 430 | 1 | Phosphothreonine By similarity | ||||||
| Modified residue | 431 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 440 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 493 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 503 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 510 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 932 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 302 | 302 | Missing in isoform 2 and isoform 3. | VSP_006003 | |||||
| Alternative sequence | 1 – 31 | 31 | MKGLS…SDRKP → MDLKTLKLFNSQLRCGWLLY IWNKAFMAHLR in isoform 5. | VSP_043718 | |||||
| Alternative sequence | 1 – 24 | 24 | MKGLS…CDSLS → MIDLFKAEWVSSVCVQVSRN GRTD in isoform 4. | VSP_043222 | |||||
| Alternative sequence | 1 – 17 | 17 | MKGLS…GVTCD → MNLIFHKDILFGIPANK in isoform 6. | VSP_043719 | |||||
| Alternative sequence | 18 – 31 | 14 | Missing in isoform 6. | VSP_043720 | |||||
| Alternative sequence | 25 – 318 | 294 | Missing in isoform 4. | VSP_043223 | |||||
| Alternative sequence | 32 – 319 | 288 | Missing in isoform 5 and isoform 6. | VSP_043721 | |||||
| Alternative sequence | 303 – 319 | 17 | MVKSE…CQYLQ → MNLIFHKDILFGIPANK in isoform 2 and isoform 3. | VSP_006004 | |||||
| Alternative sequence | 530 – 557 | 28 | Missing in isoform 5. | VSP_043722 | |||||
| Alternative sequence | 530 | 1 | T → TGVIKLSSAVE in isoform 6. | VSP_043723 | |||||
| Alternative sequence | 909 – 929 | 21 | ERRAP…APLIR → VEQCRFCMVHLKTCTNTGQS K in isoform 3 and isoform 7. | VSP_006005 | |||||
| Alternative sequence | 930 – 977 | 48 | Missing in isoform 3 and isoform 7. | VSP_006006 | |||||
| Natural variant | 816 | 1 | R → Q. Corresponds to variant rs35822832 [ dbSNP | Ensembl ]. | VAR_053648 | |||||
Experimental info | |||||||||
| Sequence conflict | 734 | 1 | A → P in AAC51119. Ref.2 | ||||||
| Sequence conflict | 740 | 1 | S → T in AAC51119. Ref.2 | ||||||
| Sequence conflict | 752 – 753 | 2 | AA → SP in AAC51119. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "DAP-1, a novel protein that interacts with the guanylate kinase-like domains of hDLG and PSD-95." Satoh K., Yanai H., Senda T., Kohu K., Nakamura T., Okumura N., Matsumine A., Kobayashi S., Toyoshima K., Akiyama T. Genes Cells 2:415-424(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). Tissue: Brain. |
| [2] | "GKAP, a novel synaptic protein that interacts with the guanylate kinase-like domain of the PSD-95/SAP90 family of channel clustering molecules." Kim E., Naisbitt S., Hsueh Y.-P., Rao A., Rothschild A., Craig A.M., Sheng M. J. Cell Biol. 136:669-678(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3). |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4; 5; 6 AND 7). Tissue: Brain and Thalamus. |
| [4] | "DNA sequence and analysis of human chromosome 18." Nusbaum C., Zody M.C., Borowsky M.L., Kamal M., Kodira C.D., Taylor T.D., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Abouelleil A., Allen N.R., Anderson S., Bloom T., Bugalter B., Butler J. Lander E.S.Nature 437:551-555(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain and Testis. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB000277 mRNA. Translation: BAA23258.1. AB000276 mRNA. Translation: BAA23257.1. U67988 mRNA. Translation: AAC51119.1. AK294717 mRNA. Translation: BAH11858.1. AK294747 mRNA. Translation: BAH11868.1. AK299880 mRNA. Translation: BAH13160.1. AK316099 mRNA. Translation: BAH14470.1. AP002472 Genomic DNA. No translation available. AP002478 Genomic DNA. No translation available. AP005130 Genomic DNA. No translation available. AP005204 Genomic DNA. No translation available. AP005241 Genomic DNA. No translation available. CH471113 Genomic DNA. Translation: EAX01654.1. CH471113 Genomic DNA. Translation: EAX01658.1. CH471113 Genomic DNA. Translation: EAX01659.1. BC136453 mRNA. Translation: AAI36454.1. BC136454 mRNA. Translation: AAI36455.1. |
| IPI | IPI00021941. IPI00216228. IPI00216229. IPI00788990. IPI00789415. IPI00790084. |
| PIR | T00014. |
| RefSeq | NP_001003809.1. NM_001003809.2. NP_001229690.1. NM_001242761.1. NP_001229691.1. NM_001242762.1. NP_001229692.1. NM_001242763.1. NP_001229693.1. NM_001242764.1. NP_001229694.1. NM_001242765.1. NP_001229695.1. NM_001242766.1. NP_004737.2. NM_004746.3. |
| UniGene | Hs.594640. Hs.654793. |
3D structure databases | |
| ProteinModelPortal | O14490. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | O14490. 8 interactions. |
| MINT | MINT-2795054. |
| STRING | 9606.ENSP00000316377. |
PTM databases | |
| PhosphoSite | O14490. |
Proteomic databases | |
| PaxDb | O14490. |
| PRIDE | O14490. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000315677; ENSP00000316377; ENSG00000170579. ENST00000400145; ENSP00000383010; ENSG00000170579. ENST00000400147; ENSP00000383011; ENSG00000170579. ENST00000400155; ENSP00000383019; ENSG00000170579. ENST00000515196; ENSP00000445973; ENSG00000170579. ENST00000534970; ENSP00000437817; ENSG00000170579. ENST00000539435; ENSP00000446312; ENSG00000170579. ENST00000581527; ENSP00000463864; ENSG00000170579. ENST00000581699; ENSP00000462848; ENSG00000170579. ENST00000584874; ENSP00000462882; ENSG00000170579. |
| GeneID | 9229. |
| KEGG | hsa:9229. |
| UCSC | uc002kme.2. human. uc002kmf.3. human. uc002kmg.3. human. |
Organism-specific databases | |
| CTD | 9229. |
| GeneCards | GC18M003488. |
| HGNC | HGNC:2905. DLGAP1. |
| HPA | HPA040963. |
| MIM | 605445. gene. |
| neXtProt | NX_O14490. |
| PharmGKB | PA27361. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG277836. |
| HOGENOM | HOG000015346. |
| HOVERGEN | HBG018957. |
| InParanoid | O14490. |
| KO | K15008. |
| OMA | PDETQTV. |
| OrthoDB | EOG4TB49Q. |
| PhylomeDB | O14490. |
Gene expression databases | |
| ArrayExpress | O14490. |
| Bgee | O14490. |
| CleanEx | HS_DLGAP1. |
| Genevestigator | O14490. |
| GermOnline | ENSG00000170579. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR005026. GKAP. [Graphical view] |
| Pfam | PF03359. GKAP. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | DLGAP1. human. |
| GenomeRNAi | 9229. |
| NextBio | 34591. |
| SOURCE | Search... |
Entry information
| Entry name | DLGP1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O14490 Secondary accession number(s): A8MWN8 P78335 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 18 Human chromosome 18: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
