Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

O08715 (AKAP1_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 130. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
A-kinase anchor protein 1, mitochondrial
Alternative name(s):
Dual specificity A-kinase-anchoring protein 1
Short name=D-AKAP-1
Protein kinase A-anchoring protein 1
Short name=PRKA1
Spermatid A-kinase anchor protein
Short name=S-AKAP
Gene names
Name:Akap1
Synonyms:Akap
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length857 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Differentially targeted protein that binds to type I and II regulatory subunits of protein kinase A. Anchors them to the cytoplasmic face of the mitochondrial outer membrane or allows them to reside in the endoplasmic reticulum. Does not contain the classic KDEL endoplasmic reticulum-targeting sequence. This explains how it is able to switch its localization, either being in the endoplasmic reticulum or in the mitochondria depending on which N-terminal part begins the isoform. The longest N-terminal part only present in isoform 2 and isoform 4 acts as a suppressor of mitochondrial targeting and as an activator of recessive endoplasmic reticulum targeting motif.

Subcellular location

Isoform 2: Endoplasmic reticulum Ref.5.

Isoform 4: Endoplasmic reticulum Ref.5.

Isoform 1: Mitochondrion outer membrane Ref.5.

Isoform 3: Mitochondrion outer membrane Ref.5.

Isoform 5: Mitochondrion outer membrane Ref.5.

Isoform 6: Mitochondrion outer membrane Ref.5.

Tissue specificity

Highest expression in testis, heart, liver, skeletal muscle, intestine and kidney, followed by brain and lung. No expression in spleen. Isoform 1/D-AKAP1Ais expressed predominantly in testis whereas isoform 4/D-AKAP1Dis expressed primarily in liver.

Domain

RII-alpha binding site, predicted to form an amphipathic helix, could participate in protein-protein interactions with a complementary surface on the R-subunit dimer.

Sequence similarities

Contains 1 KH domain.

Contains 1 Tudor domain.

Binary interactions

With

Entry

#Exp.

IntAct

Notes

PTPN21Q168252EBI-9117988,EBI-2860264From a different organism.
Siah2Q069866EBI-7838029,EBI-957413

Alternative products

This entry describes 6 isoforms produced by alternative splicing. [Align] [Select]
Isoform 3 (identifier: O08715-1)

Also known as: D-AKAP1C; AKAP121;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 1 (identifier: O08715-2)

Also known as: D-AKAP1A;

The sequence of this isoform differs from the canonical sequence as follows:
     527-544: SDGNSMDSVDSCCGLTKP → RKVLGCFLGESGRGPIIC
     545-857: Missing.
Isoform 2 (identifier: O08715-3)

Also known as: D-AKAP1B;

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGCKTGPKPFGGGETIRPIRIRRCSYFTSTDSKM
     527-544: SDGNSMDSVDSCCGLTKP → RKVLGCFLGESGRGPIIC
     545-857: Missing.
Isoform 4 (identifier: O08715-4)

Also known as: D-AKAP1D;

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGCKTGPKPFGGGETIRPIRIRRCSYFTSTDSKM
Isoform 5 (identifier: O08715-5)

Also known as: S-AKAP84;

The sequence of this isoform differs from the canonical sequence as follows:
     526-547: GSDGNSMDSVDSCCGLTKPDSP → VAAPPQERGHFGNGGCTGFFEC
     548-857: Missing.
Isoform 6 (identifier: O08715-6)

Also known as: AKAP100;

The sequence of this isoform differs from the canonical sequence as follows:
     614-637: SQHHVDKALNLIGKKFKELNLTNI → CVSVLTRRLSAPCRQSSELDWEEV
     638-857: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Transit peptide1 – 2929Mitochondrion By similarity
Chain30 – 857828A-kinase anchor protein 1, mitochondrial
PRO_0000016660

Regions

Domain561 – 62565KH
Domain712 – 77160Tudor
Region306 – 31914PKA-RII subunit binding domain

Amino acid modifications

Modified residue551Phosphoserine Ref.6 Ref.7
Modified residue1011Phosphoserine Ref.6
Modified residue1031Phosphoserine Ref.6
Modified residue1641Phosphoserine By similarity
Modified residue4011Phosphothreonine By similarity
Modified residue4871Phosphothreonine By similarity

Natural variations

Alternative sequence11M → MGCKTGPKPFGGGETIRPIR IRRCSYFTSTDSKM in isoform 2 and isoform 4.
VSP_002847
Alternative sequence526 – 54722GSDGN…KPDSP → VAAPPQERGHFGNGGCTGFF EC in isoform 5.
VSP_002850
Alternative sequence527 – 54418SDGNS…GLTKP → RKVLGCFLGESGRGPIIC in isoform 1 and isoform 2.
VSP_002848
Alternative sequence545 – 857313Missing in isoform 1 and isoform 2.
VSP_002849
Alternative sequence548 – 857310Missing in isoform 5.
VSP_002851
Alternative sequence614 – 63724SQHHV…NLTNI → CVSVLTRRLSAPCRQSSELD WEEV in isoform 6.
VSP_002852
Alternative sequence638 – 857220Missing in isoform 6.
VSP_002853

Experimental info

Sequence conflict801C → S in AAC27100. Ref.2
Sequence conflict801C → S in AAB53740. Ref.3
Sequence conflict801C → S in AAB53741. Ref.3
Sequence conflict2201S → I in AAC27100. Ref.2
Sequence conflict3251F → L in AAC27100. Ref.2
Sequence conflict3251F → L in AAB53740. Ref.3
Sequence conflict3251F → L in AAB53741. Ref.3
Sequence conflict3271A → P in AAB53740. Ref.3
Sequence conflict3271A → P in AAB53741. Ref.3
Sequence conflict3401T → I in AAC27100. Ref.2
Sequence conflict3401T → I in AAB53740. Ref.3
Sequence conflict3401T → I in AAB53741. Ref.3
Sequence conflict4861M → I in AAC27100. Ref.2
Sequence conflict4861M → I in AAB53740. Ref.3
Sequence conflict4861M → I in AAB53741. Ref.3

Sequences

Sequence LengthMass (Da)Tools
Isoform 3 (D-AKAP1C) (AKAP121) [UniParc].

Last modified July 27, 2011. Version 4.
Checksum: 455679FCF95C28E6

FASTA85792,195
        10         20         30         40         50         60 
MAIQLRSLFP LALPGMLALL GWWWFFSRKK DRLSSSDKQV ETLKVGPAIK DRRLSEEACP 

        70         80         90        100        110        120 
GVLSVAPTVT QPPGREEQRC VDKPSTEPLA LPRTRQVRRR SESSGNLPSV ADTRSQPGPC 

       130        140        150        160        170        180 
RDEIAKVELS LMGDKAKSIP LGCPLLPKDA SFPYEAVERC KQESALGKTP GRGWPSPYAA 

       190        200        210        220        230        240 
SGEKARETGG TEGTGDAVLG ENVSEEGLLS QECVSEVEKS EFPILAPGGG EGEEVSHGPP 

       250        260        270        280        290        300 
QVAELLKKEE YIVGKLPSSF VEPVHSEPVK DEDALEPQVK GSSNTSDRDL AGELDKDETV 

       310        320        330        340        350        360 
PENDQIKQAA FQLISQVILE ATEEFRATTV GKTVAQVHPT SATQPKGKEE SCVPASQETS 

       370        380        390        400        410        420 
LGQDTSDPAS TRTGATASPS AEALPPKTYV SCLSSPLSGP TKDQKPKNSA HHISLAPCPP 

       430        440        450        460        470        480 
PVTPQRQSLE GASNPRGDDN FVACMANNSQ SVLSVSSLGQ CSDPVSTSGL EDSCTETISS 

       490        500        510        520        530        540 
SGDKAMTPPL PVSTQPFSNG VLKEELSDLG TEDGWTMDTE ADHSGGSDGN SMDSVDSCCG 

       550        560        570        580        590        600 
LTKPDSPQSV QAGSNPKKVD LIIWEIEVPK HLVGRLIGKQ GRYVSFLKQT SGAKIYISTL 

       610        620        630        640        650        660 
PYTQNIQICH IEGSQHHVDK ALNLIGKKFK ELNLTNIYAP PLPSLALPSL PMTSWLMLPD 

       670        680        690        700        710        720 
GITVEVIVVN QVNAGHLFVQ QHTHPTFHAL RSLDQQMYLC YSQPGIPTLP TPVEITVICA 

       730        740        750        760        770        780 
APGADGAWWR AQVVASYEET NEVEIRYVDY GGYKRVKVDV LRQIRSDFVT LPFQGAEVLL 

       790        800        810        820        830        840 
DSVVPLSDDD HFSPEADAAM SEMTGNTALL AQVTSYSATG LPLIQLWSVV GDEVVLINRS 

       850 
LVERGLAQWV DSYYASL 

« Hide

Isoform 1 (D-AKAP1A) [UniParc].

Checksum: 24F297D5CB332F7A
Show »

FASTA54457,680
Isoform 2 (D-AKAP1B) [UniParc].

Checksum: F18916F0BE7B88A2
Show »

FASTA57761,311
Isoform 4 (D-AKAP1D) [UniParc].

Checksum: B4F8830C72620DF1
Show »

FASTA89095,825
Isoform 5 (S-AKAP84) [UniParc].

Checksum: 83069FB21BFA3628
Show »

FASTA54758,000
Isoform 6 (AKAP100) [UniParc].

Checksum: E40401F94CFFE7DF
Show »

FASTA63768,012

References

« Hide 'large scale' references
[1]"Identification of a novel protein kinase A anchoring protein that binds both type I and type II regulatory subunits."
Huang L.J.-S., Durick K., Weiner J.A., Chun J., Taylor S.S.
J. Biol. Chem. 272:8057-8064(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4).
Tissue: Embryo.
[2]Huang L.J.-S., Durick K., Taylor S.S.
Submitted (JUL-1998) to the EMBL/GenBank/DDBJ databases
Cited for: SEQUENCE REVISION.
[3]"Organelle-specific targeting of protein kinase AII (PKAII). Molecular and in situ characterization of murine A kinase anchor proteins that recruit regulatory subunits of PKAII to the cytoplasmic surface of mitochondria."
Chen Q., Lin R.-Y., Rubin C.S.
J. Biol. Chem. 272:15247-15257(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3; 5 AND 6).
Strain: BALB/c.
Tissue: Testis.
[4]"Lineage-specific biology revealed by a finished genome assembly of the mouse."
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. expand/collapse author list , Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.
PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: C57BL/6J.
[5]"NH2-Terminal targeting motifs direct dual specificity A-kinase-anchoring protein 1 (D-AKAP1) to either mitochondria or endoplasmic reticulum."
Huang L.J.-S., Wang L., Ma Y., Durick K., Perkins G., Deerinck T.J., Ellisman M.H., Taylor S.S.
J. Cell Biol. 145:951-959(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: SUBCELLULAR LOCATION.
[6]"Large-scale phosphorylation analysis of mouse liver."
Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-55; SER-101 AND SER-103, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Liver.
[7]"Specific phosphopeptide enrichment with immobilized titanium ion affinity chromatography adsorbent for phosphoproteome analysis."
Zhou H., Ye M., Dong J., Han G., Jiang X., Wu R., Zou H.
J. Proteome Res. 7:3957-3967(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-55, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Liver.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
U84389 mRNA. Translation: AAC27100.1.
U95145 mRNA. Translation: AAB53740.1.
U95146 mRNA. Translation: AAB53741.1.
AL596180 Genomic DNA. Translation: CAI24699.1.
CCDSCCDS25229.1. [O08715-1]
RefSeqNP_001036006.1. NM_001042541.1. [O08715-1]
NP_033778.2. NM_009648.2. [O08715-1]
UniGeneMm.2969.

3D structure databases

ProteinModelPortalO08715.
SMRO08715. Positions 712-821.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid198048. 3 interactions.
IntActO08715. 8 interactions.
MINTMINT-4087417.

PTM databases

PhosphoSiteO08715.

Proteomic databases

MaxQBO08715.
PaxDbO08715.
PRIDEO08715.

Protocols and materials databases

DNASU11640.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000018572; ENSMUSP00000018572; ENSMUSG00000018428. [O08715-1]
ENSMUST00000107903; ENSMUSP00000103536; ENSMUSG00000018428. [O08715-1]
ENSMUST00000107904; ENSMUSP00000103537; ENSMUSG00000018428. [O08715-4]
ENSMUST00000143720; ENSMUSP00000122295; ENSMUSG00000018428. [O08715-5]
GeneID11640.
KEGGmmu:11640.
UCSCuc007kvu.1. mouse. [O08715-1]

Organism-specific databases

CTD8165.
MGIMGI:104729. Akap1.

Phylogenomic databases

eggNOGNOG306785.
GeneTreeENSGT00390000001360.
HOGENOMHOG000013170.
HOVERGENHBG057436.
InParanoidB1AR25.
KOK16518.
OMADLIIWEI.
OrthoDBEOG779NXH.
TreeFamTF105401.

Gene expression databases

BgeeO08715.
CleanExMM_AKAP1.
GenevestigatorO08715.

Family and domain databases

Gene3D3.30.1370.10. 1 hit.
InterProIPR004087. KH_dom.
IPR004088. KH_dom_type_1.
IPR002999. Tudor.
[Graphical view]
PfamPF00013. KH_1. 1 hit.
PF00567. TUDOR. 1 hit.
[Graphical view]
SMARTSM00322. KH. 1 hit.
SM00333. TUDOR. 1 hit.
[Graphical view]
SUPFAMSSF54791. SSF54791. 1 hit.
PROSITEPS50084. KH_TYPE_1. 1 hit.
PS50304. TUDOR. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio279219.
PROO08715.
SOURCESearch...

Entry information

Entry nameAKAP1_MOUSE
AccessionPrimary (citable) accession number: O08715
Secondary accession number(s): B1AR25, O08714, P97488
Entry history
Integrated into UniProtKB/Swiss-Prot: June 1, 2001
Last sequence update: July 27, 2011
Last modified: July 9, 2014
This is version 130 of the entry and version 4 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot