O08601 (MTP_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 96.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Microsomal triglyceride transfer protein large subunit | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 894 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Catalyzes the transport of triglyceride, cholesteryl ester, and phospholipid between phospholipid surfaces. Required for the secretion of plasma lipoproteins that contain apolipoprotein B. May be involved in regulating cholesteryl ester biosynthesis in cells that produce lipoproteins. Loads phospholipid into the C1D1 antigen-binding groove. Isoform 2 is critical for the development of natural killer T (NKT) cells. May have a role in the biogenesis of lipid droplets. Ref.2 Ref.9 Ref.10 |
| Subunit structure | Heterodimer composed of MTTP and of protein disulfide isomerase (P4HB/PDI). |
| Subcellular location | Isoform 1: Endoplasmic reticulum. Note: Localized to the endoplasmic reticulum according to Ref.2. Ref.2 Ref.9 Isoform 2: Endoplasmic reticulum. Golgi apparatus. Note: Localized to the endoplasmic reticulum according to Ref.2. Localized to the Golgi apparatus according to Ref.9. Ref.2 Ref.9 |
| Tissue specificity | Expressed in heart. Isoform 1 is mainly expressed in the intestine and the liver, and at lower levels in white and brown fat cells. Isoform 2 is ubiquitous, and is the major isoform in hematopoietic cells and adipocytes. Ref.2 Ref.6 Ref.9 |
| Developmental stage | Expression in the yolk sac tissues followed by expression in the primordial liver cell nests as early as day 9 post-coitum (E9.5). Intestinal expression is detected around E12.5 and attains full adult expression patterns by E14.5. Ref.8 |
| Induction | Up-regulated by FOXO1. Ref.11 |
| Disruption phenotype | Lowers plasma and tissue triglyceride levels, and increases cellular free cholesterol. Ref.7 Ref.10 |
| Sequence similarities | Contains 1 vitellogenin domain. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative promoter usage. [Align] [Select] | ||||||
| Isoform 1 (identifier: O08601-1) Also known as: MTP-A; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O08601-2) Also known as: MTPv1; MTP-B; The sequence of this isoform differs from the canonical sequence as follows: 1-20: MILLAVLFLCFFSSYSASVK → MTVVMGKCQVSDGRQLLLFYAVLLLFPTLCAMQNS | ||||||
| Note: Cleaved by signal peptidase between residues Gln-33 and Asn-34 (PubMed:17312007 and PubMed:17635917). |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 21 | 21 | |||||||
| Chain | 22 – 894 | 873 | Microsomal triglyceride transfer protein large subunit | PRO_0000041595 | |||||
Regions | |||||||||
| Domain | 28 – 658 | 631 | Vitellogenin | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 20 | 20 | MILLA…SASVK → MTVVMGKCQVSDGRQLLLFY AVLLLFPTLCAMQNS in isoform 2. | VSP_038546 | |||||
Experimental info | |||||||||
| Sequence conflict | 654 – 656 | 3 | GKA → KGT in AAB51431. Ref.1 | ||||||
| Sequence conflict | 654 – 656 | 3 | GKA → KGT in ACB41497. Ref.2 | ||||||
| Sequence conflict | 800 | 1 | V → L in AAB51431. Ref.1 | ||||||
| Sequence conflict | 800 | 1 | V → L in ACB41497. Ref.2 | ||||||
| Sequence conflict | 800 | 1 | V → L in AAH12686. Ref.4 | ||||||
| Sequence conflict | 800 | 1 | V → L in EDL12110. Ref.5 | ||||||
| Sequence conflict | 872 | 1 | E → Q in AAB51431. Ref.1 | ||||||
| Sequence conflict | 872 | 1 | E → Q in ACB41497. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Mouse microsomal triglyceride transfer protein large subunit: cDNA cloning, tissue-specific expression and chromosomal localization." Nakamuta M., Chang B.H., Hoogeveen R., Li W.H., Chan L. Genomics 33:313-316(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Liver and Small intestine. |
| [2] | "MTP regulated by an alternate promoter is essential for NKT cell development." Dougan S.K., Rava P., Hussain M.M., Blumberg R.S. J. Exp. Med. 204:533-545(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), ALTERNATIVE PROMOTER USAGE, FUNCTION, SUBCELLULAR LOCATION, PROCESSING, TISSUE SPECIFICITY. Strain: C57BL/6J. Tissue: Thymus. |
| [3] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: C57BL/6J. Tissue: Amnion. |
| [4] | Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C. Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: FVB/N. Tissue: Liver. |
| [6] | "Apo B100-containing lipoproteins are secreted by the heart." Boren J., Veniant M.M., Young S.G. J. Clin. Invest. 101:1197-1202(1998) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [7] | "A deficiency of microsomal triglyceride transfer protein reduces apolipoprotein B secretion." Leung G.K., Veniant M.M., Kim S.K., Zlot C.H., Raabe M., Bjorkegren J., Neese R.A., Hellerstein M.K., Young S.G. J. Biol. Chem. 275:7515-7520(2000) [PubMed] [Europe PMC] [Abstract] Cited for: DISRUPTION PHENOTYPE. |
| [8] | "Microsomal triglyceride transfer protein expression during mouse development." Shelton J.M., Lee M.H., Richardson J.A., Patel S.B. J. Lipid Res. 41:532-537(2000) [PubMed] [Europe PMC] [Abstract] Cited for: DEVELOPMENTAL STAGE. |
| [9] | "Identification of a novel isoform of microsomal triglyceride transfer protein." Mohler P.J., Zhu M.Y., Blade A.M., Ham A.J., Shelness G.S., Swift L.L. J. Biol. Chem. 282:26981-26988(2007) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE PROMOTER USAGE, FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [10] | "Microsomal triglyceride transfer protein enhances cellular cholesteryl esterification by relieving product inhibition." Iqbal J., Rudel L.L., Hussain M.M. J. Biol. Chem. 283:19967-19980(2008) [PubMed] [Europe PMC] [Abstract] Cited for: DISRUPTION PHENOTYPE, FUNCTION. |
| [11] | "FoxO1 mediates insulin-dependent regulation of hepatic VLDL production in mice." Kamagate A., Qu S., Perdomo G., Su D., Kim D.H., Slusher S., Meseck M., Dong H.H. J. Clin. Invest. 118:2347-2364(2008) [PubMed] [Europe PMC] [Abstract] Cited for: INDUCTION BY FOXO1. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | L47970 mRNA. Translation: AAB51431.1. EU553486 mRNA. Translation: ACB41497.1. AK146553 mRNA. Translation: BAE27255.1. CH466532 Genomic DNA. Translation: EDL12110.1. BC012686 mRNA. Translation: AAH12686.1. |
| IPI | IPI00309073. IPI00943405. |
| RefSeq | NP_001156929.1. NM_001163457.1. NP_032668.2. NM_008642.2. |
| UniGene | Mm.2941. |
3D structure databases | |
| ProteinModelPortal | O08601. |
| SMR | O08601. Positions 470-508. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | O08601. 4 interactions. |
| MINT | MINT-1864006. |
| STRING | 10090.ENSMUSP00000029805. |
PTM databases | |
| PhosphoSite | O08601. |
Proteomic databases | |
| PaxDb | O08601. |
| PRIDE | O08601. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000029805; ENSMUSP00000029805; ENSMUSG00000028158. ENSMUST00000098580; ENSMUSP00000096179; ENSMUSG00000028158. |
| GeneID | 17777. |
| KEGG | mmu:17777. |
| UCSC | uc008rmw.2. mouse. uc008rmx.2. mouse. |
Organism-specific databases | |
| CTD | 4547. |
| MGI | MGI:106926. Mttp. |
Phylogenomic databases | |
| eggNOG | NOG272516. |
| GeneTree | ENSGT00390000011412. |
| HOGENOM | HOG000113688. |
| HOVERGEN | HBG006416. |
| InParanoid | Q91X33. |
| KO | K14463. |
| OMA | RPVTFFN. |
| OrthoDB | EOG405S0C. |
Gene expression databases | |
| ArrayExpress | O08601. |
| Bgee | O08601. |
| CleanEx | MM_MTTP. |
| Genevestigator | O08601. |
| GermOnline | ENSMUSG00000028158. Mus musculus. |
Family and domain databases | |
| Gene3D | 1.25.10.20. 1 hit. 2.30.230.10. 1 hit. |
| InterPro | IPR015819. Lipid_transp_b-sht_shell. IPR001747. Lipid_transpt_N. IPR015816. Vitellinogen_b-sht_N. IPR011030. Vitellinogen_superhlx. [Graphical view] |
| Pfam | PF01347. Vitellogenin_N. 1 hit. [Graphical view] |
| SMART | SM00638. LPD_N. 1 hit. [Graphical view] |
| SUPFAM | SSF56968. Lipid_transp_b-sht_shell. 1 hit. SSF48431. LV_superhelical. 1 hit. |
| PROSITE | PS51211. VITELLOGENIN. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | MTTP. mouse. |
| NextBio | 292509. |
| SOURCE | Search... |
Entry information
| Entry name | MTP_MOUSE | ||||||||
| Accession | Primary (citable) accession number: O08601 Secondary accession number(s): B2CXA7, Q3UJA0, Q91X33 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
