Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O08715

- AKAP1_MOUSE

UniProt

O08715 - AKAP1_MOUSE

Protein

A-kinase anchor protein 1, mitochondrial

Gene

Akap1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 132 (01 Oct 2014)
      Sequence version 4 (27 Jul 2011)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Differentially targeted protein that binds to type I and II regulatory subunits of protein kinase A. Anchors them to the cytoplasmic face of the mitochondrial outer membrane or allows them to reside in the endoplasmic reticulum. Does not contain the classic KDEL endoplasmic reticulum-targeting sequence. This explains how it is able to switch its localization, either being in the endoplasmic reticulum or in the mitochondria depending on which N-terminal part begins the isoform. The longest N-terminal part only present in isoform 2 and isoform 4 acts as a suppressor of mitochondrial targeting and as an activator of recessive endoplasmic reticulum targeting motif.

    GO - Molecular functioni

    1. protein binding Source: IntAct
    2. RNA binding Source: UniProtKB-KW

    Keywords - Ligandi

    RNA-binding

    Enzyme and pathway databases

    ReactomeiREACT_198649. Factors involved in megakaryocyte development and platelet production.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    A-kinase anchor protein 1, mitochondrial
    Alternative name(s):
    Dual specificity A-kinase-anchoring protein 1
    Short name:
    D-AKAP-1
    Protein kinase A-anchoring protein 1
    Short name:
    PRKA1
    Spermatid A-kinase anchor protein
    Short name:
    S-AKAP
    Gene namesi
    Name:Akap1
    Synonyms:Akap
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 11

    Organism-specific databases

    MGIiMGI:104729. Akap1.

    Subcellular locationi

    GO - Cellular componenti

    1. endoplasmic reticulum Source: UniProtKB-SubCell
    2. integral component of membrane Source: UniProtKB-KW
    3. mitochondrial outer membrane Source: UniProtKB-SubCell
    4. mitochondrion Source: MGI

    Keywords - Cellular componenti

    Endoplasmic reticulum, Membrane, Mitochondrion, Mitochondrion outer membrane

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transit peptidei1 – 2929MitochondrionBy similarityAdd
    BLAST
    Chaini30 – 857828A-kinase anchor protein 1, mitochondrialPRO_0000016660Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei55 – 551Phosphoserine2 Publications
    Modified residuei101 – 1011Phosphoserine1 Publication
    Modified residuei103 – 1031Phosphoserine1 Publication
    Modified residuei164 – 1641PhosphoserineBy similarity
    Modified residuei401 – 4011PhosphothreonineBy similarity
    Modified residuei487 – 4871PhosphothreonineBy similarity

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiO08715.
    PaxDbiO08715.
    PRIDEiO08715.

    PTM databases

    PhosphoSiteiO08715.

    Expressioni

    Tissue specificityi

    Highest expression in testis, heart, liver, skeletal muscle, intestine and kidney, followed by brain and lung. No expression in spleen. Isoform 1/D-AKAP1A is expressed predominantly in testis whereas isoform 4/D-AKAP1D is expressed primarily in liver.

    Gene expression databases

    BgeeiO08715.
    CleanExiMM_AKAP1.
    GenevestigatoriO08715.

    Interactioni

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    PTPN21Q168252EBI-9117988,EBI-2860264From a different organism.
    Siah2Q069866EBI-7838029,EBI-957413

    Protein-protein interaction databases

    BioGridi198048. 3 interactions.
    IntActiO08715. 8 interactions.
    MINTiMINT-4087417.

    Structurei

    3D structure databases

    ProteinModelPortaliO08715.
    SMRiO08715. Positions 712-821.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini561 – 62565KHPROSITE-ProRule annotationAdd
    BLAST
    Domaini712 – 77160TudorPROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni306 – 31914PKA-RII subunit binding domainAdd
    BLAST

    Domaini

    RII-alpha binding site, predicted to form an amphipathic helix, could participate in protein-protein interactions with a complementary surface on the R-subunit dimer.

    Sequence similaritiesi

    Contains 1 KH domain.PROSITE-ProRule annotation
    Contains 1 Tudor domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Transit peptide, Transmembrane

    Phylogenomic databases

    eggNOGiNOG306785.
    GeneTreeiENSGT00390000001360.
    HOGENOMiHOG000013170.
    HOVERGENiHBG057436.
    InParanoidiB1AR25.
    KOiK16518.
    OMAiDLIIWEI.
    OrthoDBiEOG779NXH.
    TreeFamiTF105401.

    Family and domain databases

    Gene3Di3.30.1370.10. 1 hit.
    InterProiIPR004087. KH_dom.
    IPR004088. KH_dom_type_1.
    IPR002999. Tudor.
    [Graphical view]
    PfamiPF00013. KH_1. 1 hit.
    PF00567. TUDOR. 1 hit.
    [Graphical view]
    SMARTiSM00322. KH. 1 hit.
    SM00333. TUDOR. 1 hit.
    [Graphical view]
    SUPFAMiSSF54791. SSF54791. 1 hit.
    PROSITEiPS50084. KH_TYPE_1. 1 hit.
    PS50304. TUDOR. 1 hit.
    [Graphical view]

    Sequences (6)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 6 isoformsi produced by alternative splicing. Align

    Isoform 3 (identifier: O08715-1) [UniParc]FASTAAdd to Basket

    Also known as: D-AKAP1C, AKAP121

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAIQLRSLFP LALPGMLALL GWWWFFSRKK DRLSSSDKQV ETLKVGPAIK    50
    DRRLSEEACP GVLSVAPTVT QPPGREEQRC VDKPSTEPLA LPRTRQVRRR 100
    SESSGNLPSV ADTRSQPGPC RDEIAKVELS LMGDKAKSIP LGCPLLPKDA 150
    SFPYEAVERC KQESALGKTP GRGWPSPYAA SGEKARETGG TEGTGDAVLG 200
    ENVSEEGLLS QECVSEVEKS EFPILAPGGG EGEEVSHGPP QVAELLKKEE 250
    YIVGKLPSSF VEPVHSEPVK DEDALEPQVK GSSNTSDRDL AGELDKDETV 300
    PENDQIKQAA FQLISQVILE ATEEFRATTV GKTVAQVHPT SATQPKGKEE 350
    SCVPASQETS LGQDTSDPAS TRTGATASPS AEALPPKTYV SCLSSPLSGP 400
    TKDQKPKNSA HHISLAPCPP PVTPQRQSLE GASNPRGDDN FVACMANNSQ 450
    SVLSVSSLGQ CSDPVSTSGL EDSCTETISS SGDKAMTPPL PVSTQPFSNG 500
    VLKEELSDLG TEDGWTMDTE ADHSGGSDGN SMDSVDSCCG LTKPDSPQSV 550
    QAGSNPKKVD LIIWEIEVPK HLVGRLIGKQ GRYVSFLKQT SGAKIYISTL 600
    PYTQNIQICH IEGSQHHVDK ALNLIGKKFK ELNLTNIYAP PLPSLALPSL 650
    PMTSWLMLPD GITVEVIVVN QVNAGHLFVQ QHTHPTFHAL RSLDQQMYLC 700
    YSQPGIPTLP TPVEITVICA APGADGAWWR AQVVASYEET NEVEIRYVDY 750
    GGYKRVKVDV LRQIRSDFVT LPFQGAEVLL DSVVPLSDDD HFSPEADAAM 800
    SEMTGNTALL AQVTSYSATG LPLIQLWSVV GDEVVLINRS LVERGLAQWV 850
    DSYYASL 857
    Length:857
    Mass (Da):92,195
    Last modified:July 27, 2011 - v4
    Checksum:i455679FCF95C28E6
    GO
    Isoform 1 (identifier: O08715-2) [UniParc]FASTAAdd to Basket

    Also known as: D-AKAP1A

    The sequence of this isoform differs from the canonical sequence as follows:
         527-544: SDGNSMDSVDSCCGLTKP → RKVLGCFLGESGRGPIIC
         545-857: Missing.

    Show »
    Length:544
    Mass (Da):57,680
    Checksum:i24F297D5CB332F7A
    GO
    Isoform 2 (identifier: O08715-3) [UniParc]FASTAAdd to Basket

    Also known as: D-AKAP1B

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MGCKTGPKPFGGGETIRPIRIRRCSYFTSTDSKM
         527-544: SDGNSMDSVDSCCGLTKP → RKVLGCFLGESGRGPIIC
         545-857: Missing.

    Show »
    Length:577
    Mass (Da):61,311
    Checksum:iF18916F0BE7B88A2
    GO
    Isoform 4 (identifier: O08715-4) [UniParc]FASTAAdd to Basket

    Also known as: D-AKAP1D

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MGCKTGPKPFGGGETIRPIRIRRCSYFTSTDSKM

    Show »
    Length:890
    Mass (Da):95,825
    Checksum:iB4F8830C72620DF1
    GO
    Isoform 5 (identifier: O08715-5) [UniParc]FASTAAdd to Basket

    Also known as: S-AKAP84

    The sequence of this isoform differs from the canonical sequence as follows:
         526-547: GSDGNSMDSVDSCCGLTKPDSP → VAAPPQERGHFGNGGCTGFFEC
         548-857: Missing.

    Show »
    Length:547
    Mass (Da):58,000
    Checksum:i83069FB21BFA3628
    GO
    Isoform 6 (identifier: O08715-6) [UniParc]FASTAAdd to Basket

    Also known as: AKAP100

    The sequence of this isoform differs from the canonical sequence as follows:
         614-637: SQHHVDKALNLIGKKFKELNLTNI → CVSVLTRRLSAPCRQSSELDWEEV
         638-857: Missing.

    Show »
    Length:637
    Mass (Da):68,012
    Checksum:iE40401F94CFFE7DF
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti80 – 801C → S in AAC27100. 1 PublicationCurated
    Sequence conflicti80 – 801C → S in AAB53740. (PubMed:9182549)Curated
    Sequence conflicti80 – 801C → S in AAB53741. (PubMed:9182549)Curated
    Sequence conflicti220 – 2201S → I in AAC27100. 1 PublicationCurated
    Sequence conflicti325 – 3251F → L in AAC27100. 1 PublicationCurated
    Sequence conflicti325 – 3251F → L in AAB53740. (PubMed:9182549)Curated
    Sequence conflicti325 – 3251F → L in AAB53741. (PubMed:9182549)Curated
    Sequence conflicti327 – 3271A → P in AAB53740. (PubMed:9182549)Curated
    Sequence conflicti327 – 3271A → P in AAB53741. (PubMed:9182549)Curated
    Sequence conflicti340 – 3401T → I in AAC27100. 1 PublicationCurated
    Sequence conflicti340 – 3401T → I in AAB53740. (PubMed:9182549)Curated
    Sequence conflicti340 – 3401T → I in AAB53741. (PubMed:9182549)Curated
    Sequence conflicti486 – 4861M → I in AAC27100. 1 PublicationCurated
    Sequence conflicti486 – 4861M → I in AAB53740. (PubMed:9182549)Curated
    Sequence conflicti486 – 4861M → I in AAB53741. (PubMed:9182549)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11M → MGCKTGPKPFGGGETIRPIR IRRCSYFTSTDSKM in isoform 2 and isoform 4. 1 PublicationVSP_002847
    Alternative sequencei526 – 54722GSDGN…KPDSP → VAAPPQERGHFGNGGCTGFF EC in isoform 5. 1 PublicationVSP_002850Add
    BLAST
    Alternative sequencei527 – 54418SDGNS…GLTKP → RKVLGCFLGESGRGPIIC in isoform 1 and isoform 2. 1 PublicationVSP_002848Add
    BLAST
    Alternative sequencei545 – 857313Missing in isoform 1 and isoform 2. 1 PublicationVSP_002849Add
    BLAST
    Alternative sequencei548 – 857310Missing in isoform 5. 1 PublicationVSP_002851Add
    BLAST
    Alternative sequencei614 – 63724SQHHV…NLTNI → CVSVLTRRLSAPCRQSSELD WEEV in isoform 6. 1 PublicationVSP_002852Add
    BLAST
    Alternative sequencei638 – 857220Missing in isoform 6. 1 PublicationVSP_002853Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U84389 mRNA. Translation: AAC27100.1.
    U95145 mRNA. Translation: AAB53740.1.
    U95146 mRNA. Translation: AAB53741.1.
    AL596180 Genomic DNA. Translation: CAI24699.1.
    CCDSiCCDS25229.1. [O08715-1]
    RefSeqiNP_001036006.1. NM_001042541.1. [O08715-1]
    NP_033778.2. NM_009648.2. [O08715-1]
    UniGeneiMm.2969.

    Genome annotation databases

    EnsembliENSMUST00000018572; ENSMUSP00000018572; ENSMUSG00000018428. [O08715-1]
    ENSMUST00000107903; ENSMUSP00000103536; ENSMUSG00000018428. [O08715-1]
    ENSMUST00000107904; ENSMUSP00000103537; ENSMUSG00000018428. [O08715-4]
    ENSMUST00000143720; ENSMUSP00000122295; ENSMUSG00000018428. [O08715-5]
    GeneIDi11640.
    KEGGimmu:11640.
    UCSCiuc007kvu.1. mouse. [O08715-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U84389 mRNA. Translation: AAC27100.1 .
    U95145 mRNA. Translation: AAB53740.1 .
    U95146 mRNA. Translation: AAB53741.1 .
    AL596180 Genomic DNA. Translation: CAI24699.1 .
    CCDSi CCDS25229.1. [O08715-1 ]
    RefSeqi NP_001036006.1. NM_001042541.1. [O08715-1 ]
    NP_033778.2. NM_009648.2. [O08715-1 ]
    UniGenei Mm.2969.

    3D structure databases

    ProteinModelPortali O08715.
    SMRi O08715. Positions 712-821.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 198048. 3 interactions.
    IntActi O08715. 8 interactions.
    MINTi MINT-4087417.

    PTM databases

    PhosphoSitei O08715.

    Proteomic databases

    MaxQBi O08715.
    PaxDbi O08715.
    PRIDEi O08715.

    Protocols and materials databases

    DNASUi 11640.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000018572 ; ENSMUSP00000018572 ; ENSMUSG00000018428 . [O08715-1 ]
    ENSMUST00000107903 ; ENSMUSP00000103536 ; ENSMUSG00000018428 . [O08715-1 ]
    ENSMUST00000107904 ; ENSMUSP00000103537 ; ENSMUSG00000018428 . [O08715-4 ]
    ENSMUST00000143720 ; ENSMUSP00000122295 ; ENSMUSG00000018428 . [O08715-5 ]
    GeneIDi 11640.
    KEGGi mmu:11640.
    UCSCi uc007kvu.1. mouse. [O08715-1 ]

    Organism-specific databases

    CTDi 8165.
    MGIi MGI:104729. Akap1.

    Phylogenomic databases

    eggNOGi NOG306785.
    GeneTreei ENSGT00390000001360.
    HOGENOMi HOG000013170.
    HOVERGENi HBG057436.
    InParanoidi B1AR25.
    KOi K16518.
    OMAi DLIIWEI.
    OrthoDBi EOG779NXH.
    TreeFami TF105401.

    Enzyme and pathway databases

    Reactomei REACT_198649. Factors involved in megakaryocyte development and platelet production.

    Miscellaneous databases

    NextBioi 279219.
    PROi O08715.
    SOURCEi Search...

    Gene expression databases

    Bgeei O08715.
    CleanExi MM_AKAP1.
    Genevestigatori O08715.

    Family and domain databases

    Gene3Di 3.30.1370.10. 1 hit.
    InterProi IPR004087. KH_dom.
    IPR004088. KH_dom_type_1.
    IPR002999. Tudor.
    [Graphical view ]
    Pfami PF00013. KH_1. 1 hit.
    PF00567. TUDOR. 1 hit.
    [Graphical view ]
    SMARTi SM00322. KH. 1 hit.
    SM00333. TUDOR. 1 hit.
    [Graphical view ]
    SUPFAMi SSF54791. SSF54791. 1 hit.
    PROSITEi PS50084. KH_TYPE_1. 1 hit.
    PS50304. TUDOR. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Identification of a novel protein kinase A anchoring protein that binds both type I and type II regulatory subunits."
      Huang L.J.-S., Durick K., Weiner J.A., Chun J., Taylor S.S.
      J. Biol. Chem. 272:8057-8064(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4).
      Tissue: Embryo.
    2. Huang L.J.-S., Durick K., Taylor S.S.
      Submitted (JUL-1998) to the EMBL/GenBank/DDBJ databases
      Cited for: SEQUENCE REVISION.
    3. "Organelle-specific targeting of protein kinase AII (PKAII). Molecular and in situ characterization of murine A kinase anchor proteins that recruit regulatory subunits of PKAII to the cytoplasmic surface of mitochondria."
      Chen Q., Lin R.-Y., Rubin C.S.
      J. Biol. Chem. 272:15247-15257(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3; 5 AND 6).
      Strain: BALB/c.
      Tissue: Testis.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    5. "NH2-Terminal targeting motifs direct dual specificity A-kinase-anchoring protein 1 (D-AKAP1) to either mitochondria or endoplasmic reticulum."
      Huang L.J.-S., Wang L., Ma Y., Durick K., Perkins G., Deerinck T.J., Ellisman M.H., Taylor S.S.
      J. Cell Biol. 145:951-959(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION.
    6. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-55; SER-101 AND SER-103, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Liver.
    7. "Specific phosphopeptide enrichment with immobilized titanium ion affinity chromatography adsorbent for phosphoproteome analysis."
      Zhou H., Ye M., Dong J., Han G., Jiang X., Wu R., Zou H.
      J. Proteome Res. 7:3957-3967(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-55, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Liver.

    Entry informationi

    Entry nameiAKAP1_MOUSE
    AccessioniPrimary (citable) accession number: O08715
    Secondary accession number(s): B1AR25, O08714, P97488
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 1, 2001
    Last sequence update: July 27, 2011
    Last modified: October 1, 2014
    This is version 132 of the entry and version 4 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3