Reviewed,
UniProtKB/Swiss-Prot O09110 (MP2K3_MOUSE)
Last modified
February 9, 2010.
Version 96.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Dual specificity mitogen-activated protein kinase kinase 3 Short name=MAP kinase kinase 3 Short name=MAPKK 3 EC=2.7.12.2 Alternative name(s): MAPK/ERK kinase 3 Short name=MEK 3 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus |
Protein attributes
| Sequence length | 347 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Dual specificity kinase. Is activated by cytokines and environmental stress in vivo. Catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in the MAP kinase p38 By similarity. |
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. |
| Enzyme regulation | Activated by dual phosphorylation on Ser-218 and Thr-222 By similarity. |
| Subunit structure | Binds to DYRK1B/MIRK and increases its kinase activity By similarity. Part of a complex with MAP3K3, RAC1 and CCM2. Interacts with ARRB1 By similarity. Ref.5 |
| Post-translational modification | Autophosphorylated. |
| Sequence similarities | Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase subfamily. Contains 1 protein kinase domain. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Ligand | ATP-binding Nucleotide-binding |
| Molecular function | Kinase Serine/threonine-protein kinase Transferase Tyrosine-protein kinase |
| PTM | Acetylation Phosphoprotein |
| Gene Ontology (GO) | |
| Biological process | activation of MAPK activity Inferred from direct assay. Source: MGI cardiac muscle contractionInferred from mutant phenotype. Source: MGI inflammatory responseInferred from mutant phenotype. Source: MGI regulation of cytokine biosynthetic processInferred from mutant phenotype. Source: MGI |
| Molecular function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW MAP kinase kinase activity Ref.2Inferred from direct assay. Source: MGI protein serine/threonine kinase activityInferred from electronic annotation. Source: UniProtKB-KW protein tyrosine kinase activityInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 2 (identifier: O09110-1) Also known as: 3b; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 1 (identifier: O09110-2) The sequence of this isoform differs from the canonical sequence as follows: 1-37: MESPAASPPASLPQTKGKSKRKKDLRISCVSKPPVSN → MSKP |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 347 | 347 | Dual specificity mitogen-activated protein kinase kinase 3 | PRO_0000086379 | |||||
Regions | |||||||||
| Domain | 64 – 325 | 262 | Protein kinase | ||||||
| Nucleotide binding | 70 – 78 | 9 | ATP By similarity | ||||||
Sites | |||||||||
| Active site | 190 | 1 | Proton acceptor By similarity | ||||||
| Binding site | 93 | 1 | ATP By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 1 | 1 | N-acetylmethionine By similarity | ||||||
| Modified residue | 3 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 218 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 222 | 1 | Phosphothreonine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 37 | 37 | MESPA…PPVSN → MSKP in isoform 1. | VSP_004879 | |||||
Experimental info | |||||||||
| Sequence conflict | 39 | 1 | T → A Ref.1 | ||||||
| Sequence conflict | 60 | 1 | E → K in CAA63649. Ref.1 | ||||||
| Sequence conflict | 173 – 347 | 175 | IVRAL…LGEDS → M Ref.4 | ||||||
| Sequence conflict | 216 | 1 | V → E in CAA63649. Ref.1 | ||||||
| Sequence conflict | 292 | 1 | D → Y in CAA63649. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | Neininger A., Gaestel M. Submitted (JAN-1997) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Purification and identification of a major activator for p38 from osmotically shocked cells: activation of mitogen-activated protein kinase kinase 6 by osmotic shock, tumor necrosis factor-alpha, and H2O2." Moriguchi T., Toyoshima F., Gotoh Y., Iwamatsu A., Irie K., Mori E., Kuroyanagi N., Hagiwara M., Matsumoto K., Nishida E. J. Biol. Chem. 271:26981-26988(1996) [PubMed: 8900184] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [3] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed: 16141072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Strain: C57BL/6J. Tissue: Embryonic liver and Small intestine. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Mammary gland. |
| [5] | "Rac-MEKK3-MKK3 scaffolding for p38 MAPK activation during hyperosmotic shock." Uhlik M.T., Abell A.N., Johnson N.L., Sun W., Cuevas B.D., Lobel-Rice K.E., Horne E.A., Dell'Acqua M.L., Johnson G.L. Nat. Cell Biol. 5:1104-1110(2003) [PubMed: 14634666] [Abstract] Cited for: INTERACTION WITH MAP3K3; RAC1 AND CCM2. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X93150 mRNA. Translation: CAA63649.1. D87115 mRNA. Translation: BAA13247.1. AK011002 mRNA. Translation: BAB27321.1. AK008141 mRNA. Translation: BAB25489.1. BC007467 mRNA. Translation: AAH07467.1. |
| IPI | IPI00114245. IPI00230052. |
| RefSeq | NP_032954.1. |
| UniGene | Mm.18494 |
3D structure databases | |
| SMR | O09110. Positions 21-326. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | O09110. |
PTM databases | |
| PhosphoSite | O09110. |
Proteomic databases | |
| PRIDE | O09110. |
Genome annotation databases | |
| Ensembl | ENSMUST00000019076; ENSMUSP00000019076; ENSMUSG00000018932; Mus musculus. [Genome view] |
| GeneID | 26397. |
| KEGG | mmu:26397. |
| UCSC | uc007jgx.1. mouse. |
Organism-specific databases | |
| CTD | 26397. |
| MGI | MGI:1346868. Map2k3. |
Phylogenomic databases | |
| eggNOG | roNOG15456. |
| HOGENOM | HBG755340. |
| HOVERGEN | O09110. |
| InParanoid | O09110. |
| OMA | LDKNMTI. |
| OrthoDB | EOG9Q87GM. |
| PhylomeDB | O09110. |
Enzyme and pathway databases | |
| BRENDA | 2.7.12.2. 244. |
Gene expression databases | |
| ArrayExpress | O09110. |
| Bgee | O09110. |
| CleanEx | MM_MAP2K3. |
| Genevestigator | O09110. |
| GermOnline | ENSMUSG00000018932. Mus musculus. |
Family and domain databases | |
| InterPro | IPR011009. Kinase-like_dom. IPR000719. Prot_kinase_cat_dom. IPR017441. Protein_kinase_ATP_BS. IPR017442. Se/Thr_prot_kinase-like_dom. IPR008271. Ser/Thr_prot_kinase_AS. IPR002290. Ser/Thr_prot_kinase_dom. [Graphical view] |
| Pfam | PF00069. Pkinase. 1 hit. [Graphical view] |
| SMART | SM00220. S_TKc. 1 hit. [Graphical view] |
| PROSITE | PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 304347. |
| SOURCE | Search... |
Entry information
| Entry name | MP2K3_MOUSE | ||||||||
| Accession | Primary (citable) accession number: O09110 Secondary accession number(s): P97293, Q91VX1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| SIMILARITY comments Index of protein domains and families |

Clusters with


