Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

A-kinase anchor protein 1, mitochondrial

Gene

Akap1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Differentially targeted protein that binds to type I and II regulatory subunits of protein kinase A. Anchors them to the cytoplasmic face of the mitochondrial outer membrane or allows them to reside in the endoplasmic reticulum. Does not contain the classic KDEL endoplasmic reticulum-targeting sequence. This explains how it is able to switch its localization, either being in the endoplasmic reticulum or in the mitochondria depending on which N-terminal part begins the isoform. The longest N-terminal part only present in isoform 2 and isoform 4 acts as a suppressor of mitochondrial targeting and as an activator of recessive endoplasmic reticulum targeting motif.

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Ligandi

RNA-binding

Enzyme and pathway databases

ReactomeiR-MMU-983231. Factors involved in megakaryocyte development and platelet production.

Names & Taxonomyi

Protein namesi
Recommended name:
A-kinase anchor protein 1, mitochondrial
Alternative name(s):
Dual specificity A-kinase-anchoring protein 1
Short name:
D-AKAP-1
Protein kinase A-anchoring protein 1
Short name:
PRKA1
Spermatid A-kinase anchor protein
Short name:
S-AKAP
Gene namesi
Name:Akap1
Synonyms:Akap
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 11

Organism-specific databases

MGIiMGI:104729. Akap1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane, Mitochondrion, Mitochondrion outer membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transit peptidei1 – 29MitochondrionBy similarityAdd BLAST29
ChainiPRO_000001666030 – 857A-kinase anchor protein 1, mitochondrialAdd BLAST828

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei55PhosphoserineCombined sources1
Modified residuei101PhosphoserineCombined sources1
Modified residuei103PhosphoserineCombined sources1
Modified residuei164PhosphoserineBy similarity1
Modified residuei401PhosphothreonineBy similarity1
Modified residuei487PhosphothreonineBy similarity1
Modified residuei527PhosphoserineBy similarity1
Modified residuei546PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiO08715.
MaxQBiO08715.
PaxDbiO08715.
PeptideAtlasiO08715.
PRIDEiO08715.

PTM databases

iPTMnetiO08715.
PhosphoSitePlusiO08715.
SwissPalmiO08715.

Expressioni

Tissue specificityi

Highest expression in testis, heart, liver, skeletal muscle, intestine and kidney, followed by brain and lung. No expression in spleen. Isoform 1/D-AKAP1A is expressed predominantly in testis whereas isoform 4/D-AKAP1D is expressed primarily in liver.1 Publication

Gene expression databases

BgeeiENSMUSG00000018428.
CleanExiMM_AKAP1.
ExpressionAtlasiO08715. baseline and differential.
GenevisibleiO08715. MM.

Interactioni

Subunit structurei

Interacts with SLC8A3.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
PTPN21Q168252EBI-9117988,EBI-2860264From a different organism.
Siah2Q069866EBI-7838029,EBI-957413

GO - Molecular functioni

Protein-protein interaction databases

BioGridi198048. 3 interactors.
IntActiO08715. 8 interactors.
MINTiMINT-4087417.
STRINGi10090.ENSMUSP00000018572.

Structurei

3D structure databases

ProteinModelPortaliO08715.
SMRiO08715.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini561 – 625KHPROSITE-ProRule annotationAdd BLAST65
Domaini712 – 771TudorPROSITE-ProRule annotationAdd BLAST60

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni306 – 319PKA-RII subunit binding domainAdd BLAST14

Domaini

RII-alpha binding site, predicted to form an amphipathic helix, could participate in protein-protein interactions with a complementary surface on the R-subunit dimer.

Sequence similaritiesi

Contains 1 KH domain.PROSITE-ProRule annotation
Contains 1 Tudor domain.PROSITE-ProRule annotation

Keywords - Domaini

Transit peptide, Transmembrane

Phylogenomic databases

eggNOGiKOG2279. Eukaryota.
ENOG410Z0DP. LUCA.
GeneTreeiENSGT00390000001360.
HOGENOMiHOG000013170.
HOVERGENiHBG057436.
InParanoidiO08715.
KOiK16518.
OMAiLGWWWFF.
OrthoDBiEOG091G0SWL.
TreeFamiTF105401.

Family and domain databases

Gene3Di3.30.1370.10. 1 hit.
InterProiIPR033104. Akap1.
IPR004087. KH_dom.
IPR004088. KH_dom_type_1.
IPR002999. Tudor.
[Graphical view]
PANTHERiPTHR22948:SF18. PTHR22948:SF18. 1 hit.
PfamiPF00013. KH_1. 1 hit.
PF00567. TUDOR. 1 hit.
[Graphical view]
SMARTiSM00322. KH. 1 hit.
SM00333. TUDOR. 1 hit.
[Graphical view]
SUPFAMiSSF54791. SSF54791. 1 hit.
PROSITEiPS50084. KH_TYPE_1. 1 hit.
PS50304. TUDOR. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 3 (identifier: O08715-1) [UniParc]FASTAAdd to basket
Also known as: D-AKAP1C, AKAP121

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAIQLRSLFP LALPGMLALL GWWWFFSRKK DRLSSSDKQV ETLKVGPAIK
60 70 80 90 100
DRRLSEEACP GVLSVAPTVT QPPGREEQRC VDKPSTEPLA LPRTRQVRRR
110 120 130 140 150
SESSGNLPSV ADTRSQPGPC RDEIAKVELS LMGDKAKSIP LGCPLLPKDA
160 170 180 190 200
SFPYEAVERC KQESALGKTP GRGWPSPYAA SGEKARETGG TEGTGDAVLG
210 220 230 240 250
ENVSEEGLLS QECVSEVEKS EFPILAPGGG EGEEVSHGPP QVAELLKKEE
260 270 280 290 300
YIVGKLPSSF VEPVHSEPVK DEDALEPQVK GSSNTSDRDL AGELDKDETV
310 320 330 340 350
PENDQIKQAA FQLISQVILE ATEEFRATTV GKTVAQVHPT SATQPKGKEE
360 370 380 390 400
SCVPASQETS LGQDTSDPAS TRTGATASPS AEALPPKTYV SCLSSPLSGP
410 420 430 440 450
TKDQKPKNSA HHISLAPCPP PVTPQRQSLE GASNPRGDDN FVACMANNSQ
460 470 480 490 500
SVLSVSSLGQ CSDPVSTSGL EDSCTETISS SGDKAMTPPL PVSTQPFSNG
510 520 530 540 550
VLKEELSDLG TEDGWTMDTE ADHSGGSDGN SMDSVDSCCG LTKPDSPQSV
560 570 580 590 600
QAGSNPKKVD LIIWEIEVPK HLVGRLIGKQ GRYVSFLKQT SGAKIYISTL
610 620 630 640 650
PYTQNIQICH IEGSQHHVDK ALNLIGKKFK ELNLTNIYAP PLPSLALPSL
660 670 680 690 700
PMTSWLMLPD GITVEVIVVN QVNAGHLFVQ QHTHPTFHAL RSLDQQMYLC
710 720 730 740 750
YSQPGIPTLP TPVEITVICA APGADGAWWR AQVVASYEET NEVEIRYVDY
760 770 780 790 800
GGYKRVKVDV LRQIRSDFVT LPFQGAEVLL DSVVPLSDDD HFSPEADAAM
810 820 830 840 850
SEMTGNTALL AQVTSYSATG LPLIQLWSVV GDEVVLINRS LVERGLAQWV

DSYYASL
Length:857
Mass (Da):92,195
Last modified:July 27, 2011 - v4
Checksum:i455679FCF95C28E6
GO
Isoform 1 (identifier: O08715-2) [UniParc]FASTAAdd to basket
Also known as: D-AKAP1A

The sequence of this isoform differs from the canonical sequence as follows:
     527-544: SDGNSMDSVDSCCGLTKP → RKVLGCFLGESGRGPIIC
     545-857: Missing.

Show »
Length:544
Mass (Da):57,680
Checksum:i24F297D5CB332F7A
GO
Isoform 2 (identifier: O08715-3) [UniParc]FASTAAdd to basket
Also known as: D-AKAP1B

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGCKTGPKPFGGGETIRPIRIRRCSYFTSTDSKM
     527-544: SDGNSMDSVDSCCGLTKP → RKVLGCFLGESGRGPIIC
     545-857: Missing.

Show »
Length:577
Mass (Da):61,311
Checksum:iF18916F0BE7B88A2
GO
Isoform 4 (identifier: O08715-4) [UniParc]FASTAAdd to basket
Also known as: D-AKAP1D

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGCKTGPKPFGGGETIRPIRIRRCSYFTSTDSKM

Show »
Length:890
Mass (Da):95,825
Checksum:iB4F8830C72620DF1
GO
Isoform 5 (identifier: O08715-5) [UniParc]FASTAAdd to basket
Also known as: S-AKAP84

The sequence of this isoform differs from the canonical sequence as follows:
     526-547: GSDGNSMDSVDSCCGLTKPDSP → VAAPPQERGHFGNGGCTGFFEC
     548-857: Missing.

Show »
Length:547
Mass (Da):58,000
Checksum:i83069FB21BFA3628
GO
Isoform 6 (identifier: O08715-6) [UniParc]FASTAAdd to basket
Also known as: AKAP100

The sequence of this isoform differs from the canonical sequence as follows:
     614-637: SQHHVDKALNLIGKKFKELNLTNI → CVSVLTRRLSAPCRQSSELDWEEV
     638-857: Missing.

Show »
Length:637
Mass (Da):68,012
Checksum:iE40401F94CFFE7DF
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti80C → S in AAC27100 (Ref. 2) Curated1
Sequence conflicti80C → S in AAB53740 (PubMed:9182549).Curated1
Sequence conflicti80C → S in AAB53741 (PubMed:9182549).Curated1
Sequence conflicti220S → I in AAC27100 (Ref. 2) Curated1
Sequence conflicti325F → L in AAC27100 (Ref. 2) Curated1
Sequence conflicti325F → L in AAB53740 (PubMed:9182549).Curated1
Sequence conflicti325F → L in AAB53741 (PubMed:9182549).Curated1
Sequence conflicti327A → P in AAB53740 (PubMed:9182549).Curated1
Sequence conflicti327A → P in AAB53741 (PubMed:9182549).Curated1
Sequence conflicti340T → I in AAC27100 (Ref. 2) Curated1
Sequence conflicti340T → I in AAB53740 (PubMed:9182549).Curated1
Sequence conflicti340T → I in AAB53741 (PubMed:9182549).Curated1
Sequence conflicti486M → I in AAC27100 (Ref. 2) Curated1
Sequence conflicti486M → I in AAB53740 (PubMed:9182549).Curated1
Sequence conflicti486M → I in AAB53741 (PubMed:9182549).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0028471M → MGCKTGPKPFGGGETIRPIR IRRCSYFTSTDSKM in isoform 2 and isoform 4. 1 Publication1
Alternative sequenceiVSP_002850526 – 547GSDGN…KPDSP → VAAPPQERGHFGNGGCTGFF EC in isoform 5. 1 PublicationAdd BLAST22
Alternative sequenceiVSP_002848527 – 544SDGNS…GLTKP → RKVLGCFLGESGRGPIIC in isoform 1 and isoform 2. 1 PublicationAdd BLAST18
Alternative sequenceiVSP_002849545 – 857Missing in isoform 1 and isoform 2. 1 PublicationAdd BLAST313
Alternative sequenceiVSP_002851548 – 857Missing in isoform 5. 1 PublicationAdd BLAST310
Alternative sequenceiVSP_002852614 – 637SQHHV…NLTNI → CVSVLTRRLSAPCRQSSELD WEEV in isoform 6. 1 PublicationAdd BLAST24
Alternative sequenceiVSP_002853638 – 857Missing in isoform 6. 1 PublicationAdd BLAST220

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U84389 mRNA. Translation: AAC27100.1.
U95145 mRNA. Translation: AAB53740.1.
U95146 mRNA. Translation: AAB53741.1.
AL596180 Genomic DNA. Translation: CAI24699.1.
CCDSiCCDS25229.1. [O08715-1]
RefSeqiNP_001036006.1. NM_001042541.1. [O08715-1]
NP_033778.2. NM_009648.2. [O08715-1]
UniGeneiMm.2969.

Genome annotation databases

EnsembliENSMUST00000018572; ENSMUSP00000018572; ENSMUSG00000018428. [O08715-1]
ENSMUST00000107903; ENSMUSP00000103536; ENSMUSG00000018428. [O08715-1]
ENSMUST00000107904; ENSMUSP00000103537; ENSMUSG00000018428. [O08715-4]
ENSMUST00000143720; ENSMUSP00000122295; ENSMUSG00000018428. [O08715-5]
GeneIDi11640.
KEGGimmu:11640.
UCSCiuc007kvu.2. mouse. [O08715-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U84389 mRNA. Translation: AAC27100.1.
U95145 mRNA. Translation: AAB53740.1.
U95146 mRNA. Translation: AAB53741.1.
AL596180 Genomic DNA. Translation: CAI24699.1.
CCDSiCCDS25229.1. [O08715-1]
RefSeqiNP_001036006.1. NM_001042541.1. [O08715-1]
NP_033778.2. NM_009648.2. [O08715-1]
UniGeneiMm.2969.

3D structure databases

ProteinModelPortaliO08715.
SMRiO08715.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi198048. 3 interactors.
IntActiO08715. 8 interactors.
MINTiMINT-4087417.
STRINGi10090.ENSMUSP00000018572.

PTM databases

iPTMnetiO08715.
PhosphoSitePlusiO08715.
SwissPalmiO08715.

Proteomic databases

EPDiO08715.
MaxQBiO08715.
PaxDbiO08715.
PeptideAtlasiO08715.
PRIDEiO08715.

Protocols and materials databases

DNASUi11640.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000018572; ENSMUSP00000018572; ENSMUSG00000018428. [O08715-1]
ENSMUST00000107903; ENSMUSP00000103536; ENSMUSG00000018428. [O08715-1]
ENSMUST00000107904; ENSMUSP00000103537; ENSMUSG00000018428. [O08715-4]
ENSMUST00000143720; ENSMUSP00000122295; ENSMUSG00000018428. [O08715-5]
GeneIDi11640.
KEGGimmu:11640.
UCSCiuc007kvu.2. mouse. [O08715-1]

Organism-specific databases

CTDi8165.
MGIiMGI:104729. Akap1.

Phylogenomic databases

eggNOGiKOG2279. Eukaryota.
ENOG410Z0DP. LUCA.
GeneTreeiENSGT00390000001360.
HOGENOMiHOG000013170.
HOVERGENiHBG057436.
InParanoidiO08715.
KOiK16518.
OMAiLGWWWFF.
OrthoDBiEOG091G0SWL.
TreeFamiTF105401.

Enzyme and pathway databases

ReactomeiR-MMU-983231. Factors involved in megakaryocyte development and platelet production.

Miscellaneous databases

PROiO08715.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000018428.
CleanExiMM_AKAP1.
ExpressionAtlasiO08715. baseline and differential.
GenevisibleiO08715. MM.

Family and domain databases

Gene3Di3.30.1370.10. 1 hit.
InterProiIPR033104. Akap1.
IPR004087. KH_dom.
IPR004088. KH_dom_type_1.
IPR002999. Tudor.
[Graphical view]
PANTHERiPTHR22948:SF18. PTHR22948:SF18. 1 hit.
PfamiPF00013. KH_1. 1 hit.
PF00567. TUDOR. 1 hit.
[Graphical view]
SMARTiSM00322. KH. 1 hit.
SM00333. TUDOR. 1 hit.
[Graphical view]
SUPFAMiSSF54791. SSF54791. 1 hit.
PROSITEiPS50084. KH_TYPE_1. 1 hit.
PS50304. TUDOR. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiAKAP1_MOUSE
AccessioniPrimary (citable) accession number: O08715
Secondary accession number(s): B1AR25, O08714, P97488
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 1, 2001
Last sequence update: July 27, 2011
Last modified: November 2, 2016
This is version 152 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.