O08715 (AKAP1_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 118.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: A-kinase anchor protein 1, mitochondrial Alternative name(s): Dual specificity A-kinase-anchoring protein 1 Short name=D-AKAP-1 Protein kinase A-anchoring protein 1 Short name=PRKA1 Spermatid A-kinase anchor protein Short name=S-AKAP | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 857 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Differentially targeted protein that binds to type I and II regulatory subunits of protein kinase A. Anchors them to the cytoplasmic face of the mitochondrial outer membrane or allows them to reside in the endoplasmic reticulum. Does not contain the classic KDEL endoplasmic reticulum-targeting sequence. This explains how it is able to switch its localization, either being in the endoplasmic reticulum or in the mitochondria depending on which N-terminal part begins the isoform. The longest N-terminal part only present in isoform 2 and isoform 4 acts as a suppressor of mitochondrial targeting and as an activator of recessive endoplasmic reticulum targeting motif. |
| Subcellular location | Isoform 2: Endoplasmic reticulum Ref.5. Isoform 4: Endoplasmic reticulum Ref.5. Isoform 1: Mitochondrion outer membrane Ref.5. Isoform 3: Mitochondrion outer membrane Ref.5. Isoform 5: Mitochondrion outer membrane Ref.5. Isoform 6: Mitochondrion outer membrane Ref.5. |
| Tissue specificity | Highest expression in testis, heart, liver, skeletal muscle, intestine and kidney, followed by brain and lung. No expression in spleen. Isoform 1/D-AKAP1A is expressed predominantly in testis whereas isoform 4/D-AKAP1D is expressed primarily in liver. |
| Domain | RII-alpha binding site, predicted to form an amphipathic helix, could participate in protein-protein interactions with a complementary surface on the R-subunit dimer. |
| Sequence similarities | Contains 1 KH domain. Contains 1 Tudor domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Endoplasmic reticulum Membrane Mitochondrion Mitochondrion outer membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Transit peptide Transmembrane |
| Ligand | RNA-binding |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | endoplasmic reticulum Inferred from electronic annotation. Source: UniProtKB-SubCell integral to membraneInferred from electronic annotation. Source: UniProtKB-KW mitochondrial outer membraneInferred from electronic annotation. Source: UniProtKB-SubCell mitochondrionInferred from direct assay PubMed 14651853PubMed 18614015. Source: MGI |
| Molecular_function | RNA binding Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 6 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 3 (identifier: O08715-1) Also known as: D-AKAP1C; AKAP121; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 1 (identifier: O08715-2) Also known as: D-AKAP1A; The sequence of this isoform differs from the canonical sequence as follows: 527-544: SDGNSMDSVDSCCGLTKP → RKVLGCFLGESGRGPIIC 545-857: Missing. | ||||||
| Isoform 2 (identifier: O08715-3) Also known as: D-AKAP1B; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MGCKTGPKPFGGGETIRPIRIRRCSYFTSTDSKM 527-544: SDGNSMDSVDSCCGLTKP → RKVLGCFLGESGRGPIIC 545-857: Missing. | ||||||
| Isoform 4 (identifier: O08715-4) Also known as: D-AKAP1D; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MGCKTGPKPFGGGETIRPIRIRRCSYFTSTDSKM | ||||||
| Isoform 5 (identifier: O08715-5) Also known as: S-AKAP84; The sequence of this isoform differs from the canonical sequence as follows: 526-547: GSDGNSMDSVDSCCGLTKPDSP → VAAPPQERGHFGNGGCTGFFEC 548-857: Missing. | ||||||
| Isoform 6 (identifier: O08715-6) Also known as: AKAP100; The sequence of this isoform differs from the canonical sequence as follows: 614-637: SQHHVDKALNLIGKKFKELNLTNI → CVSVLTRRLSAPCRQSSELDWEEV 638-857: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Transit peptide | 1 – 29 | 29 | Mitochondrion By similarity | ||||||
| Chain | 30 – 857 | 828 | A-kinase anchor protein 1, mitochondrial | PRO_0000016660 | |||||
Regions | |||||||||
| Domain | 561 – 625 | 65 | KH | ||||||
| Domain | 712 – 771 | 60 | Tudor | ||||||
| Region | 306 – 319 | 14 | PKA-RII subunit binding domain | ||||||
Amino acid modifications | |||||||||
| Modified residue | 55 | 1 | Phosphoserine Ref.6 Ref.7 Ref.8 | ||||||
| Modified residue | 101 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 103 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 164 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 401 | 1 | Phosphothreonine By similarity | ||||||
| Modified residue | 487 | 1 | Phosphothreonine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 | 1 | M → MGCKTGPKPFGGGETIRPIR IRRCSYFTSTDSKM in isoform 2 and isoform 4. | VSP_002847 | |||||
| Alternative sequence | 526 – 547 | 22 | GSDGN…KPDSP → VAAPPQERGHFGNGGCTGFF EC in isoform 5. | VSP_002850 | |||||
| Alternative sequence | 527 – 544 | 18 | SDGNS…GLTKP → RKVLGCFLGESGRGPIIC in isoform 1 and isoform 2. | VSP_002848 | |||||
| Alternative sequence | 545 – 857 | 313 | Missing in isoform 1 and isoform 2. | VSP_002849 | |||||
| Alternative sequence | 548 – 857 | 310 | Missing in isoform 5. | VSP_002851 | |||||
| Alternative sequence | 614 – 637 | 24 | SQHHV…NLTNI → CVSVLTRRLSAPCRQSSELD WEEV in isoform 6. | VSP_002852 | |||||
| Alternative sequence | 638 – 857 | 220 | Missing in isoform 6. | VSP_002853 | |||||
Experimental info | |||||||||
| Sequence conflict | 80 | 1 | C → S in AAC27100. Ref.2 | ||||||
| Sequence conflict | 80 | 1 | C → S in AAB53740. Ref.3 | ||||||
| Sequence conflict | 80 | 1 | C → S in AAB53741. Ref.3 | ||||||
| Sequence conflict | 220 | 1 | S → I in AAC27100. Ref.2 | ||||||
| Sequence conflict | 325 | 1 | F → L in AAC27100. Ref.2 | ||||||
| Sequence conflict | 325 | 1 | F → L in AAB53740. Ref.3 | ||||||
| Sequence conflict | 325 | 1 | F → L in AAB53741. Ref.3 | ||||||
| Sequence conflict | 327 | 1 | A → P in AAB53740. Ref.3 | ||||||
| Sequence conflict | 327 | 1 | A → P in AAB53741. Ref.3 | ||||||
| Sequence conflict | 340 | 1 | T → I in AAC27100. Ref.2 | ||||||
| Sequence conflict | 340 | 1 | T → I in AAB53740. Ref.3 | ||||||
| Sequence conflict | 340 | 1 | T → I in AAB53741. Ref.3 | ||||||
| Sequence conflict | 486 | 1 | M → I in AAC27100. Ref.2 | ||||||
| Sequence conflict | 486 | 1 | M → I in AAB53740. Ref.3 | ||||||
| Sequence conflict | 486 | 1 | M → I in AAB53741. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of a novel protein kinase A anchoring protein that binds both type I and type II regulatory subunits." Huang L.J.-S., Durick K., Weiner J.A., Chun J., Taylor S.S. J. Biol. Chem. 272:8057-8064(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4). Tissue: Embryo. |
| [2] | Huang L.J.-S., Durick K., Taylor S.S. Submitted (JUL-1998) to the EMBL/GenBank/DDBJ databases Cited for: SEQUENCE REVISION. |
| [3] | "Organelle-specific targeting of protein kinase AII (PKAII). Molecular and in situ characterization of murine A kinase anchor proteins that recruit regulatory subunits of PKAII to the cytoplasmic surface of mitochondria." Chen Q., Lin R.-Y., Rubin C.S. J. Biol. Chem. 272:15247-15257(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3; 5 AND 6). Strain: BALB/c. Tissue: Testis. |
| [4] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6J. |
| [5] | "NH2-Terminal targeting motifs direct dual specificity A-kinase-anchoring protein 1 (D-AKAP1) to either mitochondria or endoplasmic reticulum." Huang L.J.-S., Wang L., Ma Y., Durick K., Perkins G., Deerinck T.J., Ellisman M.H., Taylor S.S. J. Cell Biol. 145:951-959(1999) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [6] | "Large-scale phosphorylation analysis of mouse liver." Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-55; SER-101 AND SER-103, MASS SPECTROMETRY. Tissue: Liver. |
| [7] | "Specific phosphopeptide enrichment with immobilized titanium ion affinity chromatography adsorbent for phosphoproteome analysis." Zhou H., Ye M., Dong J., Han G., Jiang X., Wu R., Zou H. J. Proteome Res. 7:3957-3967(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-55, MASS SPECTROMETRY. Tissue: Liver. |
| [8] | "Solid tumor proteome and phosphoproteome analysis by high resolution mass spectrometry." Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J., Faessler R., Mann M. J. Proteome Res. 7:5314-5326(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-55, MASS SPECTROMETRY. Tissue: Melanoma. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U84389 mRNA. Translation: AAC27100.1. U95145 mRNA. Translation: AAB53740.1. U95146 mRNA. Translation: AAB53741.1. AL596180 Genomic DNA. Translation: CAI24699.1. |
| IPI | IPI00115506. IPI00230589. IPI00230590. IPI00230591. IPI00230592. IPI00230593. |
| RefSeq | NP_001036006.1. NM_001042541.1. NP_033778.2. NM_009648.2. |
| UniGene | Mm.2969. |
3D structure databases | |
| ProteinModelPortal | O08715. |
| SMR | O08715. Positions 654-849. |
| ModBase | Search... |
Protein-protein interaction databases | |
| MINT | MINT-4087417. |
PTM databases | |
| PhosphoSite | O08715. |
Proteomic databases | |
| PaxDb | O08715. |
| PRIDE | O08715. |
Protocols and materials databases | |
| DNASU | 11640. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000018572; ENSMUSP00000018572; ENSMUSG00000018428. ENSMUST00000107903; ENSMUSP00000103536; ENSMUSG00000018428. ENSMUST00000107904; ENSMUSP00000103537; ENSMUSG00000018428. ENSMUST00000143720; ENSMUSP00000122295; ENSMUSG00000018428. |
| GeneID | 11640. |
| KEGG | mmu:11640. |
Organism-specific databases | |
| CTD | 8165. |
| MGI | MGI:104729. Akap1. |
Phylogenomic databases | |
| eggNOG | NOG306785. |
| GeneTree | ENSGT00390000001360. |
| HOGENOM | HOG000013170. |
| HOVERGEN | HBG057436. |
| InParanoid | B1AR25. |
| KO | K16518. |
| OMA | DLIIWEI. |
| OrthoDB | EOG40GCR6. |
Gene expression databases | |
| Bgee | O08715. |
| CleanEx | MM_AKAP1. |
| Genevestigator | O08715. |
| GermOnline | ENSMUSG00000018428. Mus musculus. |
Family and domain databases | |
| InterPro | IPR004087. KH_dom. IPR004088. KH_dom_type_1. IPR002999. Tudor. [Graphical view] |
| Pfam | PF00013. KH_1. 1 hit. PF00567. TUDOR. 1 hit. [Graphical view] |
| SMART | SM00322. KH. 1 hit. SM00333. TUDOR. 1 hit. [Graphical view] |
| PROSITE | PS50084. KH_TYPE_1. 1 hit. PS50304. TUDOR. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 279219. |
| SOURCE | Search... |
Entry information
| Entry name | AKAP1_MOUSE | ||||||||
| Accession | Primary (citable) accession number: O08715 Secondary accession number(s): B1AR25, O08714, P97488 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
