Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nuclear factor 1 B-type

Gene

NFIB

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi1 – 195CTF/NF-IPROSITE-ProRule annotationAdd BLAST195

GO - Molecular functioni

  • DNA binding Source: UniProtKB
  • RNA polymerase II core promoter proximal region sequence-specific DNA binding Source: NTNU_SB
  • RNA polymerase II transcription corepressor activity Source: UniProtKB
  • RNA polymerase II transcription factor activity, sequence-specific DNA binding Source: UniProtKB
  • transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding Source: NTNU_SB

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Activator

Keywords - Biological processi

DNA replication, Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000147862-MONOMER.
ReactomeiR-HSA-73980. RNA Polymerase III Transcription Termination.
R-HSA-749476. RNA Polymerase III Abortive And Retractive Initiation.
SignaLinkiO00712.
SIGNORiO00712.

Names & Taxonomyi

Protein namesi
Recommended name:
Nuclear factor 1 B-type
Short name:
NF1-B
Short name:
Nuclear factor 1/B
Alternative name(s):
CCAAT-box-binding transcription factor
Short name:
CTF
Nuclear factor I/B
Short name:
NF-I/B
Short name:
NFI-B
TGGCA-binding protein
Gene namesi
Name:NFIB
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

HGNCiHGNC:7785. NFIB.

Subcellular locationi

GO - Cellular componenti

  • cerebellar mossy fiber Source: UniProtKB
  • nucleolus Source: HPA
  • nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi4781.
OpenTargetsiENSG00000147862.
PharmGKBiPA31591.

Polymorphism and mutation databases

BioMutaiNFIB.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001001951 – 420Nuclear factor 1 B-typeAdd BLAST420

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei264PhosphoserineCombined sources1
Modified residuei286PhosphothreonineBy similarity1
Modified residuei292PhosphoserineCombined sources1
Modified residuei295PhosphoserineCombined sources1
Modified residuei312PhosphoserineCombined sources1
Modified residuei328PhosphoserineCombined sources1
Modified residuei333PhosphoserineCombined sources1
Modified residuei335Asymmetric dimethylarginineBy similarity1
Modified residuei388Asymmetric dimethylarginineBy similarity1

Keywords - PTMi

Methylation, Phosphoprotein

Proteomic databases

EPDiO00712.
PaxDbiO00712.
PeptideAtlasiO00712.
PRIDEiO00712.

PTM databases

iPTMnetiO00712.
PhosphoSitePlusiO00712.

Expressioni

Gene expression databases

BgeeiENSG00000147862.
CleanExiHS_NFIB.
ExpressionAtlasiO00712. baseline and differential.
GenevisibleiO00712. HS.

Organism-specific databases

HPAiHPA003956.

Interactioni

Subunit structurei

Binds DNA as a homodimer.

Protein-protein interaction databases

BioGridi110853. 14 interactors.
DIPiDIP-61433N.
IntActiO00712. 5 interactors.
STRINGi9606.ENSP00000370340.

Structurei

3D structure databases

ProteinModelPortaliO00712.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the CTF/NF-I family.PROSITE-ProRule annotation
Contains 1 CTF/NF-I DNA-binding domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG3663. Eukaryota.
ENOG410Y16G. LUCA.
GeneTreeiENSGT00390000009905.
HOGENOMiHOG000013028.
HOVERGENiHBG006561.
InParanoidiO00712.
KOiK09169.
PhylomeDBiO00712.
TreeFamiTF313889.

Family and domain databases

InterProiIPR000647. CTF/NFI.
IPR020604. CTF/NFI_DNA-bd-dom.
IPR019739. CTF/NFI_DNA-bd_CS.
IPR019548. CTF/NFI_DNA-bd_N.
IPR003619. MAD_homology1_Dwarfin-type.
[Graphical view]
PANTHERiPTHR11492. PTHR11492. 1 hit.
PfamiPF00859. CTF_NFI. 1 hit.
PF03165. MH1. 1 hit.
PF10524. NfI_DNAbd_pre-N. 1 hit.
[Graphical view]
SMARTiSM00523. DWA. 1 hit.
[Graphical view]
PROSITEiPS00349. CTF_NFI_1. 1 hit.
PS51080. CTF_NFI_2. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.
Isoform 1 (identifier: O00712-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MMYSPICLTQ DEFHPFIEAL LPHVRAIAYT WFNLQARKRK YFKKHEKRMS
60 70 80 90 100
KDEERAVKDE LLSEKPEIKQ KWASRLLAKL RKDIRQEYRE DFVLTVTGKK
110 120 130 140 150
HPCCVLSNPD QKGKIRRIDC LRQADKVWRL DLVMVILFKG IPLESTDGER
160 170 180 190 200
LMKSPHCTNP ALCVQPHHIT VSVKELDLFL AYYVQEQDSG QSGSPSHNDP
210 220 230 240 250
AKNPPGYLED SFVKSGVFNV SELVRVSRTP ITQGTGVNFP IGEIPSQPYY
260 270 280 290 300
HDMNSGVNLQ RSLSSPPSSK RPKTISIDEN MEPSPTGDFY PSPSSPAAGS
310 320 330 340 350
RTWHERDQDM SSPTTMKKPE KPLFSSASPQ DSSPRLSTFP QHHHPGIPGV
360 370 380 390 400
AHSVISTRTP PPPSPLPFPT QAILPPAPSS YFSHPTIRYP PHLNPQDTLK
410 420
NYVPSYDPSS PQTSQSWYLG
Length:420
Mass (Da):47,442
Last modified:March 15, 2004 - v2
Checksum:i0F71635FE9D64FA4
GO
Isoform 2 (identifier: O00712-3)
Sequence is not available
Length:
Mass (Da):
Isoform 3 (identifier: O00712-2) [UniParc]FASTAAdd to basket
Also known as: NFI-B3

The sequence of this isoform differs from the canonical sequence as follows:
     187-188: QD → AR
     189-420: Missing.

Show »
Length:188
Mass (Da):22,251
Checksum:iC718698597C13336
GO
Isoform 4 (identifier: O00712-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-10: MMYSPICLTQ → MERIPVSVDFWVVCCAVLKCNPGIPMERIPVSVDFWVVCCAVLKCNPGIPKRMSTLCFGFS

Note: No experimental confirmation available.
Show »
Length:471
Mass (Da):53,049
Checksum:iD2797FFB1527C066
GO
Isoform 5 (identifier: O00712-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     416-416: S → PNGSGQVVGK...DPSFLHQQQS

Note: No experimental confirmation available.
Show »
Length:494
Mass (Da):55,181
Checksum:i55BE3377EEEA2C07
GO
Isoform 6 (identifier: O00712-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-252: Missing.
     416-420: SWYLG → PNGSGQVVGK...EPFLQAETSN

Note: No experimental confirmation available.
Show »
Length:309
Mass (Da):33,525
Checksum:i8DA70FF7F8A8CEEF
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti17I → M in AAB41899 (PubMed:9484777).Curated1
Sequence conflicti37R → G in BAD18416 (PubMed:14702039).Curated1
Sequence conflicti74S → F in BX648845 (PubMed:17974005).Curated1
Sequence conflicti198N → S in BAD18416 (PubMed:14702039).Curated1
Sequence conflicti284S → R in BX648845 (PubMed:17974005).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0547131 – 252Missing in isoform 6. 1 PublicationAdd BLAST252
Alternative sequenceiVSP_0444621 – 10MMYSPICLTQ → MERIPVSVDFWVVCCAVLKC NPGIPMERIPVSVDFWVVCC AVLKCNPGIPKRMSTLCFGF S in isoform 4. 1 Publication10
Alternative sequenceiVSP_003545187 – 188QD → AR in isoform 3. 1 Publication2
Alternative sequenceiVSP_003546189 – 420Missing in isoform 3. 1 PublicationAdd BLAST232
Alternative sequenceiVSP_054714416 – 420SWYLG → PNGSGQVVGKVPGHFTPVLA PSPHPSAVRPVTLSMTDTKP ITTSTEAYTASGTSQANRYV GLSPRDPSFLHQQQLRICDW TMNQNGRHLYPSTSEDTLGI TWQSPGTWASLVPFQVSNRT PILPANVQNYGLNIIGEPFL QAETSN in isoform 6. 1 Publication5
Alternative sequenceiVSP_045065416S → PNGSGQVVGKVPGHFTPVLA PSPHPSAVRPVTLSMTDTKP ITTSTEAYTASGTSQANRYV GLSPRDPSFLHQQQS in isoform 5. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U85193 mRNA. Translation: AAB41899.1.
U70862 mRNA. Translation: AAB51197.1.
BT007266 mRNA. Translation: AAP35930.1.
AK131233 mRNA. Translation: BAD18416.1.
BX648416 mRNA. Translation: CAH56156.1.
BX648845 mRNA. No translation available.
AL441963, AL136366 Genomic DNA. Translation: CAH71971.1.
AL136366, AL441963 Genomic DNA. Translation: CAH73585.1.
AL137017 Genomic DNA. No translation available.
AL449443 Genomic DNA. No translation available.
CH471071 Genomic DNA. Translation: EAW58697.1.
CH471071 Genomic DNA. Translation: EAW58699.1.
BC001283 mRNA. Translation: AAH01283.1.
U07810 mRNA. Translation: AAA93125.1.
CCDSiCCDS55291.1. [O00712-5]
CCDS6474.1. [O00712-1]
CCDS65007.1. [O00712-6]
RefSeqiNP_001177666.1. NM_001190737.1. [O00712-5]
NP_001177667.1. NM_001190738.1.
NP_001269716.1. NM_001282787.1. [O00712-6]
NP_005587.2. NM_005596.3. [O00712-1]
UniGeneiHs.644095.

Genome annotation databases

EnsembliENST00000380953; ENSP00000370340; ENSG00000147862. [O00712-5]
ENST00000380959; ENSP00000370346; ENSG00000147862. [O00712-1]
ENST00000543693; ENSP00000442888; ENSG00000147862. [O00712-6]
GeneIDi4781.
KEGGihsa:4781.
UCSCiuc003zld.4. human. [O00712-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U85193 mRNA. Translation: AAB41899.1.
U70862 mRNA. Translation: AAB51197.1.
BT007266 mRNA. Translation: AAP35930.1.
AK131233 mRNA. Translation: BAD18416.1.
BX648416 mRNA. Translation: CAH56156.1.
BX648845 mRNA. No translation available.
AL441963, AL136366 Genomic DNA. Translation: CAH71971.1.
AL136366, AL441963 Genomic DNA. Translation: CAH73585.1.
AL137017 Genomic DNA. No translation available.
AL449443 Genomic DNA. No translation available.
CH471071 Genomic DNA. Translation: EAW58697.1.
CH471071 Genomic DNA. Translation: EAW58699.1.
BC001283 mRNA. Translation: AAH01283.1.
U07810 mRNA. Translation: AAA93125.1.
CCDSiCCDS55291.1. [O00712-5]
CCDS6474.1. [O00712-1]
CCDS65007.1. [O00712-6]
RefSeqiNP_001177666.1. NM_001190737.1. [O00712-5]
NP_001177667.1. NM_001190738.1.
NP_001269716.1. NM_001282787.1. [O00712-6]
NP_005587.2. NM_005596.3. [O00712-1]
UniGeneiHs.644095.

3D structure databases

ProteinModelPortaliO00712.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110853. 14 interactors.
DIPiDIP-61433N.
IntActiO00712. 5 interactors.
STRINGi9606.ENSP00000370340.

PTM databases

iPTMnetiO00712.
PhosphoSitePlusiO00712.

Polymorphism and mutation databases

BioMutaiNFIB.

Proteomic databases

EPDiO00712.
PaxDbiO00712.
PeptideAtlasiO00712.
PRIDEiO00712.

Protocols and materials databases

DNASUi4781.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000380953; ENSP00000370340; ENSG00000147862. [O00712-5]
ENST00000380959; ENSP00000370346; ENSG00000147862. [O00712-1]
ENST00000543693; ENSP00000442888; ENSG00000147862. [O00712-6]
GeneIDi4781.
KEGGihsa:4781.
UCSCiuc003zld.4. human. [O00712-1]

Organism-specific databases

CTDi4781.
DisGeNETi4781.
GeneCardsiNFIB.
HGNCiHGNC:7785. NFIB.
HPAiHPA003956.
MIMi600728. gene.
neXtProtiNX_O00712.
OpenTargetsiENSG00000147862.
PharmGKBiPA31591.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3663. Eukaryota.
ENOG410Y16G. LUCA.
GeneTreeiENSGT00390000009905.
HOGENOMiHOG000013028.
HOVERGENiHBG006561.
InParanoidiO00712.
KOiK09169.
PhylomeDBiO00712.
TreeFamiTF313889.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000147862-MONOMER.
ReactomeiR-HSA-73980. RNA Polymerase III Transcription Termination.
R-HSA-749476. RNA Polymerase III Abortive And Retractive Initiation.
SignaLinkiO00712.
SIGNORiO00712.

Miscellaneous databases

ChiTaRSiNFIB. human.
GeneWikiiNFIB_(gene).
GenomeRNAii4781.
PROiO00712.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000147862.
CleanExiHS_NFIB.
ExpressionAtlasiO00712. baseline and differential.
GenevisibleiO00712. HS.

Family and domain databases

InterProiIPR000647. CTF/NFI.
IPR020604. CTF/NFI_DNA-bd-dom.
IPR019739. CTF/NFI_DNA-bd_CS.
IPR019548. CTF/NFI_DNA-bd_N.
IPR003619. MAD_homology1_Dwarfin-type.
[Graphical view]
PANTHERiPTHR11492. PTHR11492. 1 hit.
PfamiPF00859. CTF_NFI. 1 hit.
PF03165. MH1. 1 hit.
PF10524. NfI_DNAbd_pre-N. 1 hit.
[Graphical view]
SMARTiSM00523. DWA. 1 hit.
[Graphical view]
PROSITEiPS00349. CTF_NFI_1. 1 hit.
PS51080. CTF_NFI_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiNFIB_HUMAN
AccessioniPrimary (citable) accession number: O00712
Secondary accession number(s): G3V1P1
, H7BYE8, O00166, Q12858, Q5VW29, Q63HM5, Q6ZNF9, Q96J45
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 1, 2001
Last sequence update: March 15, 2004
Last modified: November 2, 2016
This is version 154 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.