Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O00712

- NFIB_HUMAN

UniProt

O00712 - NFIB_HUMAN

Protein

Nuclear factor 1 B-type

Gene

NFIB

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 132 (01 Oct 2014)
      Sequence version 2 (15 Mar 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication.

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    DNA bindingi1 – 195195CTF/NF-IPROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. DNA binding Source: UniProtKB
    2. double-stranded DNA binding Source: Ensembl
    3. RNA polymerase II core promoter proximal region sequence-specific DNA binding Source: NTNU_SB
    4. RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription Source: NTNU_SB
    5. RNA polymerase II transcription corepressor activity Source: UniProtKB
    6. sequence-specific DNA binding RNA polymerase II transcription factor activity Source: UniProtKB

    GO - Biological processi

    1. anterior commissure morphogenesis Source: UniProtKB
    2. chondrocyte differentiation Source: UniProtKB
    3. Clara cell differentiation Source: UniProtKB
    4. commissural neuron axon guidance Source: UniProtKB
    5. DNA replication Source: UniProtKB-KW
    6. glial cell differentiation Source: UniProtKB
    7. hindbrain development Source: Ensembl
    8. lung ciliated cell differentiation Source: UniProtKB
    9. negative regulation of DNA binding Source: UniProtKB
    10. negative regulation of epithelial cell proliferation involved in lung morphogenesis Source: UniProtKB
    11. negative regulation of mesenchymal cell proliferation involved in lung development Source: UniProtKB
    12. negative regulation of transcription from RNA polymerase II promoter Source: UniProtKB
    13. positive regulation of transcription from RNA polymerase II promoter Source: UniProtKB
    14. principal sensory nucleus of trigeminal nerve development Source: UniProtKB
    15. transcription from RNA polymerase II promoter Source: GOC
    16. Type II pneumocyte differentiation Source: UniProtKB
    17. Type I pneumocyte differentiation Source: UniProtKB

    Keywords - Molecular functioni

    Activator

    Keywords - Biological processi

    DNA replication, Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding

    Enzyme and pathway databases

    ReactomeiREACT_22339. RNA Polymerase III Abortive And Retractive Initiation.
    REACT_63. RNA Polymerase III Transcription Termination.
    SignaLinkiO00712.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Nuclear factor 1 B-type
    Short name:
    NF1-B
    Short name:
    Nuclear factor 1/B
    Alternative name(s):
    CCAAT-box-binding transcription factor
    Short name:
    CTF
    Nuclear factor I/B
    Short name:
    NF-I/B
    Short name:
    NFI-B
    TGGCA-binding protein
    Gene namesi
    Name:NFIB
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 9

    Organism-specific databases

    HGNCiHGNC:7785. NFIB.

    Subcellular locationi

    GO - Cellular componenti

    1. cerebellar mossy fiber Source: UniProtKB
    2. nucleolus Source: HPA
    3. nucleus Source: UniProtKB

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA31591.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 420420Nuclear factor 1 B-typePRO_0000100195Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei264 – 2641Phosphoserine1 Publication
    Modified residuei292 – 2921PhosphoserineBy similarity
    Modified residuei295 – 2951PhosphoserineBy similarity
    Modified residuei312 – 3121Phosphoserine1 Publication
    Modified residuei328 – 3281Phosphoserine2 Publications
    Modified residuei333 – 3331Phosphoserine1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiO00712.
    PaxDbiO00712.
    PRIDEiO00712.

    PTM databases

    PhosphoSiteiO00712.

    Expressioni

    Gene expression databases

    ArrayExpressiO00712.
    BgeeiO00712.
    CleanExiHS_NFIB.
    GenevestigatoriO00712.

    Organism-specific databases

    HPAiHPA003956.

    Interactioni

    Subunit structurei

    Binds DNA as a homodimer.

    Protein-protein interaction databases

    BioGridi110853. 9 interactions.
    STRINGi9606.ENSP00000370346.

    Structurei

    3D structure databases

    ProteinModelPortaliO00712.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the CTF/NF-I family.PROSITE-ProRule annotation
    Contains 1 CTF/NF-I DNA-binding domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiNOG252172.
    HOVERGENiHBG006561.
    KOiK09169.
    PhylomeDBiO00712.
    TreeFamiTF313889.

    Family and domain databases

    InterProiIPR000647. CTF/NFI.
    IPR020604. CTF/NFI_DNA-bd-dom.
    IPR019739. CTF/NFI_DNA-bd_CS.
    IPR019548. CTF/NFI_DNA-bd_N.
    IPR003619. MAD_homology1_Dwarfin-type.
    [Graphical view]
    PANTHERiPTHR11492. PTHR11492. 1 hit.
    PfamiPF00859. CTF_NFI. 1 hit.
    PF03165. MH1. 1 hit.
    PF10524. NfI_DNAbd_pre-N. 1 hit.
    [Graphical view]
    SMARTiSM00523. DWA. 1 hit.
    [Graphical view]
    PROSITEiPS00349. CTF_NFI_1. 1 hit.
    PS51080. CTF_NFI_2. 1 hit.
    [Graphical view]

    Sequences (6)i

    Sequence statusi: Complete.

    This entry describes 6 isoformsi produced by alternative splicing. Align

    Note: Additional isoforms seem to exist.

    Isoform 1 (identifier: O00712-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MMYSPICLTQ DEFHPFIEAL LPHVRAIAYT WFNLQARKRK YFKKHEKRMS    50
    KDEERAVKDE LLSEKPEIKQ KWASRLLAKL RKDIRQEYRE DFVLTVTGKK 100
    HPCCVLSNPD QKGKIRRIDC LRQADKVWRL DLVMVILFKG IPLESTDGER 150
    LMKSPHCTNP ALCVQPHHIT VSVKELDLFL AYYVQEQDSG QSGSPSHNDP 200
    AKNPPGYLED SFVKSGVFNV SELVRVSRTP ITQGTGVNFP IGEIPSQPYY 250
    HDMNSGVNLQ RSLSSPPSSK RPKTISIDEN MEPSPTGDFY PSPSSPAAGS 300
    RTWHERDQDM SSPTTMKKPE KPLFSSASPQ DSSPRLSTFP QHHHPGIPGV 350
    AHSVISTRTP PPPSPLPFPT QAILPPAPSS YFSHPTIRYP PHLNPQDTLK 400
    NYVPSYDPSS PQTSQSWYLG 420
    Length:420
    Mass (Da):47,442
    Last modified:March 15, 2004 - v2
    Checksum:i0F71635FE9D64FA4
    GO
    Isoform 2 (identifier: O00712-3)

    Sequence is not available
    Length:
    Mass (Da):
    Isoform 3 (identifier: O00712-2) [UniParc]FASTAAdd to Basket

    Also known as: NFI-B3

    The sequence of this isoform differs from the canonical sequence as follows:
         187-188: QD → AR
         189-420: Missing.

    Show »
    Length:188
    Mass (Da):22,251
    Checksum:iC718698597C13336
    GO
    Isoform 4 (identifier: O00712-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-10: MMYSPICLTQ → MERIPVSVDFWVVCCAVLKCNPGIPMERIPVSVDFWVVCCAVLKCNPGIPKRMSTLCFGFS

    Note: No experimental confirmation available.

    Show »
    Length:471
    Mass (Da):53,049
    Checksum:iD2797FFB1527C066
    GO
    Isoform 5 (identifier: O00712-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         416-416: S → PNGSGQVVGK...DPSFLHQQQS

    Note: No experimental confirmation available.

    Show »
    Length:494
    Mass (Da):55,181
    Checksum:i55BE3377EEEA2C07
    GO
    Isoform 6 (identifier: O00712-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-252: Missing.
         416-420: SWYLG → PNGSGQVVGK...EPFLQAETSN

    Note: No experimental confirmation available.

    Show »
    Length:309
    Mass (Da):33,525
    Checksum:i8DA70FF7F8A8CEEF
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti17 – 171I → M in AAB41899. (PubMed:9484777)Curated
    Sequence conflicti37 – 371R → G in BAD18416. (PubMed:14702039)Curated
    Sequence conflicti74 – 741S → F in BX648845. (PubMed:17974005)Curated
    Sequence conflicti198 – 1981N → S in BAD18416. (PubMed:14702039)Curated
    Sequence conflicti284 – 2841S → R in BX648845. (PubMed:17974005)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 252252Missing in isoform 6. 1 PublicationVSP_054713Add
    BLAST
    Alternative sequencei1 – 1010MMYSPICLTQ → MERIPVSVDFWVVCCAVLKC NPGIPMERIPVSVDFWVVCC AVLKCNPGIPKRMSTLCFGF S in isoform 4. 1 PublicationVSP_044462
    Alternative sequencei187 – 1882QD → AR in isoform 3. 1 PublicationVSP_003545
    Alternative sequencei189 – 420232Missing in isoform 3. 1 PublicationVSP_003546Add
    BLAST
    Alternative sequencei416 – 4205SWYLG → PNGSGQVVGKVPGHFTPVLA PSPHPSAVRPVTLSMTDTKP ITTSTEAYTASGTSQANRYV GLSPRDPSFLHQQQLRICDW TMNQNGRHLYPSTSEDTLGI TWQSPGTWASLVPFQVSNRT PILPANVQNYGLNIIGEPFL QAETSN in isoform 6. 1 PublicationVSP_054714
    Alternative sequencei416 – 4161S → PNGSGQVVGKVPGHFTPVLA PSPHPSAVRPVTLSMTDTKP ITTSTEAYTASGTSQANRYV GLSPRDPSFLHQQQS in isoform 5. 1 PublicationVSP_045065

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U85193 mRNA. Translation: AAB41899.1.
    U70862 mRNA. Translation: AAB51197.1.
    BT007266 mRNA. Translation: AAP35930.1.
    AK131233 mRNA. Translation: BAD18416.1.
    BX648416 mRNA. Translation: CAH56156.1.
    BX648845 mRNA. No translation available.
    AL441963, AL136366 Genomic DNA. Translation: CAH71971.1.
    AL136366, AL441963 Genomic DNA. Translation: CAH73585.1.
    AL137017 Genomic DNA. No translation available.
    AL449443 Genomic DNA. No translation available.
    CH471071 Genomic DNA. Translation: EAW58697.1.
    CH471071 Genomic DNA. Translation: EAW58699.1.
    BC001283 mRNA. Translation: AAH01283.1.
    U07810 mRNA. Translation: AAA93125.1.
    CCDSiCCDS55291.1. [O00712-5]
    CCDS6474.1. [O00712-1]
    CCDS65007.1. [O00712-6]
    RefSeqiNP_001177666.1. NM_001190737.1. [O00712-5]
    NP_001177667.1. NM_001190738.1.
    NP_001269716.1. NM_001282787.1. [O00712-6]
    NP_005587.2. NM_005596.3. [O00712-1]
    UniGeneiHs.644095.

    Genome annotation databases

    EnsembliENST00000380953; ENSP00000370340; ENSG00000147862. [O00712-5]
    ENST00000380959; ENSP00000370346; ENSG00000147862. [O00712-1]
    ENST00000543693; ENSP00000442888; ENSG00000147862. [O00712-6]
    GeneIDi4781.
    KEGGihsa:4781.
    UCSCiuc003zld.3. human.
    uc003zle.3. human. [O00712-1]
    uc003zlf.3. human.
    uc022bdp.1. human. [O00712-4]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U85193 mRNA. Translation: AAB41899.1 .
    U70862 mRNA. Translation: AAB51197.1 .
    BT007266 mRNA. Translation: AAP35930.1 .
    AK131233 mRNA. Translation: BAD18416.1 .
    BX648416 mRNA. Translation: CAH56156.1 .
    BX648845 mRNA. No translation available.
    AL441963 , AL136366 Genomic DNA. Translation: CAH71971.1 .
    AL136366 , AL441963 Genomic DNA. Translation: CAH73585.1 .
    AL137017 Genomic DNA. No translation available.
    AL449443 Genomic DNA. No translation available.
    CH471071 Genomic DNA. Translation: EAW58697.1 .
    CH471071 Genomic DNA. Translation: EAW58699.1 .
    BC001283 mRNA. Translation: AAH01283.1 .
    U07810 mRNA. Translation: AAA93125.1 .
    CCDSi CCDS55291.1. [O00712-5 ]
    CCDS6474.1. [O00712-1 ]
    CCDS65007.1. [O00712-6 ]
    RefSeqi NP_001177666.1. NM_001190737.1. [O00712-5 ]
    NP_001177667.1. NM_001190738.1.
    NP_001269716.1. NM_001282787.1. [O00712-6 ]
    NP_005587.2. NM_005596.3. [O00712-1 ]
    UniGenei Hs.644095.

    3D structure databases

    ProteinModelPortali O00712.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 110853. 9 interactions.
    STRINGi 9606.ENSP00000370346.

    PTM databases

    PhosphoSitei O00712.

    Proteomic databases

    MaxQBi O00712.
    PaxDbi O00712.
    PRIDEi O00712.

    Protocols and materials databases

    DNASUi 4781.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000380953 ; ENSP00000370340 ; ENSG00000147862 . [O00712-5 ]
    ENST00000380959 ; ENSP00000370346 ; ENSG00000147862 . [O00712-1 ]
    ENST00000543693 ; ENSP00000442888 ; ENSG00000147862 . [O00712-6 ]
    GeneIDi 4781.
    KEGGi hsa:4781.
    UCSCi uc003zld.3. human.
    uc003zle.3. human. [O00712-1 ]
    uc003zlf.3. human.
    uc022bdp.1. human. [O00712-4 ]

    Organism-specific databases

    CTDi 4781.
    GeneCardsi GC09M014077.
    HGNCi HGNC:7785. NFIB.
    HPAi HPA003956.
    MIMi 600728. gene.
    neXtProti NX_O00712.
    PharmGKBi PA31591.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG252172.
    HOVERGENi HBG006561.
    KOi K09169.
    PhylomeDBi O00712.
    TreeFami TF313889.

    Enzyme and pathway databases

    Reactomei REACT_22339. RNA Polymerase III Abortive And Retractive Initiation.
    REACT_63. RNA Polymerase III Transcription Termination.
    SignaLinki O00712.

    Miscellaneous databases

    ChiTaRSi NFIB. human.
    GeneWikii NFIB_(gene).
    GenomeRNAii 4781.
    NextBioi 18436.
    PROi O00712.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O00712.
    Bgeei O00712.
    CleanExi HS_NFIB.
    Genevestigatori O00712.

    Family and domain databases

    InterProi IPR000647. CTF/NFI.
    IPR020604. CTF/NFI_DNA-bd-dom.
    IPR019739. CTF/NFI_DNA-bd_CS.
    IPR019548. CTF/NFI_DNA-bd_N.
    IPR003619. MAD_homology1_Dwarfin-type.
    [Graphical view ]
    PANTHERi PTHR11492. PTHR11492. 1 hit.
    Pfami PF00859. CTF_NFI. 1 hit.
    PF03165. MH1. 1 hit.
    PF10524. NfI_DNAbd_pre-N. 1 hit.
    [Graphical view ]
    SMARTi SM00523. DWA. 1 hit.
    [Graphical view ]
    PROSITEi PS00349. CTF_NFI_1. 1 hit.
    PS51080. CTF_NFI_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Identification of NFIB as recurrent translocation partner gene of HMGIC in pleomorphic adenomas."
      Geurts J.M.W., Schoenmakers E.F.P.M., Roijer E., Astroem A.-K., Stenman G., van de Ven W.J.M.
      Oncogene 16:865-872(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "NFI-B3, a novel transcriptional repressor of the nuclear factor I family, is generated by alternative RNA processing."
      Liu Y., Bernard H.U., Apt D.
      J. Biol. Chem. 272:10739-10745(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
      Tissue: Foreskin.
    3. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
      Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
      Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
      Tissue: Amygdala.
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 5 AND 6).
      Tissue: Colon epithelium.
    6. "DNA sequence and analysis of human chromosome 9."
      Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L.
      , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
      Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Cervix.
    9. "Chromosomal localization of the four genes (NFIA, B, C, and X) for the human transcription factor nuclear factor I by FISH."
      Qian F., Kruse U., Lichter P., Sippel A.E.
      Genomics 28:66-73(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 20-283.
    10. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-264 AND SER-328, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    11. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-312; SER-328 AND SER-333, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.

    Entry informationi

    Entry nameiNFIB_HUMAN
    AccessioniPrimary (citable) accession number: O00712
    Secondary accession number(s): G3V1P1
    , H7BYE8, O00166, Q12858, Q5VW29, Q63HM5, Q6ZNF9, Q96J45
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 1, 2001
    Last sequence update: March 15, 2004
    Last modified: October 1, 2014
    This is version 132 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 9
      Human chromosome 9: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3