Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O14490

- DLGP1_HUMAN

UniProt

O14490 - DLGP1_HUMAN

Protein

Disks large-associated protein 1

Gene

DLGAP1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 116 (01 Oct 2014)
      Sequence version 1 (01 Jan 1998)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Part of the postsynaptic scaffold in neuronal cells.

    GO - Molecular functioni

    1. protein binding Source: IntAct

    GO - Biological processi

    1. synaptic transmission Source: UniProtKB

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Disks large-associated protein 1
    Short name:
    DAP-1
    Alternative name(s):
    Guanylate kinase-associated protein
    Short name:
    hGKAP
    PSD-95/SAP90-binding protein 1
    SAP90/PSD-95-associated protein 1
    Short name:
    SAPAP1
    Gene namesi
    Name:DLGAP1
    Synonyms:DAP1, GKAP
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 18

    Organism-specific databases

    HGNCiHGNC:2905. DLGAP1.

    Subcellular locationi

    GO - Cellular componenti

    1. cell junction Source: UniProtKB-KW
    2. neuronal postsynaptic density Source: Ensembl
    3. postsynaptic membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Cell junction, Cell membrane, Membrane, Postsynaptic cell membrane, Synapse

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA27361.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 977977Disks large-associated protein 1PRO_0000174288Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei356 – 3561PhosphoserineBy similarity
    Modified residuei503 – 5031PhosphoserineBy similarity
    Modified residuei510 – 5101PhosphoserineBy similarity
    Modified residuei932 – 9321PhosphoserineBy similarity

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    PaxDbiO14490.
    PRIDEiO14490.

    PTM databases

    PhosphoSiteiO14490.

    Expressioni

    Tissue specificityi

    Expressed in brain.

    Gene expression databases

    ArrayExpressiO14490.
    BgeeiO14490.
    CleanExiHS_DLGAP1.
    GenevestigatoriO14490.

    Organism-specific databases

    HPAiHPA040963.

    Interactioni

    Subunit structurei

    Interacts with guanylate kinase-like domain of DLG1, DLG2, DLG3, DLG4 and AIP1. Interacts with the PDZ domain of SHANK1, SHANK2 and SHANK3. Found in a complex with DLG4 and SHANK1, SHANK2 or SHANK3. Found in a complex with DLG4 and BEGAIN. Interacts with DYL2 and LRFN1 By similarity.By similarity

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    Dlg1Q626962EBI-1753207,EBI-389325From a different organism.
    DLG4P783525EBI-1753207,EBI-80389
    GRB2P629933EBI-1753207,EBI-401755
    NCK1P163334EBI-1753207,EBI-389883

    Protein-protein interaction databases

    BioGridi114660. 18 interactions.
    IntActiO14490. 12 interactions.
    MINTiMINT-2795054.
    STRINGi9606.ENSP00000316377.

    Structurei

    3D structure databases

    ProteinModelPortaliO14490.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni650 – 66112Interaction with DYL2By similarityAdd
    BLAST
    Regioni672 – 68312Interaction with DYL2By similarityAdd
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi975 – 9773PDZ-bindingBy similarity

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi622 – 6309Poly-Thr

    Sequence similaritiesi

    Belongs to the SAPAP family.Curated

    Phylogenomic databases

    eggNOGiNOG277836.
    HOGENOMiHOG000015346.
    HOVERGENiHBG018957.
    InParanoidiO14490.
    KOiK15008.
    OMAiAVEVSSC.
    OrthoDBiEOG75QR37.
    PhylomeDBiO14490.
    TreeFamiTF321382.

    Family and domain databases

    InterProiIPR005026. GKAP.
    [Graphical view]
    PfamiPF03359. GKAP. 1 hit.
    [Graphical view]

    Sequences (7)i

    Sequence statusi: Complete.

    This entry describes 7 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O14490-1) [UniParc]FASTAAdd to Basket

    Also known as: DAP1-alpha

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MKGLSGSRSH HHGVTCDSAC DSLSHHSDRK PYLLSPVEHH PADHPYYTQR    50
    NSFQAECVGP FSDPLASSTF PRRHYTSQQE LKDECALVPR TLATKANRIP 100
    ANLLDQFERQ LPLSRDGYHT LQYKRTAVEH RSDSPGRIRH LVHSVQKLFT 150
    KSHSLEGPSK GSVNGGKASP DEAQAARYGK RSKSKERRAE PKARPSTSPG 200
    WWSSDDNLDG DMCIYHAPSG VMTMGRCPDR SASQYFLEAY NTISEQAVKA 250
    SRSNNDVKCS TCANLPVSLD TPLLKKSAWS STLTVSRARE VYQKASVNMD 300
    QAMVKSESCQ QERSCQYLQV PQDEWTGYTP RGKDDEIPCR RMRSGSYIKA 350
    MGDEDSGDSD TSPKPSPKVA ARRESYLKAT QPSLTELTTL KISNEHSPKL 400
    QIRSHSYLRA VSEVSINRSL DSLDPAGLLT SPKFRSRNES YMRAMSTISQ 450
    VSEMEVNGQF ESVCESVFSE LESQAVEALD LPMPGCFRMR SHSYVRAIEK 500
    GCSQDDECVS LRSSSPPRTT TTVRTIQSST VSSCITTYKK TPPPVPPRTT 550
    TKPFISITAQ SSTESAQDAY MDGQGQRGDI ISQSGLSNST ESLDSMKALT 600
    AAIEAANAQI HGPASQHMGN NTATVTTTTT IATVTTEDRK KDHFKKNRCL 650
    SIGIQVDDAE EPDKTGENKA PSKFQSVGVQ VEEEKCFRRF TRSNSVTTAV 700
    QADLDFHDNL ENSLESIEDN SCPGPMARQF SRDASTSTVS IQGSGNHYHA 750
    CAADDDFDTD FDPSILPPPD PWIDSITEDP LEAVQRSVCH RDGHWFLKLL 800
    QAERDRMEGW CQQMEREERE NNLPEDILGK IRTAVGSAQL LMAQKFYQFR 850
    ELCEENLNPN AHPRPTSQDL AGFWDMLQLS IENISMKFDE LHQLKANNWK 900
    QMDPLDKKER RAPPPVPKKP AKGPAPLIRE RSLESSQRQE ARKRLMAAKR 950
    AASVRQNSAT ESAESIEIYI PEAQTRL 977
    Length:977
    Mass (Da):108,873
    Last modified:January 1, 1998 - v1
    Checksum:i670F72B17D9BE667
    GO
    Isoform 2 (identifier: O14490-2) [UniParc]FASTAAdd to Basket

    Also known as: DAP1-beta

    The sequence of this isoform differs from the canonical sequence as follows:
         1-302: Missing.
         303-319: MVKSESCQQERSCQYLQ → MNLIFHKDILFGIPANK

    Show »
    Length:675
    Mass (Da):75,261
    Checksum:iA88274F7F3D9F5ED
    GO
    Isoform 3 (identifier: O14490-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-302: Missing.
         303-319: MVKSESCQQERSCQYLQ → MNLIFHKDILFGIPANK
         909-929: ERRAPPPVPKKPAKGPAPLIR → VEQCRFCMVHLKTCTNTGQSK
         930-977: Missing.

    Show »
    Length:627
    Mass (Da):69,969
    Checksum:i2326123341316726
    GO
    Isoform 4 (identifier: O14490-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-24: MKGLSGSRSHHHGVTCDSACDSLS → MIDLFKAEWVSSVCVQVSRNGRTD
         25-318: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:683
    Mass (Da):76,159
    Checksum:i8F23FC02956683BE
    GO
    Isoform 5 (identifier: O14490-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-31: MKGLSGSRSHHHGVTCDSACDSLSHHSDRKP → MDLKTLKLFNSQLRCGWLLYIWNKAFMAHLR
         32-319: Missing.
         530-557: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:661
    Mass (Da):74,058
    Checksum:i5A96B64BA7D70469
    GO
    Isoform 6 (identifier: O14490-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-17: MKGLSGSRSHHHGVTCD → MNLIFHKDILFGIPANK
         18-31: Missing.
         32-319: Missing.
         530-530: T → TGVIKLSSAVE

    Note: No experimental confirmation available.

    Show »
    Length:685
    Mass (Da):76,245
    Checksum:iACBD1D7BB4CC8756
    GO
    Isoform 7 (identifier: O14490-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         909-929: ERRAPPPVPKKPAKGPAPLIR → VEQCRFCMVHLKTCTNTGQSK
         930-977: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:929
    Mass (Da):103,581
    Checksum:i00E65FE3F36B7D6B
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti734 – 7341A → P in AAC51119. (PubMed:9024696)Curated
    Sequence conflicti740 – 7401S → T in AAC51119. (PubMed:9024696)Curated
    Sequence conflicti752 – 7532AA → SP in AAC51119. (PubMed:9024696)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti816 – 8161R → Q.
    Corresponds to variant rs35822832 [ dbSNP | Ensembl ].
    VAR_053648

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 302302Missing in isoform 2 and isoform 3. 2 PublicationsVSP_006003Add
    BLAST
    Alternative sequencei1 – 3131MKGLS…SDRKP → MDLKTLKLFNSQLRCGWLLY IWNKAFMAHLR in isoform 5. 1 PublicationVSP_043718Add
    BLAST
    Alternative sequencei1 – 2424MKGLS…CDSLS → MIDLFKAEWVSSVCVQVSRN GRTD in isoform 4. 1 PublicationVSP_043222Add
    BLAST
    Alternative sequencei1 – 1717MKGLS…GVTCD → MNLIFHKDILFGIPANK in isoform 6. 1 PublicationVSP_043719Add
    BLAST
    Alternative sequencei18 – 3114Missing in isoform 6. 1 PublicationVSP_043720Add
    BLAST
    Alternative sequencei25 – 318294Missing in isoform 4. 1 PublicationVSP_043223Add
    BLAST
    Alternative sequencei32 – 319288Missing in isoform 5 and isoform 6. 1 PublicationVSP_043721Add
    BLAST
    Alternative sequencei303 – 31917MVKSE…CQYLQ → MNLIFHKDILFGIPANK in isoform 2 and isoform 3. 2 PublicationsVSP_006004Add
    BLAST
    Alternative sequencei530 – 55728Missing in isoform 5. 1 PublicationVSP_043722Add
    BLAST
    Alternative sequencei530 – 5301T → TGVIKLSSAVE in isoform 6. 1 PublicationVSP_043723
    Alternative sequencei909 – 92921ERRAP…APLIR → VEQCRFCMVHLKTCTNTGQS K in isoform 3 and isoform 7. 2 PublicationsVSP_006005Add
    BLAST
    Alternative sequencei930 – 97748Missing in isoform 3 and isoform 7. 2 PublicationsVSP_006006Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB000277 mRNA. Translation: BAA23258.1.
    AB000276 mRNA. Translation: BAA23257.1.
    U67988 mRNA. Translation: AAC51119.1.
    AK294717 mRNA. Translation: BAH11858.1.
    AK294747 mRNA. Translation: BAH11868.1.
    AK299880 mRNA. Translation: BAH13160.1.
    AK316099 mRNA. Translation: BAH14470.1.
    AP002472 Genomic DNA. No translation available.
    AP002478 Genomic DNA. No translation available.
    AP005130 Genomic DNA. No translation available.
    AP005204 Genomic DNA. No translation available.
    AP005241 Genomic DNA. No translation available.
    CH471113 Genomic DNA. Translation: EAX01654.1.
    CH471113 Genomic DNA. Translation: EAX01658.1.
    CH471113 Genomic DNA. Translation: EAX01659.1.
    BC136453 mRNA. Translation: AAI36454.1.
    BC136454 mRNA. Translation: AAI36455.1.
    CCDSiCCDS11836.1. [O14490-1]
    CCDS42406.1. [O14490-2]
    CCDS56049.1. [O14490-3]
    CCDS56050.1. [O14490-6]
    CCDS56051.1. [O14490-4]
    CCDS56052.1. [O14490-5]
    CCDS56053.1. [O14490-7]
    PIRiT00014.
    RefSeqiNP_001003809.1. NM_001003809.2. [O14490-2]
    NP_001229690.1. NM_001242761.1. [O14490-7]
    NP_001229691.1. NM_001242762.1. [O14490-5]
    NP_001229692.1. NM_001242763.1.
    NP_001229693.1. NM_001242764.1. [O14490-4]
    NP_001229694.1. NM_001242765.1. [O14490-3]
    NP_001229695.1. NM_001242766.1. [O14490-6]
    NP_004737.2. NM_004746.3. [O14490-1]
    UniGeneiHs.594640.
    Hs.654793.

    Genome annotation databases

    EnsembliENST00000315677; ENSP00000316377; ENSG00000170579. [O14490-1]
    ENST00000400145; ENSP00000383010; ENSG00000170579. [O14490-3]
    ENST00000400147; ENSP00000383011; ENSG00000170579. [O14490-2]
    ENST00000400155; ENSP00000383019; ENSG00000170579. [O14490-4]
    ENST00000515196; ENSP00000445973; ENSG00000170579. [O14490-7]
    ENST00000534970; ENSP00000437817; ENSG00000170579. [O14490-5]
    ENST00000539435; ENSP00000446312; ENSG00000170579. [O14490-6]
    ENST00000581527; ENSP00000463864; ENSG00000170579. [O14490-7]
    ENST00000581699; ENSP00000462848; ENSG00000170579. [O14490-4]
    ENST00000584874; ENSP00000462882; ENSG00000170579. [O14490-1]
    GeneIDi9229.
    KEGGihsa:9229.
    UCSCiuc002kme.2. human. [O14490-2]
    uc002kmf.3. human. [O14490-1]
    uc002kmg.3. human. [O14490-3]
    uc010dkn.3. human. [O14490-6]
    uc010wyw.2. human. [O14490-4]
    uc010wyy.2. human. [O14490-5]
    uc010wyz.2. human. [O14490-7]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB000277 mRNA. Translation: BAA23258.1 .
    AB000276 mRNA. Translation: BAA23257.1 .
    U67988 mRNA. Translation: AAC51119.1 .
    AK294717 mRNA. Translation: BAH11858.1 .
    AK294747 mRNA. Translation: BAH11868.1 .
    AK299880 mRNA. Translation: BAH13160.1 .
    AK316099 mRNA. Translation: BAH14470.1 .
    AP002472 Genomic DNA. No translation available.
    AP002478 Genomic DNA. No translation available.
    AP005130 Genomic DNA. No translation available.
    AP005204 Genomic DNA. No translation available.
    AP005241 Genomic DNA. No translation available.
    CH471113 Genomic DNA. Translation: EAX01654.1 .
    CH471113 Genomic DNA. Translation: EAX01658.1 .
    CH471113 Genomic DNA. Translation: EAX01659.1 .
    BC136453 mRNA. Translation: AAI36454.1 .
    BC136454 mRNA. Translation: AAI36455.1 .
    CCDSi CCDS11836.1. [O14490-1 ]
    CCDS42406.1. [O14490-2 ]
    CCDS56049.1. [O14490-3 ]
    CCDS56050.1. [O14490-6 ]
    CCDS56051.1. [O14490-4 ]
    CCDS56052.1. [O14490-5 ]
    CCDS56053.1. [O14490-7 ]
    PIRi T00014.
    RefSeqi NP_001003809.1. NM_001003809.2. [O14490-2 ]
    NP_001229690.1. NM_001242761.1. [O14490-7 ]
    NP_001229691.1. NM_001242762.1. [O14490-5 ]
    NP_001229692.1. NM_001242763.1.
    NP_001229693.1. NM_001242764.1. [O14490-4 ]
    NP_001229694.1. NM_001242765.1. [O14490-3 ]
    NP_001229695.1. NM_001242766.1. [O14490-6 ]
    NP_004737.2. NM_004746.3. [O14490-1 ]
    UniGenei Hs.594640.
    Hs.654793.

    3D structure databases

    ProteinModelPortali O14490.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 114660. 18 interactions.
    IntActi O14490. 12 interactions.
    MINTi MINT-2795054.
    STRINGi 9606.ENSP00000316377.

    PTM databases

    PhosphoSitei O14490.

    Proteomic databases

    PaxDbi O14490.
    PRIDEi O14490.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000315677 ; ENSP00000316377 ; ENSG00000170579 . [O14490-1 ]
    ENST00000400145 ; ENSP00000383010 ; ENSG00000170579 . [O14490-3 ]
    ENST00000400147 ; ENSP00000383011 ; ENSG00000170579 . [O14490-2 ]
    ENST00000400155 ; ENSP00000383019 ; ENSG00000170579 . [O14490-4 ]
    ENST00000515196 ; ENSP00000445973 ; ENSG00000170579 . [O14490-7 ]
    ENST00000534970 ; ENSP00000437817 ; ENSG00000170579 . [O14490-5 ]
    ENST00000539435 ; ENSP00000446312 ; ENSG00000170579 . [O14490-6 ]
    ENST00000581527 ; ENSP00000463864 ; ENSG00000170579 . [O14490-7 ]
    ENST00000581699 ; ENSP00000462848 ; ENSG00000170579 . [O14490-4 ]
    ENST00000584874 ; ENSP00000462882 ; ENSG00000170579 . [O14490-1 ]
    GeneIDi 9229.
    KEGGi hsa:9229.
    UCSCi uc002kme.2. human. [O14490-2 ]
    uc002kmf.3. human. [O14490-1 ]
    uc002kmg.3. human. [O14490-3 ]
    uc010dkn.3. human. [O14490-6 ]
    uc010wyw.2. human. [O14490-4 ]
    uc010wyy.2. human. [O14490-5 ]
    uc010wyz.2. human. [O14490-7 ]

    Organism-specific databases

    CTDi 9229.
    GeneCardsi GC18M003488.
    HGNCi HGNC:2905. DLGAP1.
    HPAi HPA040963.
    MIMi 605445. gene.
    neXtProti NX_O14490.
    PharmGKBi PA27361.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG277836.
    HOGENOMi HOG000015346.
    HOVERGENi HBG018957.
    InParanoidi O14490.
    KOi K15008.
    OMAi AVEVSSC.
    OrthoDBi EOG75QR37.
    PhylomeDBi O14490.
    TreeFami TF321382.

    Miscellaneous databases

    ChiTaRSi DLGAP1. human.
    GeneWikii DLGAP1.
    GenomeRNAii 9229.
    NextBioi 34591.
    PROi O14490.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O14490.
    Bgeei O14490.
    CleanExi HS_DLGAP1.
    Genevestigatori O14490.

    Family and domain databases

    InterProi IPR005026. GKAP.
    [Graphical view ]
    Pfami PF03359. GKAP. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "DAP-1, a novel protein that interacts with the guanylate kinase-like domains of hDLG and PSD-95."
      Satoh K., Yanai H., Senda T., Kohu K., Nakamura T., Okumura N., Matsumine A., Kobayashi S., Toyoshima K., Akiyama T.
      Genes Cells 2:415-424(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
      Tissue: Brain.
    2. "GKAP, a novel synaptic protein that interacts with the guanylate kinase-like domain of the PSD-95/SAP90 family of channel clustering molecules."
      Kim E., Naisbitt S., Hsueh Y.-P., Rao A., Rothschild A., Craig A.M., Sheng M.
      J. Cell Biol. 136:669-678(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4; 5; 6 AND 7).
      Tissue: Brain and Thalamus.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain and Testis.

    Entry informationi

    Entry nameiDLGP1_HUMAN
    AccessioniPrimary (citable) accession number: O14490
    Secondary accession number(s): A8MWN8
    , B2RMU8, B7WPA1, B7Z2H2, B7Z2I2, B7Z9Y4, O14489, P78335
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: September 26, 2001
    Last sequence update: January 1, 1998
    Last modified: October 1, 2014
    This is version 116 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 18
      Human chromosome 18: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3