Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O08715

- AKAP1_MOUSE

UniProt

O08715 - AKAP1_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

A-kinase anchor protein 1, mitochondrial

Gene

Akap1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Differentially targeted protein that binds to type I and II regulatory subunits of protein kinase A. Anchors them to the cytoplasmic face of the mitochondrial outer membrane or allows them to reside in the endoplasmic reticulum. Does not contain the classic KDEL endoplasmic reticulum-targeting sequence. This explains how it is able to switch its localization, either being in the endoplasmic reticulum or in the mitochondria depending on which N-terminal part begins the isoform. The longest N-terminal part only present in isoform 2 and isoform 4 acts as a suppressor of mitochondrial targeting and as an activator of recessive endoplasmic reticulum targeting motif.

GO - Molecular functioni

  1. poly(A) RNA binding Source: Ensembl
Complete GO annotation...

Keywords - Ligandi

RNA-binding

Enzyme and pathway databases

ReactomeiREACT_198649. Factors involved in megakaryocyte development and platelet production.

Names & Taxonomyi

Protein namesi
Recommended name:
A-kinase anchor protein 1, mitochondrial
Alternative name(s):
Dual specificity A-kinase-anchoring protein 1
Short name:
D-AKAP-1
Protein kinase A-anchoring protein 1
Short name:
PRKA1
Spermatid A-kinase anchor protein
Short name:
S-AKAP
Gene namesi
Name:Akap1
Synonyms:Akap
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 11

Organism-specific databases

MGIiMGI:104729. Akap1.

Subcellular locationi

GO - Cellular componenti

  1. endoplasmic reticulum Source: UniProtKB-KW
  2. integral component of membrane Source: UniProtKB-KW
  3. mitochondrial outer membrane Source: UniProtKB-KW
  4. mitochondrion Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane, Mitochondrion, Mitochondrion outer membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transit peptidei1 – 2929MitochondrionBy similarityAdd
BLAST
Chaini30 – 857828A-kinase anchor protein 1, mitochondrialPRO_0000016660Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei55 – 551Phosphoserine2 Publications
Modified residuei101 – 1011Phosphoserine1 Publication
Modified residuei103 – 1031Phosphoserine1 Publication
Modified residuei164 – 1641PhosphoserineBy similarity
Modified residuei401 – 4011PhosphothreonineBy similarity
Modified residuei487 – 4871PhosphothreonineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiO08715.
PaxDbiO08715.
PRIDEiO08715.

PTM databases

PhosphoSiteiO08715.

Expressioni

Tissue specificityi

Highest expression in testis, heart, liver, skeletal muscle, intestine and kidney, followed by brain and lung. No expression in spleen. Isoform 1/D-AKAP1A is expressed predominantly in testis whereas isoform 4/D-AKAP1D is expressed primarily in liver.

Gene expression databases

BgeeiO08715.
CleanExiMM_AKAP1.
GenevestigatoriO08715.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
PTPN21Q168252EBI-9117988,EBI-2860264From a different organism.
Siah2Q069866EBI-7838029,EBI-957413

Protein-protein interaction databases

BioGridi198048. 3 interactions.
IntActiO08715. 8 interactions.
MINTiMINT-4087417.

Structurei

3D structure databases

ProteinModelPortaliO08715.
SMRiO08715. Positions 712-821.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini561 – 62565KHPROSITE-ProRule annotationAdd
BLAST
Domaini712 – 77160TudorPROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni306 – 31914PKA-RII subunit binding domainAdd
BLAST

Domaini

RII-alpha binding site, predicted to form an amphipathic helix, could participate in protein-protein interactions with a complementary surface on the R-subunit dimer.

Sequence similaritiesi

Contains 1 KH domain.PROSITE-ProRule annotation
Contains 1 Tudor domain.PROSITE-ProRule annotation

Keywords - Domaini

Transit peptide, Transmembrane

Phylogenomic databases

eggNOGiNOG306785.
GeneTreeiENSGT00390000001360.
HOGENOMiHOG000013170.
HOVERGENiHBG057436.
InParanoidiO08715.
KOiK16518.
OMAiDLIIWEI.
OrthoDBiEOG779NXH.
TreeFamiTF105401.

Family and domain databases

Gene3Di3.30.1370.10. 1 hit.
InterProiIPR004087. KH_dom.
IPR004088. KH_dom_type_1.
IPR002999. Tudor.
[Graphical view]
PfamiPF00013. KH_1. 1 hit.
PF00567. TUDOR. 1 hit.
[Graphical view]
SMARTiSM00322. KH. 1 hit.
SM00333. TUDOR. 1 hit.
[Graphical view]
SUPFAMiSSF54791. SSF54791. 1 hit.
PROSITEiPS50084. KH_TYPE_1. 1 hit.
PS50304. TUDOR. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative splicing. Align

Isoform 3 (identifier: O08715-1) [UniParc]FASTAAdd to Basket

Also known as: D-AKAP1C, AKAP121

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAIQLRSLFP LALPGMLALL GWWWFFSRKK DRLSSSDKQV ETLKVGPAIK
60 70 80 90 100
DRRLSEEACP GVLSVAPTVT QPPGREEQRC VDKPSTEPLA LPRTRQVRRR
110 120 130 140 150
SESSGNLPSV ADTRSQPGPC RDEIAKVELS LMGDKAKSIP LGCPLLPKDA
160 170 180 190 200
SFPYEAVERC KQESALGKTP GRGWPSPYAA SGEKARETGG TEGTGDAVLG
210 220 230 240 250
ENVSEEGLLS QECVSEVEKS EFPILAPGGG EGEEVSHGPP QVAELLKKEE
260 270 280 290 300
YIVGKLPSSF VEPVHSEPVK DEDALEPQVK GSSNTSDRDL AGELDKDETV
310 320 330 340 350
PENDQIKQAA FQLISQVILE ATEEFRATTV GKTVAQVHPT SATQPKGKEE
360 370 380 390 400
SCVPASQETS LGQDTSDPAS TRTGATASPS AEALPPKTYV SCLSSPLSGP
410 420 430 440 450
TKDQKPKNSA HHISLAPCPP PVTPQRQSLE GASNPRGDDN FVACMANNSQ
460 470 480 490 500
SVLSVSSLGQ CSDPVSTSGL EDSCTETISS SGDKAMTPPL PVSTQPFSNG
510 520 530 540 550
VLKEELSDLG TEDGWTMDTE ADHSGGSDGN SMDSVDSCCG LTKPDSPQSV
560 570 580 590 600
QAGSNPKKVD LIIWEIEVPK HLVGRLIGKQ GRYVSFLKQT SGAKIYISTL
610 620 630 640 650
PYTQNIQICH IEGSQHHVDK ALNLIGKKFK ELNLTNIYAP PLPSLALPSL
660 670 680 690 700
PMTSWLMLPD GITVEVIVVN QVNAGHLFVQ QHTHPTFHAL RSLDQQMYLC
710 720 730 740 750
YSQPGIPTLP TPVEITVICA APGADGAWWR AQVVASYEET NEVEIRYVDY
760 770 780 790 800
GGYKRVKVDV LRQIRSDFVT LPFQGAEVLL DSVVPLSDDD HFSPEADAAM
810 820 830 840 850
SEMTGNTALL AQVTSYSATG LPLIQLWSVV GDEVVLINRS LVERGLAQWV

DSYYASL
Length:857
Mass (Da):92,195
Last modified:July 27, 2011 - v4
Checksum:i455679FCF95C28E6
GO
Isoform 1 (identifier: O08715-2) [UniParc]FASTAAdd to Basket

Also known as: D-AKAP1A

The sequence of this isoform differs from the canonical sequence as follows:
     527-544: SDGNSMDSVDSCCGLTKP → RKVLGCFLGESGRGPIIC
     545-857: Missing.

Show »
Length:544
Mass (Da):57,680
Checksum:i24F297D5CB332F7A
GO
Isoform 2 (identifier: O08715-3) [UniParc]FASTAAdd to Basket

Also known as: D-AKAP1B

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGCKTGPKPFGGGETIRPIRIRRCSYFTSTDSKM
     527-544: SDGNSMDSVDSCCGLTKP → RKVLGCFLGESGRGPIIC
     545-857: Missing.

Show »
Length:577
Mass (Da):61,311
Checksum:iF18916F0BE7B88A2
GO
Isoform 4 (identifier: O08715-4) [UniParc]FASTAAdd to Basket

Also known as: D-AKAP1D

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGCKTGPKPFGGGETIRPIRIRRCSYFTSTDSKM

Show »
Length:890
Mass (Da):95,825
Checksum:iB4F8830C72620DF1
GO
Isoform 5 (identifier: O08715-5) [UniParc]FASTAAdd to Basket

Also known as: S-AKAP84

The sequence of this isoform differs from the canonical sequence as follows:
     526-547: GSDGNSMDSVDSCCGLTKPDSP → VAAPPQERGHFGNGGCTGFFEC
     548-857: Missing.

Show »
Length:547
Mass (Da):58,000
Checksum:i83069FB21BFA3628
GO
Isoform 6 (identifier: O08715-6) [UniParc]FASTAAdd to Basket

Also known as: AKAP100

The sequence of this isoform differs from the canonical sequence as follows:
     614-637: SQHHVDKALNLIGKKFKELNLTNI → CVSVLTRRLSAPCRQSSELDWEEV
     638-857: Missing.

Show »
Length:637
Mass (Da):68,012
Checksum:iE40401F94CFFE7DF
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti80 – 801C → S in AAC27100. 1 PublicationCurated
Sequence conflicti80 – 801C → S in AAB53740. (PubMed:9182549)Curated
Sequence conflicti80 – 801C → S in AAB53741. (PubMed:9182549)Curated
Sequence conflicti220 – 2201S → I in AAC27100. 1 PublicationCurated
Sequence conflicti325 – 3251F → L in AAC27100. 1 PublicationCurated
Sequence conflicti325 – 3251F → L in AAB53740. (PubMed:9182549)Curated
Sequence conflicti325 – 3251F → L in AAB53741. (PubMed:9182549)Curated
Sequence conflicti327 – 3271A → P in AAB53740. (PubMed:9182549)Curated
Sequence conflicti327 – 3271A → P in AAB53741. (PubMed:9182549)Curated
Sequence conflicti340 – 3401T → I in AAC27100. 1 PublicationCurated
Sequence conflicti340 – 3401T → I in AAB53740. (PubMed:9182549)Curated
Sequence conflicti340 – 3401T → I in AAB53741. (PubMed:9182549)Curated
Sequence conflicti486 – 4861M → I in AAC27100. 1 PublicationCurated
Sequence conflicti486 – 4861M → I in AAB53740. (PubMed:9182549)Curated
Sequence conflicti486 – 4861M → I in AAB53741. (PubMed:9182549)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MGCKTGPKPFGGGETIRPIR IRRCSYFTSTDSKM in isoform 2 and isoform 4. 1 PublicationVSP_002847
Alternative sequencei526 – 54722GSDGN…KPDSP → VAAPPQERGHFGNGGCTGFF EC in isoform 5. 1 PublicationVSP_002850Add
BLAST
Alternative sequencei527 – 54418SDGNS…GLTKP → RKVLGCFLGESGRGPIIC in isoform 1 and isoform 2. 1 PublicationVSP_002848Add
BLAST
Alternative sequencei545 – 857313Missing in isoform 1 and isoform 2. 1 PublicationVSP_002849Add
BLAST
Alternative sequencei548 – 857310Missing in isoform 5. 1 PublicationVSP_002851Add
BLAST
Alternative sequencei614 – 63724SQHHV…NLTNI → CVSVLTRRLSAPCRQSSELD WEEV in isoform 6. 1 PublicationVSP_002852Add
BLAST
Alternative sequencei638 – 857220Missing in isoform 6. 1 PublicationVSP_002853Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U84389 mRNA. Translation: AAC27100.1.
U95145 mRNA. Translation: AAB53740.1.
U95146 mRNA. Translation: AAB53741.1.
AL596180 Genomic DNA. Translation: CAI24699.1.
CCDSiCCDS25229.1. [O08715-1]
RefSeqiNP_001036006.1. NM_001042541.1. [O08715-1]
NP_033778.2. NM_009648.2. [O08715-1]
UniGeneiMm.2969.

Genome annotation databases

EnsembliENSMUST00000018572; ENSMUSP00000018572; ENSMUSG00000018428. [O08715-1]
ENSMUST00000107903; ENSMUSP00000103536; ENSMUSG00000018428. [O08715-1]
ENSMUST00000107904; ENSMUSP00000103537; ENSMUSG00000018428. [O08715-4]
ENSMUST00000143720; ENSMUSP00000122295; ENSMUSG00000018428. [O08715-5]
GeneIDi11640.
KEGGimmu:11640.
UCSCiuc007kvu.1. mouse. [O08715-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U84389 mRNA. Translation: AAC27100.1 .
U95145 mRNA. Translation: AAB53740.1 .
U95146 mRNA. Translation: AAB53741.1 .
AL596180 Genomic DNA. Translation: CAI24699.1 .
CCDSi CCDS25229.1. [O08715-1 ]
RefSeqi NP_001036006.1. NM_001042541.1. [O08715-1 ]
NP_033778.2. NM_009648.2. [O08715-1 ]
UniGenei Mm.2969.

3D structure databases

ProteinModelPortali O08715.
SMRi O08715. Positions 712-821.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 198048. 3 interactions.
IntActi O08715. 8 interactions.
MINTi MINT-4087417.

PTM databases

PhosphoSitei O08715.

Proteomic databases

MaxQBi O08715.
PaxDbi O08715.
PRIDEi O08715.

Protocols and materials databases

DNASUi 11640.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000018572 ; ENSMUSP00000018572 ; ENSMUSG00000018428 . [O08715-1 ]
ENSMUST00000107903 ; ENSMUSP00000103536 ; ENSMUSG00000018428 . [O08715-1 ]
ENSMUST00000107904 ; ENSMUSP00000103537 ; ENSMUSG00000018428 . [O08715-4 ]
ENSMUST00000143720 ; ENSMUSP00000122295 ; ENSMUSG00000018428 . [O08715-5 ]
GeneIDi 11640.
KEGGi mmu:11640.
UCSCi uc007kvu.1. mouse. [O08715-1 ]

Organism-specific databases

CTDi 8165.
MGIi MGI:104729. Akap1.

Phylogenomic databases

eggNOGi NOG306785.
GeneTreei ENSGT00390000001360.
HOGENOMi HOG000013170.
HOVERGENi HBG057436.
InParanoidi O08715.
KOi K16518.
OMAi DLIIWEI.
OrthoDBi EOG779NXH.
TreeFami TF105401.

Enzyme and pathway databases

Reactomei REACT_198649. Factors involved in megakaryocyte development and platelet production.

Miscellaneous databases

NextBioi 279219.
PROi O08715.
SOURCEi Search...

Gene expression databases

Bgeei O08715.
CleanExi MM_AKAP1.
Genevestigatori O08715.

Family and domain databases

Gene3Di 3.30.1370.10. 1 hit.
InterProi IPR004087. KH_dom.
IPR004088. KH_dom_type_1.
IPR002999. Tudor.
[Graphical view ]
Pfami PF00013. KH_1. 1 hit.
PF00567. TUDOR. 1 hit.
[Graphical view ]
SMARTi SM00322. KH. 1 hit.
SM00333. TUDOR. 1 hit.
[Graphical view ]
SUPFAMi SSF54791. SSF54791. 1 hit.
PROSITEi PS50084. KH_TYPE_1. 1 hit.
PS50304. TUDOR. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of a novel protein kinase A anchoring protein that binds both type I and type II regulatory subunits."
    Huang L.J.-S., Durick K., Weiner J.A., Chun J., Taylor S.S.
    J. Biol. Chem. 272:8057-8064(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4).
    Tissue: Embryo.
  2. Huang L.J.-S., Durick K., Taylor S.S.
    Submitted (JUL-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: SEQUENCE REVISION.
  3. "Organelle-specific targeting of protein kinase AII (PKAII). Molecular and in situ characterization of murine A kinase anchor proteins that recruit regulatory subunits of PKAII to the cytoplasmic surface of mitochondria."
    Chen Q., Lin R.-Y., Rubin C.S.
    J. Biol. Chem. 272:15247-15257(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3; 5 AND 6).
    Strain: BALB/c.
    Tissue: Testis.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  5. "NH2-Terminal targeting motifs direct dual specificity A-kinase-anchoring protein 1 (D-AKAP1) to either mitochondria or endoplasmic reticulum."
    Huang L.J.-S., Wang L., Ma Y., Durick K., Perkins G., Deerinck T.J., Ellisman M.H., Taylor S.S.
    J. Cell Biol. 145:951-959(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION.
  6. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-55; SER-101 AND SER-103, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.
  7. "Specific phosphopeptide enrichment with immobilized titanium ion affinity chromatography adsorbent for phosphoproteome analysis."
    Zhou H., Ye M., Dong J., Han G., Jiang X., Wu R., Zou H.
    J. Proteome Res. 7:3957-3967(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-55, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.

Entry informationi

Entry nameiAKAP1_MOUSE
AccessioniPrimary (citable) accession number: O08715
Secondary accession number(s): B1AR25, O08714, P97488
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 1, 2001
Last sequence update: July 27, 2011
Last modified: October 29, 2014
This is version 133 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3