Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Myosin-11

Gene

Myh11

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Muscle contraction.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi178 – 1858ATPSequence analysis

GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • motor activity Source: MGI
  • structural constituent of muscle Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Motor protein, Muscle protein, Myosin

Keywords - Ligandi

Actin-binding, ATP-binding, Calmodulin-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Myosin-11
Alternative name(s):
Myosin heavy chain 11
Myosin heavy chain, smooth muscle isoform
SMMHC
Gene namesi
Name:Myh11
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Unplaced

Organism-specific databases

MGIiMGI:102643. Myh11.

Subcellular locationi

GO - Cellular componenti

  • brush border Source: UniProtKB
  • extracellular exosome Source: MGI
  • melanosome Source: UniProtKB-SubCell
  • muscle myosin complex Source: MGI
  • myofibril Source: UniProtKB-SubCell
  • myosin complex Source: MGI
  • myosin filament Source: UniProtKB-KW
  • smooth muscle contractile fiber Source: MGI
  • stress fiber Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Thick filament

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 19721972Myosin-11PRO_0000123425Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei8 – 81PhosphoserineCombined sources
Modified residuei23 – 231PhosphoserineBy similarity
Modified residuei129 – 1291N6,N6,N6-trimethyllysineSequence analysis
Modified residuei1684 – 16841PhosphoserineBy similarity
Modified residuei1722 – 17221PhosphoserineBy similarity
Modified residuei1951 – 19511PhosphothreonineCombined sources
Modified residuei1954 – 19541PhosphoserineCombined sources
Modified residuei1971 – 19711PhosphoserineCombined sources

Keywords - PTMi

Methylation, Phosphoprotein

Proteomic databases

EPDiO08638.
MaxQBiO08638.
PaxDbiO08638.
PRIDEiO08638.

PTM databases

iPTMnetiO08638.
PhosphoSiteiO08638.
SwissPalmiO08638.

Expressioni

Gene expression databases

CleanExiMM_MYH11.

Interactioni

Subunit structurei

Muscle myosin is a hexameric protein that consists of 2 heavy chain subunits (MHC), 2 alkali light chain subunits (MLC) and 2 regulatory light chain subunits (MLC-2).

Protein-protein interaction databases

IntActiO08638. 6 interactions.
MINTiMINT-4102706.
STRINGi10090.ENSMUSP00000087756.

Structurei

3D structure databases

ProteinModelPortaliO08638.
SMRiO08638. Positions 7-1075.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini85 – 783699Myosin motorAdd
BLAST
Domaini786 – 81530IQPROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni661 – 68323Actin-bindingBy similarityAdd
BLAST
Regioni762 – 77615Actin-bindingBy similarityAdd
BLAST
Regioni1935 – 197238C-terminalAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili844 – 19341091Sequence analysisAdd
BLAST

Domaini

The rodlike tail sequence is highly repetitive, showing cycles of a 28-residue repeat pattern composed of 4 heptapeptides, characteristic for alpha-helical coiled coils.
Limited proteolysis of myosin heavy chain produces 1 light meromyosin (LMM) and 1 heavy meromyosin (HMM). HMM can be further cleaved into 2 globular subfragments (S1) and 1 rod-shaped subfragment (S2).Curated

Sequence similaritiesi

Contains 1 IQ domain.PROSITE-ProRule annotation
Contains 1 myosin motor domain.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG0161. Eukaryota.
COG5022. LUCA.
HOGENOMiHOG000173958.
HOVERGENiHBG004704.
InParanoidiO08638.
PhylomeDBiO08638.

Family and domain databases

Gene3Di4.10.270.10. 1 hit.
InterProiIPR000048. IQ_motif_EF-hand-BS.
IPR027401. Myosin-like_IQ_dom.
IPR001609. Myosin_head_motor_dom.
IPR004009. Myosin_N.
IPR002928. Myosin_tail.
IPR027417. P-loop_NTPase.
[Graphical view]
PfamiPF00063. Myosin_head. 1 hit.
PF02736. Myosin_N. 1 hit.
PF01576. Myosin_tail_1. 1 hit.
[Graphical view]
PRINTSiPR00193. MYOSINHEAVY.
SMARTiSM00242. MYSc. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
PROSITEiPS50096. IQ. 1 hit.
PS51456. MYOSIN_MOTOR. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O08638-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAQKGQLSDD EKFLFVDKNF MNSPMAQADW VAKKLVWVPS EKQGFEAASI
60 70 80 90 100
KEEKGDEVVV ELVENGKKVT VGKDDIQKMN PPKFSKVEDM AELTCLNEAS
110 120 130 140 150
VLHNLRERYF SGLIYTYSGL FCVVVNPYKY LPIYSEKIVD MYKGKKRHEM
160 170 180 190 200
PPHIYAIADT AYRSMLQDRE DQSILCTGES GAGKTENTQK VIQYLAVVAS
210 220 230 240 250
SHKGKKDSSI TGELEKQLLQ ANPILEAFGN AKTVKNDNSS RFGKFIRINF
260 270 280 290 300
DVTGYIVGAN IETYLLEKSR AIRQARDERT FHIFYYLLAG AKEKMKSDLL
310 320 330 340 350
LESFNSYTFL SNGFVPIPAA QDDEMFQETL EAMSIMGFNE EEQLAILKVV
360 370 380 390 400
SSVLQLGNIV FKKERNTDQA SMPDNTAAQK VCHLVGINVT DFTRAILTPR
410 420 430 440 450
IKVGRDVVQK AQTKEQADFA IEALAKATYE RLFRWILSRV NKALDKTHRQ
460 470 480 490 500
GASFLGILDI AGFEIFEVNS FEQLCINYTN EKLQQLFNHT MFILEQEEYQ
510 520 530 540 550
REGIEWNFID FGLDLQPSIE LIERPNNPPG VLALLDEECW FPKATDKSFV
560 570 580 590 600
EKLCSEQGNH PKFQKPKQLK DKTEFSIIHY AGKVDYNASA WLTKNMDPLN
610 620 630 640 650
DNVTSLLNAS SDKFVADLWK DVDRIVGLDQ MAKMTESSLP SASKTKKGMF
660 670 680 690 700
RTVGQLYKEQ LGKLMATLRN TTANFVRCII PNHEKRSGKL DAFLVLEQLR
710 720 730 740 750
CNGVLEGIRI CRQGFPNRIV FQEFRQRYEI LAANAIPKGF MDGKQACILM
760 770 780 790 800
IKALELDPNL YRIGQSKIFF RTGVLAHLEE ERDLKITDVI MAFQAMCRGY
810 820 830 840 850
LARKAFTKRQ QQLTAMKVIQ RNCAAYLKLR NWQWWRLFTK VKPLLQVTRQ
860 870 880 890 900
EEEMQAKEEE MQKITERQQK AETELKELEQ KHTQLAEEKT LLQEQLQAET
910 920 930 940 950
ELYAESEEMR VRLAAKKQEL EEILHEMEAR LEEEEDRRQQ LQAERKKMAQ
960 970 980 990 1000
QMLDLEEQLE EEEAARQKLQ LEKVTAEAKI KKLEDDILVM DDQNSKLSKE
1010 1020 1030 1040 1050
RKLLEERVSD LTTNLAEEEE KAKNLTKLKS KHESMISELE VRLKKEEKSR
1060 1070 1080 1090 1100
QELEKLKRKL EGDASDFHEQ IADLQAQIAE LKMQLAKKEE ELQAALARLD
1110 1120 1130 1140 1150
EEIAQKNNAL KKIRELEGHI SDLQEDLDSE RAARNKAEKQ KRDLGEELEA
1160 1170 1180 1190 1200
LKTELEDTLD STATQQELRA KREQEVTVLK KALDEETRSH EAQVQEMRQK
1210 1220 1230 1240 1250
HTQAVEELTE QLEQFKRAKA NLDKSKQTLE KENADLAGEL RVLGQAKQEV
1260 1270 1280 1290 1300
EHKKKKLEVQ LQDLQSKCSD GERARAELSD KVHKLQNEVE SVTGMLNEAE
1310 1320 1330 1340 1350
GKAIKLAKDV ASLGSQLQDT QELLQEETRQ KLNVSTKLRQ LEDERNSLQD
1360 1370 1380 1390 1400
QLDEEMEAKQ NLERHVSTLN IQLSDSKKKL QDFASTIEVM EEGKKRLQKE
1410 1420 1430 1440 1450
MEGLSQQYEE KAAAYDKLEK TKNRLQQELD DLVVDLDNQR QLVSNLEKKQ
1460 1470 1480 1490 1500
KKFDQLLAEE KNISSKYADE RDRAEAEARE KETKALSLAR ALEEALEAKE
1510 1520 1530 1540 1550
ELERTNKMLK AEMEDLVSSK DDVGKNVHEL EKSKRALETQ MEEMKTQLEE
1560 1570 1580 1590 1600
SEDDVQATED AKLRLEVNMQ ALKGQFERDL QARDEQNEEK RRQLQRQLHE
1610 1620 1630 1640 1650
YETELEDERK QRALAAAAKK KLEGDLKDLE LQADSAIKGR EEAIKQLRKL
1660 1670 1680 1690 1700
QAQMKDFQRE LDDARASRDE IFATSKENEK KAKSLEADLM QLQEDLAAAE
1710 1720 1730 1740 1750
RARKQADLEK EELAEELASS LSGRNTLQDE KRRLEARIAQ LEEELEEEQG
1760 1770 1780 1790 1800
NMEAMSDRVR KATLQAEQLS NELATERSTA QKNESARQQL ERQNKELRSK
1810 1820 1830 1840 1850
LQEVEGAVKA KLKSTVAALE AKIAQLEEQV EQEAREKQAA TKSLKQKDKK
1860 1870 1880 1890 1900
LKEVLLQVED ERKMAEQYKE QAEKGNTKVK QLKRQLEEAE EESQCINANR
1910 1920 1930 1940 1950
RKLQRELDEA TESNEAMGRE VNALKSKLRR GNEASFVPSR RAGGRRVIEN
1960 1970
TDGSEEEMDA RDSDFNGTKA SE
Length:1,972
Mass (Da):227,028
Last modified:July 1, 1997 - v1
Checksum:iA1398E3F5B11F15A
GO
Isoform 2 (identifier: O08638-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1930-1972: RGNEASFVPSRRAGGRRVIENTDGSEEEMDARDSDFNGTKASE → GPPPQETSQ

Show »
Length:1,938
Mass (Da):223,266
Checksum:i46A0B1B9BCB63A8A
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti126 – 1261N → D in AAB36168 (PubMed:8593698).Curated
Sequence conflicti161 – 1611A → V in AAA67552 (PubMed:7923625).Curated
Sequence conflicti189 – 1891Q → K in AAA67552 (PubMed:7923625).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1930 – 197243RGNEA…TKASE → GPPPQETSQ in isoform 2. CuratedVSP_003346Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D85923 mRNA. Translation: BAA19690.1.
D85924 mRNA. Translation: BAA19691.1.
L25860 mRNA. Translation: AAA67552.1.
S81516 mRNA. Translation: AAB36168.1.
CCDSiCCDS27972.1. [O08638-2]
PIRiI52863.
JC5420.
JC5421.
UniGeneiMm.250705.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D85923 mRNA. Translation: BAA19690.1.
D85924 mRNA. Translation: BAA19691.1.
L25860 mRNA. Translation: AAA67552.1.
S81516 mRNA. Translation: AAB36168.1.
CCDSiCCDS27972.1. [O08638-2]
PIRiI52863.
JC5420.
JC5421.
UniGeneiMm.250705.

3D structure databases

ProteinModelPortaliO08638.
SMRiO08638. Positions 7-1075.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiO08638. 6 interactions.
MINTiMINT-4102706.
STRINGi10090.ENSMUSP00000087756.

PTM databases

iPTMnetiO08638.
PhosphoSiteiO08638.
SwissPalmiO08638.

Proteomic databases

EPDiO08638.
MaxQBiO08638.
PaxDbiO08638.
PRIDEiO08638.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Organism-specific databases

MGIiMGI:102643. Myh11.

Phylogenomic databases

eggNOGiKOG0161. Eukaryota.
COG5022. LUCA.
HOGENOMiHOG000173958.
HOVERGENiHBG004704.
InParanoidiO08638.
PhylomeDBiO08638.

Miscellaneous databases

ChiTaRSiMyh11. mouse.
PROiO08638.
SOURCEiSearch...

Gene expression databases

CleanExiMM_MYH11.

Family and domain databases

Gene3Di4.10.270.10. 1 hit.
InterProiIPR000048. IQ_motif_EF-hand-BS.
IPR027401. Myosin-like_IQ_dom.
IPR001609. Myosin_head_motor_dom.
IPR004009. Myosin_N.
IPR002928. Myosin_tail.
IPR027417. P-loop_NTPase.
[Graphical view]
PfamiPF00063. Myosin_head. 1 hit.
PF02736. Myosin_N. 1 hit.
PF01576. Myosin_tail_1. 1 hit.
[Graphical view]
PRINTSiPR00193. MYOSINHEAVY.
SMARTiSM00242. MYSc. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
PROSITEiPS50096. IQ. 1 hit.
PS51456. MYOSIN_MOTOR. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning and expression of murine smooth muscle myosin heavy chains."
    Hasegawa K., Arakawa E., Oda S., Matsuda Y.
    Biochem. Biophys. Res. Commun. 232:313-316(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA].
    Strain: BALB/cJ.
    Tissue: Uterus.
  2. "Smooth muscle myosin heavy chain exclusively marks the smooth muscle lineage during mouse embryogenesis."
    Miano J.M., Cserjesi P., Ligon K.L., Periasamy M., Olson E.N.
    Circ. Res. 75:803-812(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-368.
    Tissue: Uterus.
  3. "Preferential differentiation of P19 mouse embryonal carcinoma cells into smooth muscle cells. Use of retinoic acid and antisense against the central nervous system-specific POU transcription factor Brn-2."
    Suzuki T., Kim H.S., Kurabayashi M., Hamada H., Fujii H., Aikawa M., Watanabe M., Watanabe N., Sakomura Y., Yazaki Y., Nagai R.
    Circ. Res. 78:395-404(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-126.
    Tissue: Uterus.
  4. Lubec G., Sunyer B., Chen W.-Q.
    Submitted (JAN-2009) to UniProtKB
    Cited for: PROTEIN SEQUENCE OF 1218-1224, IDENTIFICATION BY MASS SPECTROMETRY.
    Strain: OF1.
    Tissue: Hippocampus.
  5. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-8; THR-1951 AND SER-1954, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.
  6. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-8; THR-1951; SER-1954 AND SER-1971, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain, Brown adipose tissue, Heart, Kidney, Liver, Lung, Pancreas, Spleen and Testis.

Entry informationi

Entry nameiMYH11_MOUSE
AccessioniPrimary (citable) accession number: O08638
Secondary accession number(s): O08639, Q62462, Q64195
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 27, 2001
Last sequence update: July 1, 1997
Last modified: May 11, 2016
This is version 141 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.