Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Kininogen-1

Gene

Kng1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

1 Kininogens are inhibitors of thiol proteases; (2) HMW-kininogen plays an important role in blood coagulation by helping to position optimally prekallikrein and factor XI next to factor XII; (3) HMW-kininogen inhibits the thrombin- and plasmin-induced aggregation of thrombocytes; (4) the active peptide bradykinin that is released from HMW-kininogen shows a variety of physiological effects: (4A) influence in smooth muscle contraction, (4B) induction of hypotension, (4C) natriuresis and diuresis, (4D) decrease in blood glucose level, (4E) it is a mediator of inflammation and causes (4E1) increase in vascular permeability, (4E2) stimulation of nociceptors (4E3) release of other mediators of inflammation (e.g. prostaglandins), (4F) it has a cardioprotective effect (directly via bradykinin action, indirectly via endothelium-derived relaxing factor action); (5) LMW-kininogen inhibits the aggregation of thrombocytes; (6) LMW-kininogen is in contrast to HMW-kininogen not involved in blood clotting (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Protease inhibitor, Thiol protease inhibitor, Vasoactive, Vasodilator

Keywords - Biological processi

Blood coagulation, Hemostasis, Inflammatory response

Enzyme and pathway databases

ReactomeiR-MMU-114608. Platelet degranulation.
R-MMU-140837. Intrinsic Pathway of Fibrin Clot Formation.
R-MMU-375276. Peptide ligand-binding receptors.
R-MMU-416476. G alpha (q) signalling events.
R-MMU-418594. G alpha (i) signalling events.

Protein family/group databases

MEROPSiI25.018.

Names & Taxonomyi

Protein namesi
Recommended name:
Kininogen-1
Cleaved into the following 3 chains:
Gene namesi
Name:Kng1
Synonyms:Kng
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 16

Organism-specific databases

MGIiMGI:1097705. Kng1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2020Add
BLAST
Chaini21 – 661641Kininogen-1PRO_0000006691Add
BLAST
Chaini21 – 379359Kininogen-1 heavy chainPRO_0000006692Add
BLAST
Peptidei380 – 3889BradykininPRO_0000006693
Chaini389 – 661273Kininogen-1 light chainPRO_0000006694Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi28 ↔ 631Interchain (between heavy and light chains)PROSITE-ProRule annotation
Glycosylationi82 – 821N-linked (GlcNAc...)1 Publication
Disulfide bondi83 ↔ 94PROSITE-ProRule annotation
Disulfide bondi107 ↔ 125PROSITE-ProRule annotation
Disulfide bondi141 ↔ 144PROSITE-ProRule annotation
Glycosylationi168 – 1681N-linked (GlcNAc...)2 Publications
Glycosylationi204 – 2041N-linked (GlcNAc...)1 Publication
Disulfide bondi205 ↔ 217PROSITE-ProRule annotation
Disulfide bondi228 ↔ 247PROSITE-ProRule annotation
Glycosylationi242 – 2421N-linked (GlcNAc...)1 Publication
Disulfide bondi263 ↔ 266PROSITE-ProRule annotation
Disulfide bondi327 ↔ 339PROSITE-ProRule annotation
Modified residuei331 – 3311PhosphoserineBy similarity
Disulfide bondi350 ↔ 369PROSITE-ProRule annotation

Post-translational modificationi

Bradykinin is released from kininogen by plasma kallikrein.
Phosphorylated by FAM20C in the extracellular medium.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiO08677.
PaxDbiO08677.
PeptideAtlasiO08677.
PRIDEiO08677.

2D gel databases

REPRODUCTION-2DPAGEIPI00129225.

PTM databases

iPTMnetiO08677.
PhosphoSiteiO08677.
SwissPalmiO08677.

Miscellaneous databases

PMAP-CutDBO08677.

Expressioni

Tissue specificityi

Plasma.

Gene expression databases

BgeeiENSMUSG00000022875.
CleanExiMM_KNG1.
ExpressionAtlasiO08677. baseline and differential.
GenevisibleiO08677. MM.

Interactioni

Subunit structurei

Isoform LMW interacts with CRISP3.1 Publication

GO - Molecular functioni

Protein-protein interaction databases

BioGridi201005. 1 interaction.
IntActiO08677. 5 interactions.
MINTiMINT-1865734.
STRINGi10090.ENSMUSP00000023589.

Structurei

3D structure databases

ProteinModelPortaliO08677.
SMRiO08677. Positions 264-369.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini28 – 131104Cystatin kininogen-type 1PROSITE-ProRule annotationAdd
BLAST
Domaini150 – 253104Cystatin kininogen-type 2PROSITE-ProRule annotationAdd
BLAST
Domaini272 – 375104Cystatin kininogen-type 3PROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi439 – 52486His-richAdd
BLAST

Sequence similaritiesi

Contains 3 cystatin kininogen-type domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal

Phylogenomic databases

eggNOGiENOG410IKIQ. Eukaryota.
ENOG4111ZQ8. LUCA.
GeneTreeiENSGT00440000039713.
HOGENOMiHOG000113239.
HOVERGENiHBG006224.
InParanoidiO08677.
KOiK03898.
PhylomeDBiO08677.
TreeFamiTF351852.

Family and domain databases

InterProiIPR000010. Cystatin_dom.
IPR002395. Kininogen.
IPR027358. Kininogen-type_cystatin_dom.
IPR018073. Prot_inh_cystat_CS.
[Graphical view]
PfamiPF00031. Cystatin. 3 hits.
[Graphical view]
PRINTSiPR00334. KININOGEN.
SMARTiSM00043. CY. 3 hits.
[Graphical view]
PROSITEiPS00287. CYSTATIN. 1 hit.
PS51647. CYSTATIN_KININOGEN. 3 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform HMW (identifier: O08677-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKLITTLLLC SGLLLTLTQG EEAQEIDCND EAVFQAVDFS LKQFNPGVKS
60 70 80 90 100
GNQYMLHRVI EGTKTDGSPT FYSFKYLIKE GNCSAQSGLA WQDCDFKDAE
110 120 130 140 150
EAATGECTAT VGKRENEFFI VTQTCKIAPS KAPILKAYFP CIGCVHAIST
160 170 180 190 200
DSPDLEPVLK HSIEHFNNNT DHSHLFTLRK VKSAHRQVVA GLNFDITYTI
210 220 230 240 250
VQTNCSKERF PSLHGDCVAL PNGDDGECRG NLFMDINNKI ANFSQSCTLY
260 270 280 290 300
SGDDLVEALP KPCPGCPRDI PVDSPELKEV LGHSIAQLNA ENDHPFYYKI
310 320 330 340 350
DTVKKATSQV VAGTKYVIEF IARETKCSKE SNTELAEDCE IKHLGQSLDC
360 370 380 390 400
NANVYMRPWE NKVVPTVKCQ ALDMTEMARR PPGFSPFRSV TVQETKEGRT
410 420 430 440 450
VSPPYIAREQ EERDAETEQG PTHGHGWLHE KQIKANKNHR GHKHGHDHGH
460 470 480 490 500
WSPRRHGLGH GHQKPHGLGH GHQLKLDYLR HQREDGDDHT HTVGHGHGHG
510 520 530 540 550
HGHGHGHGHG HGHGHGHGHG HGHGKHTNKD KNSVKQTTQR TESLASSSEY
560 570 580 590 600
STTSTQMQGR TEGPTLTPPR AQPTVTSSGF QDSDFIEDVV ATTPPYDTGA
610 620 630 640 650
HDDLIPDIHV QPDSLSFKLI SDFPEATSPK CPGRPWKPAS WEDPNTETTE
660
FSDFDLLDAL S
Length:661
Mass (Da):73,102
Last modified:July 1, 1997 - v1
Checksum:i774460258D58796E
GO
Isoform LMW (identifier: O08677-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     401-432: VSPPYIAREQEERDAETEQGPTHGHGWLHEKQ → RLLRACEYKGRLSKAGAEPAPERQAESSQVKQ
     433-661: Missing.

Show »
Length:432
Mass (Da):47,898
Checksum:i91854EDA5284A16B
GO
Isoform 3 (identifier: O08677-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     401-581: Missing.

Show »
Length:480
Mass (Da):53,206
Checksum:i7D0AE95FC5AA98DE
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti642 – 6421E → K in AAI08937 (PubMed:15489334).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei401 – 581181Missing in isoform 3. 2 PublicationsVSP_037159Add
BLAST
Alternative sequencei401 – 43232VSPPY…LHEKQ → RLLRACEYKGRLSKAGAEPA PERQAESSQVKQ in isoform LMW. 3 PublicationsVSP_001263Add
BLAST
Alternative sequencei433 – 661229Missing in isoform LMW. 3 PublicationsVSP_001264Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D84415 mRNA. Translation: BAA19742.1.
D84435 mRNA. Translation: BAA19743.1.
AY462058 mRNA. Translation: AAR88632.1.
AY660571 mRNA. Translation: AAT70087.1.
AK005547 mRNA. No translation available.
BC018158 mRNA. Translation: AAH18158.1.
BC108936 mRNA. Translation: AAI08937.1.
CCDSiCCDS28073.1. [O08677-2]
CCDS49803.1. [O08677-3]
CCDS49804.1. [O08677-1]
RefSeqiNP_001095881.1. NM_001102411.1.
NP_075614.1. NM_023125.3. [O08677-2]
UniGeneiMm.2160.

Genome annotation databases

EnsembliENSMUST00000039492; ENSMUSP00000040485; ENSMUSG00000022875. [O08677-2]
GeneIDi16644.
KEGGimmu:16644.
UCSCiuc007ytb.1. mouse. [O08677-1]
uc007ytc.1. mouse. [O08677-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D84415 mRNA. Translation: BAA19742.1.
D84435 mRNA. Translation: BAA19743.1.
AY462058 mRNA. Translation: AAR88632.1.
AY660571 mRNA. Translation: AAT70087.1.
AK005547 mRNA. No translation available.
BC018158 mRNA. Translation: AAH18158.1.
BC108936 mRNA. Translation: AAI08937.1.
CCDSiCCDS28073.1. [O08677-2]
CCDS49803.1. [O08677-3]
CCDS49804.1. [O08677-1]
RefSeqiNP_001095881.1. NM_001102411.1.
NP_075614.1. NM_023125.3. [O08677-2]
UniGeneiMm.2160.

3D structure databases

ProteinModelPortaliO08677.
SMRiO08677. Positions 264-369.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi201005. 1 interaction.
IntActiO08677. 5 interactions.
MINTiMINT-1865734.
STRINGi10090.ENSMUSP00000023589.

Protein family/group databases

MEROPSiI25.018.

PTM databases

iPTMnetiO08677.
PhosphoSiteiO08677.
SwissPalmiO08677.

2D gel databases

REPRODUCTION-2DPAGEIPI00129225.

Proteomic databases

MaxQBiO08677.
PaxDbiO08677.
PeptideAtlasiO08677.
PRIDEiO08677.

Protocols and materials databases

DNASUi16644.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000039492; ENSMUSP00000040485; ENSMUSG00000022875. [O08677-2]
GeneIDi16644.
KEGGimmu:16644.
UCSCiuc007ytb.1. mouse. [O08677-1]
uc007ytc.1. mouse. [O08677-2]

Organism-specific databases

CTDi3827.
MGIiMGI:1097705. Kng1.

Phylogenomic databases

eggNOGiENOG410IKIQ. Eukaryota.
ENOG4111ZQ8. LUCA.
GeneTreeiENSGT00440000039713.
HOGENOMiHOG000113239.
HOVERGENiHBG006224.
InParanoidiO08677.
KOiK03898.
PhylomeDBiO08677.
TreeFamiTF351852.

Enzyme and pathway databases

ReactomeiR-MMU-114608. Platelet degranulation.
R-MMU-140837. Intrinsic Pathway of Fibrin Clot Formation.
R-MMU-375276. Peptide ligand-binding receptors.
R-MMU-416476. G alpha (q) signalling events.
R-MMU-418594. G alpha (i) signalling events.

Miscellaneous databases

PMAP-CutDBO08677.
PROiO08677.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000022875.
CleanExiMM_KNG1.
ExpressionAtlasiO08677. baseline and differential.
GenevisibleiO08677. MM.

Family and domain databases

InterProiIPR000010. Cystatin_dom.
IPR002395. Kininogen.
IPR027358. Kininogen-type_cystatin_dom.
IPR018073. Prot_inh_cystat_CS.
[Graphical view]
PfamiPF00031. Cystatin. 3 hits.
[Graphical view]
PRINTSiPR00334. KININOGEN.
SMARTiSM00043. CY. 3 hits.
[Graphical view]
PROSITEiPS00287. CYSTATIN. 1 hit.
PS51647. CYSTATIN_KININOGEN. 3 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiKNG1_MOUSE
AccessioniPrimary (citable) accession number: O08677
Secondary accession number(s): O08676
, Q32MX7, Q6S9I1, Q91XK5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: July 1, 1997
Last modified: September 7, 2016
This is version 155 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.