O08638 (MYH11_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 115.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Myosin-11 Alternative name(s): Myosin heavy chain 11 Myosin heavy chain, smooth muscle isoform SMMHC | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 1972 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Muscle contraction. |
| Subunit structure | Muscle myosin is a hexameric protein that consists of 2 heavy chain subunits (MHC), 2 alkali light chain subunits (MLC) and 2 regulatory light chain subunits (MLC-2). |
| Subcellular location | Melanosome By similarity. Cytoplasm › myofibril. Note: Thick filaments of the myofibrils. |
| Domain | The rodlike tail sequence is highly repetitive, showing cycles of a 28-residue repeat pattern composed of 4 heptapeptides, characteristic for alpha-helical coiled coils. Each myosin heavy chain can be split into 1 light meromyosin (LMM) and 1 heavy meromyosin (HMM). It can later be split further into 2 globular subfragments (S1) and 1 rod-shaped subfragment (S2). |
| Sequence similarities | Contains 1 IQ domain. Contains 1 myosin head-like domain. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O08638-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O08638-2) The sequence of this isoform differs from the canonical sequence as follows: 1930-1972: RGNEASFVPSRRAGGRRVIENTDGSEEEMDARDSDFNGTKASE → GPPPQETSQ |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1972 | 1972 | Myosin-11 | PRO_0000123425 | |||||
Regions | |||||||||
| Domain | 1 – 785 | 785 | Myosin head-like | ||||||
| Domain | 786 – 815 | 30 | IQ | ||||||
| Nucleotide binding | 178 – 185 | 8 | ATP Potential | ||||||
| Region | 661 – 683 | 23 | Actin-binding By similarity | ||||||
| Region | 762 – 776 | 15 | Actin-binding By similarity | ||||||
| Region | 1935 – 1972 | 38 | C-terminal | ||||||
| Coiled coil | 844 – 1934 | 1091 | Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 129 | 1 | N6,N6,N6-trimethyllysine Potential | ||||||
| Modified residue | 1954 | 1 | Phosphoserine Ref.5 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1930 – 1972 | 43 | RGNEA…TKASE → GPPPQETSQ in isoform 2. | VSP_003346 | |||||
Experimental info | |||||||||
| Sequence conflict | 126 | 1 | N → D in AAB36168. Ref.3 | ||||||
| Sequence conflict | 161 | 1 | A → V in AAA67552. Ref.2 | ||||||
| Sequence conflict | 189 | 1 | Q → K in AAA67552. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning and expression of murine smooth muscle myosin heavy chains." Hasegawa K., Arakawa E., Oda S., Matsuda Y. Biochem. Biophys. Res. Commun. 232:313-316(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. Strain: BALB/c. Tissue: Uterus. |
| [2] | "Smooth muscle myosin heavy chain exclusively marks the smooth muscle lineage during mouse embryogenesis." Miano J.M., Cserjesi P., Ligon K.L., Periasamy M., Olson E.N. Circ. Res. 75:803-812(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-368. Tissue: Uterus. |
| [3] | "Preferential differentiation of P19 mouse embryonal carcinoma cells into smooth muscle cells. Use of retinoic acid and antisense against the central nervous system-specific POU transcription factor Brn-2." Suzuki T., Kim H.S., Kurabayashi M., Hamada H., Fujii H., Aikawa M., Watanabe M., Watanabe N., Sakomura Y., Yazaki Y., Nagai R. Circ. Res. 78:395-404(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-126. Tissue: Uterus. |
| [4] | Lubec G., Sunyer B., Chen W.-Q. Submitted (JAN-2009) to UniProtKB Cited for: PROTEIN SEQUENCE OF 1218-1224, MASS SPECTROMETRY. Strain: OF1. Tissue: Hippocampus. |
| [5] | "Protein phosphorylation and expression profiling by Yin-yang multidimensional liquid chromatography (Yin-yang MDLC) mass spectrometry." Dai J., Jin W.-H., Sheng Q.-H., Shieh C.-H., Wu J.-R., Zeng R. J. Proteome Res. 6:250-262(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1954, MASS SPECTROMETRY. Tissue: Liver. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | D85923 mRNA. Translation: BAA19690.1. D85924 mRNA. Translation: BAA19691.1. L25860 mRNA. Translation: AAA67552.1. S81516 mRNA. Translation: AAB36168.1. |
| IPI | IPI00114894. IPI00227865. |
| PIR | I52863. JC5420. JC5421. |
| UniGene | Mm.250705. |
3D structure databases | |
| ProteinModelPortal | O08638. |
| SMR | O08638. Positions 7-963. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | O08638. 3 interactions. |
PTM databases | |
| PhosphoSite | O08638. |
Proteomic databases | |
| PaxDb | O08638. |
| PRIDE | O08638. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Organism-specific databases | |
| MGI | MGI:102643. Myh11. |
Phylogenomic databases | |
| eggNOG | COG5022. |
| HOGENOM | HOG000173958. |
| HOVERGEN | HBG004704. |
| InParanoid | O08638. |
| OrthoDB | EOG4TXBR1. |
Gene expression databases | |
| CleanEx | MM_MYH11. |
| Genevestigator | O08638. |
| GermOnline | ENSMUSG00000018830. Mus musculus. |
Family and domain databases | |
| InterPro | IPR000048. IQ_motif_EF-hand-BS. IPR001609. Myosin_head_motor_dom. IPR004009. Myosin_N. IPR002928. Myosin_tail. [Graphical view] |
| Pfam | PF00063. Myosin_head. 1 hit. PF02736. Myosin_N. 1 hit. PF01576. Myosin_tail_1. 1 hit. [Graphical view] |
| PRINTS | PR00193. MYOSINHEAVY. |
| SMART | SM00015. IQ. 1 hit. SM00242. MYSc. 1 hit. [Graphical view] |
| PROSITE | PS50096. IQ. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | MYH11. mouse. |
| SOURCE | Search... |
Entry information
| Entry name | MYH11_MOUSE | ||||||||
| Accession | Primary (citable) accession number: O08638 Secondary accession number(s): O08639, Q62462, Q64195 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
