O09110 (MP2K3_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 121.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Dual specificity mitogen-activated protein kinase kinase 3 Short name=MAP kinase kinase 3 Short name=MAPKK 3 EC=2.7.12.2 Alternative name(s): MAPK/ERK kinase 3 Short name=MEK 3 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 347 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Dual specificity kinase. Is activated by cytokines and environmental stress in vivo. Catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in the MAP kinase p38 By similarity. |
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. |
| Enzyme regulation | Activated by dual phosphorylation on Ser-218 and Thr-222 By similarity. |
| Subunit structure | Binds to DYRK1B/MIRK and increases its kinase activity By similarity. Part of a complex with MAP3K3, RAC1 and CCM2. Interacts with ARRB1 By similarity. Ref.5 |
| Post-translational modification | Phosphorylation on Ser-218 and Thr-222 by MAP kinase kinase kinases regulates positively the kinase activity. Phosphorylated by TAOK2 By similarity. Autophosphorylated. |
| Sequence similarities | Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase subfamily. Contains 1 protein kinase domain. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 2 (identifier: O09110-1) Also known as: 3b; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 1 (identifier: O09110-2) The sequence of this isoform differs from the canonical sequence as follows: 1-37: MESPAASPPASLPQTKGKSKRKKDLRISCVSKPPVSN → MSKP |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 347 | 347 | Dual specificity mitogen-activated protein kinase kinase 3 | PRO_0000086379 | |||||
Regions | |||||||||
| Domain | 64 – 325 | 262 | Protein kinase | ||||||
| Nucleotide binding | 70 – 78 | 9 | ATP By similarity | ||||||
Sites | |||||||||
| Active site | 190 | 1 | Proton acceptor By similarity | ||||||
| Binding site | 93 | 1 | ATP By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 1 | 1 | N-acetylmethionine By similarity | ||||||
| Modified residue | 3 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 218 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 222 | 1 | Phosphothreonine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 37 | 37 | MESPA…PPVSN → MSKP in isoform 1. | VSP_004879 | |||||
Experimental info | |||||||||
| Sequence conflict | 39 | 1 | T → A Ref.1 | ||||||
| Sequence conflict | 60 | 1 | E → K in CAA63649. Ref.1 | ||||||
| Sequence conflict | 173 – 347 | 175 | IVRAL…LGEDS → M Ref.4 | ||||||
| Sequence conflict | 216 | 1 | V → E in CAA63649. Ref.1 | ||||||
| Sequence conflict | 292 | 1 | D → Y in CAA63649. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | Neininger A., Gaestel M. Submitted (JAN-1997) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Purification and identification of a major activator for p38 from osmotically shocked cells: activation of mitogen-activated protein kinase kinase 6 by osmotic shock, tumor necrosis factor-alpha, and H2O2." Moriguchi T., Toyoshima F., Gotoh Y., Iwamatsu A., Irie K., Mori E., Kuroyanagi N., Hagiwara M., Matsumoto K., Nishida E. J. Biol. Chem. 271:26981-26988(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [3] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Strain: C57BL/6J. Tissue: Embryonic liver and Small intestine. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Mammary gland. |
| [5] | "Rac-MEKK3-MKK3 scaffolding for p38 MAPK activation during hyperosmotic shock." Uhlik M.T., Abell A.N., Johnson N.L., Sun W., Cuevas B.D., Lobel-Rice K.E., Horne E.A., Dell'Acqua M.L., Johnson G.L. Nat. Cell Biol. 5:1104-1110(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH MAP3K3; RAC1 AND CCM2. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | X93150 mRNA. Translation: CAA63649.1. D87115 mRNA. Translation: BAA13247.1. AK011002 mRNA. Translation: BAB27321.1. AK008141 mRNA. Translation: BAB25489.1. BC007467 mRNA. Translation: AAH07467.1. | ||||||||||||
| IPI | IPI00114245. IPI00230052. | ||||||||||||
| RefSeq | NP_032954.1. NM_008928.4. | ||||||||||||
| UniGene | Mm.18494. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | O09110. | ||||||||||||
| SMR | O09110. Positions 16-345. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | O09110. 2 interactions. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | O09110. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | O09110. | ||||||||||||
| PRIDE | O09110. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENSMUST00000019076; ENSMUSP00000019076; ENSMUSG00000018932. ENSMUST00000130269; ENSMUSP00000114430; ENSMUSG00000018932. | ||||||||||||
| GeneID | 26397. | ||||||||||||
| KEGG | mmu:26397. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 5606. | ||||||||||||
| MGI | MGI:1346868. Map2k3. | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | COG0515. | ||||||||||||
| GeneTree | ENSGT00690000102058. | ||||||||||||
| HOGENOM | HOG000234206. | ||||||||||||
| HOVERGEN | HBG108518. | ||||||||||||
| InParanoid | O09110. | ||||||||||||
| KO | K04432. | ||||||||||||
| OMA | LRISCVS. | ||||||||||||
| OrthoDB | EOG4P2Q2M. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| BRENDA | 2.7.12.2. 3474. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | O09110. | ||||||||||||
| Bgee | O09110. | ||||||||||||
| CleanEx | MM_MAP2K3. | ||||||||||||
| Genevestigator | O09110. | ||||||||||||
| GermOnline | ENSMUSG00000018932. Mus musculus. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR011009. Kinase-like_dom. IPR000719. Prot_kinase_cat_dom. IPR017441. Protein_kinase_ATP_BS. IPR002290. Ser/Thr_dual-sp_kinase_dom. IPR008271. Ser/Thr_kinase_AS. [Graphical view] | ||||||||||||
| Pfam | PF00069. Pkinase. 1 hit. [Graphical view] | ||||||||||||
| SMART | SM00220. S_TKc. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF56112. Kinase_like. 1 hit. | ||||||||||||
| PROSITE | PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| NextBio | 304347. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | MP2K3_MOUSE | ||||||||
| Accession | Primary (citable) accession number: O09110 Secondary accession number(s): P97293, Q91VX1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
