Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O09110

- MP2K3_MOUSE

UniProt

O09110 - MP2K3_MOUSE

Protein

Dual specificity mitogen-activated protein kinase kinase 3

Gene

Map2k3

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 136 (01 Oct 2014)
      Sequence version 2 (01 Nov 2002)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Dual specificity kinase. Is activated by cytokines and environmental stress in vivo. Catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in the MAP kinase p38 By similarity.By similarity

    Catalytic activityi

    ATP + a protein = ADP + a phosphoprotein.

    Enzyme regulationi

    Activated by dual phosphorylation on Ser-218 and Thr-222.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei93 – 931ATPPROSITE-ProRule annotation
    Active sitei190 – 1901Proton acceptorPROSITE-ProRule annotation

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi70 – 789ATPPROSITE-ProRule annotation

    GO - Molecular functioni

    1. ATP binding Source: UniProtKB-KW
    2. MAP kinase kinase activity Source: MGI
    3. protein binding Source: UniProtKB
    4. protein kinase binding Source: UniProtKB
    5. protein serine/threonine kinase activity Source: UniProtKB-KW
    6. protein tyrosine kinase activity Source: UniProtKB-KW

    GO - Biological processi

    1. activation of MAPK activity Source: MGI
    2. cardiac muscle contraction Source: MGI
    3. inflammatory response Source: MGI
    4. MAPK cascade Source: MGI
    5. positive regulation of transcription, DNA-templated Source: Ensembl
    6. regulation of cytokine biosynthetic process Source: MGI

    Keywords - Molecular functioni

    Kinase, Serine/threonine-protein kinase, Transferase, Tyrosine-protein kinase

    Keywords - Ligandi

    ATP-binding, Nucleotide-binding

    Enzyme and pathway databases

    BRENDAi2.7.12.2. 3474.
    ReactomeiREACT_188970. Oxidative Stress Induced Senescence.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Dual specificity mitogen-activated protein kinase kinase 3 (EC:2.7.12.2)
    Short name:
    MAP kinase kinase 3
    Short name:
    MAPKK 3
    Alternative name(s):
    MAPK/ERK kinase 3
    Short name:
    MEK 3
    Gene namesi
    Name:Map2k3
    Synonyms:Mkk3, Prkmk3
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 11

    Organism-specific databases

    MGIiMGI:1346868. Map2k3.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 347347Dual specificity mitogen-activated protein kinase kinase 3PRO_0000086379Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei1 – 11N-acetylmethionineBy similarity
    Modified residuei3 – 31PhosphoserineBy similarity
    Modified residuei218 – 2181PhosphoserineBy similarity
    Modified residuei222 – 2221PhosphothreonineBy similarity

    Post-translational modificationi

    Phosphorylation on Ser-218 and Thr-222 by MAP kinase kinase kinases regulates positively the kinase activity. Phosphorylated by TAOK2 By similarity. Autophosphorylated.By similarity

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    MaxQBiO09110.
    PaxDbiO09110.
    PRIDEiO09110.

    PTM databases

    PhosphoSiteiO09110.

    Expressioni

    Gene expression databases

    ArrayExpressiO09110.
    BgeeiO09110.
    CleanExiMM_MAP2K3.
    GenevestigatoriO09110.

    Interactioni

    Subunit structurei

    Binds to DYRK1B/MIRK and increases its kinase activity By similarity. Part of a complex with MAP3K3, RAC1 and CCM2. Interacts with ARRB1 By similarity.By similarity

    Protein-protein interaction databases

    BioGridi204951. 8 interactions.
    IntActiO09110. 3 interactions.
    MINTiMINT-4102274.

    Structurei

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1LEZX-ray2.30B16-32[»]
    ProteinModelPortaliO09110.
    SMRiO09110. Positions 16-345.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini64 – 325262Protein kinasePROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 1 protein kinase domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiCOG0515.
    GeneTreeiENSGT00690000102058.
    HOGENOMiHOG000234206.
    HOVERGENiHBG108518.
    InParanoidiO09110.
    KOiK04432.
    OMAiNYLELME.
    OrthoDBiEOG7J9VPW.
    PhylomeDBiO09110.
    TreeFamiTF350701.

    Family and domain databases

    InterProiIPR011009. Kinase-like_dom.
    IPR000719. Prot_kinase_dom.
    IPR017441. Protein_kinase_ATP_BS.
    IPR002290. Ser/Thr_dual-sp_kinase_dom.
    IPR008271. Ser/Thr_kinase_AS.
    [Graphical view]
    PfamiPF00069. Pkinase. 1 hit.
    [Graphical view]
    SMARTiSM00220. S_TKc. 1 hit.
    [Graphical view]
    SUPFAMiSSF56112. SSF56112. 1 hit.
    PROSITEiPS00107. PROTEIN_KINASE_ATP. 1 hit.
    PS50011. PROTEIN_KINASE_DOM. 1 hit.
    PS00108. PROTEIN_KINASE_ST. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 2 (identifier: O09110-1) [UniParc]FASTAAdd to Basket

    Also known as: 3b

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MESPAASPPA SLPQTKGKSK RKKDLRISCV SKPPVSNPTP PRNLDSRTFI    50
    TIGDRNFEVE ADDLVTISEL GRGAYGVVEK VRHAQSGTIM AVKRIRATVN 100
    TQEQKRLLMD LDINMRTVDC FYTVTFYGAL FREGDVWICM ELMDTSLDKF 150
    YRKVLEKNMK IPEDILGEIA VSIVRALEHL HSKLSVIHRD VKPSNVLINK 200
    EGHVKMCDFG ISGYLVDSVA KTMDAGCKPY MAPERINPEL NQKGYNVKSD 250
    VWSLGITMIE MAILRFPYES WGTPFQQLKQ VVEEPSPQLP ADQFSPEFVD 300
    FTSQCLRKNP AERMSYLELM EHPFFTLHKT KKTDIAAFVK EILGEDS 347
    Length:347
    Mass (Da):39,296
    Last modified:November 1, 2002 - v2
    Checksum:i4A2A420EDCA8A2BC
    GO
    Isoform 1 (identifier: O09110-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-37: MESPAASPPASLPQTKGKSKRKKDLRISCVSKPPVSN → MSKP

    Show »
    Length:314
    Mass (Da):35,836
    Checksum:i3F85122E7F272D5B
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti39 – 391T → A1 PublicationCurated
    Sequence conflicti60 – 601E → K in CAA63649. 1 PublicationCurated
    Sequence conflicti173 – 347175IVRAL…LGEDS → M(PubMed:15489334)CuratedAdd
    BLAST
    Sequence conflicti216 – 2161V → E in CAA63649. 1 PublicationCurated
    Sequence conflicti292 – 2921D → Y in CAA63649. 1 PublicationCurated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 3737MESPA…PPVSN → MSKP in isoform 1. 2 PublicationsVSP_004879Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X93150 mRNA. Translation: CAA63649.1.
    D87115 mRNA. Translation: BAA13247.1.
    AK011002 mRNA. Translation: BAB27321.1.
    AK008141 mRNA. Translation: BAB25489.1.
    BC007467 mRNA. Translation: AAH07467.1.
    CCDSiCCDS24804.1. [O09110-1]
    RefSeqiNP_032954.1. NM_008928.4. [O09110-1]
    UniGeneiMm.18494.

    Genome annotation databases

    EnsembliENSMUST00000019076; ENSMUSP00000019076; ENSMUSG00000018932. [O09110-1]
    ENSMUST00000130269; ENSMUSP00000114430; ENSMUSG00000018932.
    GeneIDi26397.
    KEGGimmu:26397.
    UCSCiuc007jgw.1. mouse. [O09110-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X93150 mRNA. Translation: CAA63649.1 .
    D87115 mRNA. Translation: BAA13247.1 .
    AK011002 mRNA. Translation: BAB27321.1 .
    AK008141 mRNA. Translation: BAB25489.1 .
    BC007467 mRNA. Translation: AAH07467.1 .
    CCDSi CCDS24804.1. [O09110-1 ]
    RefSeqi NP_032954.1. NM_008928.4. [O09110-1 ]
    UniGenei Mm.18494.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1LEZ X-ray 2.30 B 16-32 [» ]
    ProteinModelPortali O09110.
    SMRi O09110. Positions 16-345.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 204951. 8 interactions.
    IntActi O09110. 3 interactions.
    MINTi MINT-4102274.

    PTM databases

    PhosphoSitei O09110.

    Proteomic databases

    MaxQBi O09110.
    PaxDbi O09110.
    PRIDEi O09110.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000019076 ; ENSMUSP00000019076 ; ENSMUSG00000018932 . [O09110-1 ]
    ENSMUST00000130269 ; ENSMUSP00000114430 ; ENSMUSG00000018932 .
    GeneIDi 26397.
    KEGGi mmu:26397.
    UCSCi uc007jgw.1. mouse. [O09110-1 ]

    Organism-specific databases

    CTDi 5606.
    MGIi MGI:1346868. Map2k3.

    Phylogenomic databases

    eggNOGi COG0515.
    GeneTreei ENSGT00690000102058.
    HOGENOMi HOG000234206.
    HOVERGENi HBG108518.
    InParanoidi O09110.
    KOi K04432.
    OMAi NYLELME.
    OrthoDBi EOG7J9VPW.
    PhylomeDBi O09110.
    TreeFami TF350701.

    Enzyme and pathway databases

    BRENDAi 2.7.12.2. 3474.
    Reactomei REACT_188970. Oxidative Stress Induced Senescence.

    Miscellaneous databases

    NextBioi 304347.
    PROi O09110.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O09110.
    Bgeei O09110.
    CleanExi MM_MAP2K3.
    Genevestigatori O09110.

    Family and domain databases

    InterProi IPR011009. Kinase-like_dom.
    IPR000719. Prot_kinase_dom.
    IPR017441. Protein_kinase_ATP_BS.
    IPR002290. Ser/Thr_dual-sp_kinase_dom.
    IPR008271. Ser/Thr_kinase_AS.
    [Graphical view ]
    Pfami PF00069. Pkinase. 1 hit.
    [Graphical view ]
    SMARTi SM00220. S_TKc. 1 hit.
    [Graphical view ]
    SUPFAMi SSF56112. SSF56112. 1 hit.
    PROSITEi PS00107. PROTEIN_KINASE_ATP. 1 hit.
    PS50011. PROTEIN_KINASE_DOM. 1 hit.
    PS00108. PROTEIN_KINASE_ST. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Neininger A., Gaestel M.
      Submitted (JAN-1997) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "Purification and identification of a major activator for p38 from osmotically shocked cells: activation of mitogen-activated protein kinase kinase 6 by osmotic shock, tumor necrosis factor-alpha, and H2O2."
      Moriguchi T., Toyoshima F., Gotoh Y., Iwamatsu A., Irie K., Mori E., Kuroyanagi N., Hagiwara M., Matsumoto K., Nishida E.
      J. Biol. Chem. 271:26981-26988(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    3. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Strain: C57BL/6J.
      Tissue: Embryonic liver and Small intestine.
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Mammary gland.
    5. Cited for: INTERACTION WITH MAP3K3; RAC1 AND CCM2.

    Entry informationi

    Entry nameiMP2K3_MOUSE
    AccessioniPrimary (citable) accession number: O09110
    Secondary accession number(s): P97293, Q91VX1
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 1, 1997
    Last sequence update: November 1, 2002
    Last modified: October 1, 2014
    This is version 136 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    3. Human and mouse protein kinases
      Human and mouse protein kinases: classification and index
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3