UniProtKB - O01577 (O01577_CAEEL)
(max 400 entries)x
Your basket is currently empty.
Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)
- BLAST>tr|O01577|O01577_CAEEL Uncharacterized protein OS=Caenorhabditis elegans GN=unc-108 PE=1 SV=1 MSYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVTIDGKQIKLQIW DTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTSWLEDARQHSNSNMVIMLIGNK SDLEARREVKREEGEAFAREHGLVFMETSAKTAANVEEAFIDTAKEIYRKIQEGVFDINN EANGIKLGPQHSPSSPNSPGGNATGGLGGGSGCC
- Align
- Format
- Add to basketAdded to basket
- History
- Other tutorials and videos
- Help video
- Feedback
Protein
Submitted name:
Uncharacterized protein
Gene
unc-108
Organism
Caenorhabditis elegans
Status
Unreviewed-Annotation score:
Annotation score:5 out of 5
<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>Select a section on the left to see content.
<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni
- GTPase activity Source: WormBase <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- GTP binding Source: WormBase <p>Inferred by Curator</p> <p>Used for cases where an annotation is not supported by any evidence but can be reasonably inferred by a curator from other GO annotations for which evidence <br />is available.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ic">GO evidence code guide</a></p> Inferred by curatori
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi
- apoptotic cell clearance Source: WormBase <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- dense core granule maturation Source: WormBase <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- locomotion Source: WormBase <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- nematode larval development Source: WormBase <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- phagolysosome assembly Source: WormBase <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- phagolysosome assembly involved in apoptotic cell clearance Source: WormBase <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- phagosome acidification involved in apoptotic cell clearance Source: WormBase <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- regulation of locomotion involved in locomotory behavior Source: WormBase <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi
| <p>This subsection of the ‘Names and Taxonomy’ section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi | Submitted name: Uncharacterized proteinImported<p>Information which has been imported from another database using automatic procedures.</p> <p><a href="/manual/evidences#ECO:0000313">More…</a></p> Automatic assertion inferred from database entriesi |
| <p>This subsection of the ‘Names and taxonomy’ section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi | Name:unc-108Imported <p>Information which has been imported from another database using automatic procedures.</p> <p><a href="/manual/evidences#ECO:0000313">More…</a></p> Automatic assertion inferred from database entriesi ORF Names:CELE_F53F10.4Imported <p>Information which has been imported from another database using automatic procedures.</p> <p><a href="/manual/evidences#ECO:0000313">More…</a></p> Automatic assertion inferred from database entriesi , F53F10.4Imported<p>Information which has been imported from another database using automatic procedures.</p> <p><a href="/manual/evidences#ECO:0000313">More…</a></p> Automatic assertion inferred from database entriesi |
| <p>This subsection of the ‘Names and taxonomy’ section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>Organismi | Caenorhabditis elegansImported <p>Information which has been imported from another database using automatic procedures.</p> <p><a href="/manual/evidences#ECO:0000313">More…</a></p> Automatic assertion inferred from database entriesi |
| <p>This subsection of the ‘Names and taxonomy’ section shows the unique identifier assigned by the <span class="caps">NCBI</span> to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri | 6239 [NCBI] |
| <p>This subsection of the ‘Names and taxonomy’ section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineagei | cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Protostomia › Ecdysozoa › Nematoda › Chromadorea › Rhabditida › Rhabditoidea › Rhabditidae › Peloderinae › Caenorhabditis |
| <p>This subsection of the “Names and Taxonomy” section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi |
|
Organism-specific databases
WormBase More...WormBasei | F53F10.4; CE10986; WBGene00006833; unc-108. |
<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Cellular componenti
- axon Source: WormBase <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- early endosome Source: WormBase <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- endosome Source: WormBase <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- Golgi apparatus Source: WormBase <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- Golgi trans cisterna Source: WormBase <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- lysosome Source: WormBase <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- neuronal cell body Source: WormBase <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- perinuclear region of cytoplasm Source: WormBase <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- phagocytic vesicle Source: WormBase <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- trans-Golgi network Source: WormBase <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi
Proteomic databases
Encyclopedia of Proteome Dynamics More...EPDi | O01577. |
PaxDb, a database of protein abundance averages across all three domains of life More...PaxDbi | O01577. |
<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni
Gene expression databases
Bgee dataBase for Gene Expression Evolution More...Bgeei | WBGene00006833. |
ExpressionAtlas, Differential and Baseline Expression More...ExpressionAtlasi | O01577. baseline. |
<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni
Protein-protein interaction databases
Protein interaction database and analysis system More...IntActi | O01577. 1 interactor. |
STRING: functional protein association networks More...STRINGi | 6239.F53F10.4.2. |
<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei
3D structure databases
Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase More...ProteinModelPortali | O01577. |
SWISS-MODEL Repository - a database of annotated 3D protein structure models More...SMRi | O01577. |
Database of comparative protein structure models More...ModBasei | Search... |
MobiDB: a database of protein disorder and mobility annotations More...MobiDBi | Search... |
<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi
Phylogenomic databases
evolutionary genealogy of genes: Non-supervised Orthologous Groups More...eggNOGi | KOG0098. Eukaryota. COG1100. LUCA. |
Ensembl GeneTree More...GeneTreei | ENSGT00760000118841. |
The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms More...HOGENOMi | HOG000233968. |
InParanoid: Eukaryotic Ortholog Groups More...InParanoidi | O01577. |
KEGG Orthology (KO) More...KOi | K07877. |
Identification of Orthologs from Complete Genome Data More...OMAi | FKDHSQH. |
Database of Orthologous Groups More...OrthoDBi | EOG091G0QOB. |
Database for complete collections of gene phylogenies More...PhylomeDBi | O01577. |
Family and domain databases
Integrated resource of protein families, domains and functional sites More...InterProi | View protein in InterPro IPR027417. P-loop_NTPase. IPR005225. Small_GTP-bd_dom. IPR001806. Small_GTPase. |
Pfam protein domain database More...Pfami | View protein in Pfam PF00071. Ras. 1 hit. |
Superfamily database of structural and functional annotation More...SUPFAMi | SSF52540. SSF52540. 1 hit. |
TIGRFAMs; a protein family database More...TIGRFAMsi | TIGR00231. small_GTP. 1 hit. |
<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including length and molecular weight.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequencei
<p>This subsection of the ‘Sequence’ section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.
O01577-1 [UniParc]FASTAAdd to basketAdded to basketShow »
10 20 30 40 50
MSYAYLFKYI IIGDTGVGKS CLLLQFTDKR FQPVHDLTIG VEFGARMVTI
60 70 80 90 100
DGKQIKLQIW DTAGQESFRS ITRSYYRGAA GALLVYDITR RDTFNHLTSW
110 120 130 140 150
LEDARQHSNS NMVIMLIGNK SDLEARREVK REEGEAFARE HGLVFMETSA
160 170 180 190 200
KTAANVEEAF IDTAKEIYRK IQEGVFDINN EANGIKLGPQ HSPSSPNSPG
210
GNATGGLGGG SGCC
Length:214
Mass (Da):23,591
Last modified:July 1, 1997 - v1
<p>The checksum is a form of redundancy check that is calculated
from the sequence. It is useful for tracking sequence updates.</p>
<p>It should be noted that while, in theory, two different sequences could
have the same checksum value, the likelihood that this would happen
is extremely low.</p>
<p>However UniProtKB may contain entries with identical sequences in case
of multiple genes (paralogs).</p>
<p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64)
using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1.
The algorithm is described in the ISO 3309 standard.
</p>
<p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br />
<strong>Cyclic redundancy and other checksums</strong><br />
<a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p>
Checksum:i285AE75E9C559A3B
Sequence databases
| Select the link destinations: EMBL nucleotide sequence database More...EMBLiGenBank nucleotide sequence database More...GenBankiDNA Data Bank of Japan; a nucleotide sequence database More...DDBJiLinks Updated | BX284601 Genomic DNA. Translation: CCD66422.1. |
Protein sequence database of the Protein Information Resource More...PIRi | T25796. |
NCBI Reference Sequences More...RefSeqi | NP_491233.1. NM_058832.4. |
UniGene gene-oriented nucleotide sequence clusters More...UniGenei | Cel.17433. |
Genome annotation databases
Ensembl metazoan genome annotation project More...EnsemblMetazoai | F53F10.4; F53F10.4; WBGene00006833. |
Database of genes from NCBI RefSeq genomes More...GeneIDi | 171956. |
KEGG: Kyoto Encyclopedia of Genes and Genomes More...KEGGi | cel:CELE_F53F10.4. |
UCSC genome browser More...UCSCi | F53F10.4. c. elegans. |
<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi
| Entry | Cluster members | Organisms | Length | Cluster ID | Cluster name | Size | |
|---|---|---|---|---|---|---|---|
| O01577 | G0NJI8 E3MG99 I7FN62 | Caenorhabditis elegans Caenorhabditis brenneri (Nematode worm) Caenorhabditis remanei (Caenorhabditis vulgaris) | 214 | UniRef100_O01577 | Cluster: Uncharacterized protein | 4 |
<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi
Sequence databases
| Select the link destinations: EMBL nucleotide sequence database More...EMBLiGenBank nucleotide sequence database More...GenBankiDNA Data Bank of Japan; a nucleotide sequence database More...DDBJiLinks Updated | BX284601 Genomic DNA. Translation: CCD66422.1. |
Protein sequence database of the Protein Information Resource More...PIRi | T25796. |
NCBI Reference Sequences More...RefSeqi | NP_491233.1. NM_058832.4. |
UniGene gene-oriented nucleotide sequence clusters More...UniGenei | Cel.17433. |
3D structure databases
Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase More...ProteinModelPortali | O01577. |
SWISS-MODEL Repository - a database of annotated 3D protein structure models More...SMRi | O01577. |
Database of comparative protein structure models More...ModBasei | Search... |
MobiDB: a database of protein disorder and mobility annotations More...MobiDBi | Search... |
Protein-protein interaction databases
Protein interaction database and analysis system More...IntActi | O01577. 1 interactor. |
STRING: functional protein association networks More...STRINGi | 6239.F53F10.4.2. |
Proteomic databases
Encyclopedia of Proteome Dynamics More...EPDi | O01577. |
PaxDb, a database of protein abundance averages across all three domains of life More...PaxDbi | O01577. |
Protocols and materials databases
| Structural Biology Knowledgebase | Search... |
Genome annotation databases
Ensembl metazoan genome annotation project More...EnsemblMetazoai | F53F10.4; F53F10.4; WBGene00006833. |
Database of genes from NCBI RefSeq genomes More...GeneIDi | 171956. |
KEGG: Kyoto Encyclopedia of Genes and Genomes More...KEGGi | cel:CELE_F53F10.4. |
UCSC genome browser More...UCSCi | F53F10.4. c. elegans. |
Organism-specific databases
Comparative Toxicogenomics Database More...CTDi | 171956. |
WormBase More...WormBasei | F53F10.4; CE10986; WBGene00006833; unc-108. |
Phylogenomic databases
evolutionary genealogy of genes: Non-supervised Orthologous Groups More...eggNOGi | KOG0098. Eukaryota. COG1100. LUCA. |
Ensembl GeneTree More...GeneTreei | ENSGT00760000118841. |
The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms More...HOGENOMi | HOG000233968. |
InParanoid: Eukaryotic Ortholog Groups More...InParanoidi | O01577. |
KEGG Orthology (KO) More...KOi | K07877. |
Identification of Orthologs from Complete Genome Data More...OMAi | FKDHSQH. |
Database of Orthologous Groups More...OrthoDBi | EOG091G0QOB. |
Database for complete collections of gene phylogenies More...PhylomeDBi | O01577. |
Gene expression databases
Bgee dataBase for Gene Expression Evolution More...Bgeei | WBGene00006833. |
ExpressionAtlas, Differential and Baseline Expression More...ExpressionAtlasi | O01577. baseline. |
Family and domain databases
Integrated resource of protein families, domains and functional sites More...InterProi | View protein in InterPro IPR027417. P-loop_NTPase. IPR005225. Small_GTP-bd_dom. IPR001806. Small_GTPase. |
Pfam protein domain database More...Pfami | View protein in Pfam PF00071. Ras. 1 hit. |
Superfamily database of structural and functional annotation More...SUPFAMi | SSF52540. SSF52540. 1 hit. |
TIGRFAMs; a protein family database More...TIGRFAMsi | TIGR00231. small_GTP. 1 hit. |
ProtoNet; Automatic hierarchical classification of proteins More...ProtoNeti | Search... |
<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi
| <p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry namei | O01577_CAEEL | |
| <p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>Accessioni | O01577Primary (citable) accession number: O01577 | |
| <p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyi | Integrated into UniProtKB/TrEMBL: | July 1, 1997 |
| Last sequence update: | July 1, 1997 | |
| Last modified: | August 30, 2017 | |
| This is version 148 of the entry and version 1 of the sequence. See complete history. | ||
| <p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusi | Unreviewed (UniProtKB/TrEMBL) | |
<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Technical termi
Complete proteome, Proteomics identificationCombined sources<p>Information inferred from a combination of experimental and computational evidence, without manual validation.</p> <p><a href="/manual/evidences#ECO:0000213">More…</a></p> Automatic assertion inferred from combination of experimental and computational evidencei
, Reference proteomeImported<p>Information which has been imported from another database using automatic procedures.</p> <p><a href="/manual/evidences#ECO:0000313">More…</a></p> Automatic assertion inferred from database entriesi