O00712 (NFIB_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 117.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Nuclear factor 1 B-type Short name=NF1-B Short name=Nuclear factor 1/B Alternative name(s): CCAAT-box-binding transcription factor Short name=CTF Nuclear factor I/B Short name=NF-I/B Short name=NFI-B TGGCA-binding protein | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 420 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication. |
| Subunit structure | Binds DNA as a homodimer. |
| Subcellular location | |
| Sequence similarities | Belongs to the CTF/NF-I family. Contains 1 CTF/NF-I DNA-binding domain. |
Ontologies
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform 1 (identifier: O00712-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O00712-3) The sequence of this isoform is not available. | ||||||
| Isoform 3 (identifier: O00712-2) Also known as: NFI-B3; The sequence of this isoform differs from the canonical sequence as follows: 187-188: QD → AR 189-420: Missing. | ||||||
| Isoform 4 (identifier: O00712-4) The sequence of this isoform differs from the canonical sequence as follows: 1-10: MMYSPICLTQ → MERIPVSVDFWVVCCAVLKCNPGIPMERIPVSVDFWVVCCAVLKCNPGIPKRMSTLCFGFS | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 5 (identifier: O00712-5) The sequence of this isoform differs from the canonical sequence as follows: 416-416: S → PNGSGQVVGK...DPSFLHQQQS | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed Ref.12 | ||||||
| Chain | 2 – 420 | 419 | Nuclear factor 1 B-type | PRO_0000100195 | |||||
Regions | |||||||||
| DNA binding | 1 – 195 | 195 | CTF/NF-I | ||||||
Amino acid modifications | |||||||||
| Modified residue | 2 | 1 | N-acetylmethionine Ref.12 | ||||||
| Modified residue | 63 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 264 | 1 | Phosphoserine Ref.11 | ||||||
| Modified residue | 292 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 295 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 312 | 1 | Phosphoserine Ref.12 | ||||||
| Modified residue | 328 | 1 | Phosphoserine Ref.11 Ref.12 | ||||||
| Modified residue | 333 | 1 | Phosphoserine Ref.12 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 10 | 10 | MMYSPICLTQ → MERIPVSVDFWVVCCAVLKC NPGIPMERIPVSVDFWVVCC AVLKCNPGIPKRMSTLCFGF S in isoform 4. | VSP_044462 | |||||
| Alternative sequence | 187 – 188 | 2 | QD → AR in isoform 3. | VSP_003545 | |||||
| Alternative sequence | 189 – 420 | 232 | Missing in isoform 3. | VSP_003546 | |||||
| Alternative sequence | 416 | 1 | S → PNGSGQVVGKVPGHFTPVLA PSPHPSAVRPVTLSMTDTKP ITTSTEAYTASGTSQANRYV GLSPRDPSFLHQQQS in isoform 5. | VSP_045065 | |||||
Experimental info | |||||||||
| Sequence conflict | 17 | 1 | I → M in AAB41899. Ref.1 | ||||||
| Sequence conflict | 37 | 1 | R → G in BAD18416. Ref.4 | ||||||
| Sequence conflict | 74 | 1 | S → F in BX648845. Ref.5 | ||||||
| Sequence conflict | 198 | 1 | N → S in BAD18416. Ref.4 | ||||||
| Sequence conflict | 284 | 1 | S → R in BX648845. Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of NFIB as recurrent translocation partner gene of HMGIC in pleomorphic adenomas." Geurts J.M.W., Schoenmakers E.F.P.M., Roijer E., Astroem A.-K., Stenman G., van de Ven W.J.M. Oncogene 16:865-872(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "NFI-B3, a novel transcriptional repressor of the nuclear factor I family, is generated by alternative RNA processing." Liu Y., Bernard H.U., Apt D. J. Biol. Chem. 272:10739-10745(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3). Tissue: Foreskin. |
| [3] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Amygdala. |
| [5] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5). Tissue: Colon epithelium. |
| [6] | "DNA sequence and analysis of human chromosome 9." Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L. Dunham I.Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Cervix. |
| [9] | "Chromosomal localization of the four genes (NFIA, B, C, and X) for the human transcription factor nuclear factor I by FISH." Qian F., Kruse U., Lichter P., Sippel A.E. Genomics 28:66-73(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 20-283. |
| [10] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [11] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-264 AND SER-328, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [12] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-2, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-312; SER-328 AND SER-333, MASS SPECTROMETRY, CLEAVAGE OF INITIATOR METHIONINE. Tissue: Cervix carcinoma. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U85193 mRNA. Translation: AAB41899.1. U70862 mRNA. Translation: AAB51197.1. BT007266 mRNA. Translation: AAP35930.1. AK131233 mRNA. Translation: BAD18416.1. BX648845 mRNA. No translation available. AL441963, AL136366 Genomic DNA. Translation: CAH71971.1. AL136366, AL441963 Genomic DNA. Translation: CAH73585.1. AL137017 Genomic DNA. No translation available. AL449443 Genomic DNA. No translation available. CH471071 Genomic DNA. Translation: EAW58699.1. BC001283 mRNA. Translation: AAH01283.1. U07810 mRNA. Translation: AAA93125.1. |
| IPI | IPI00473116. IPI00646279. IPI00953386. |
| RefSeq | NP_001177666.1. NM_001190737.1. NP_001177667.1. NM_001190738.1. NP_005587.2. NM_005596.3. |
| UniGene | Hs.644095. |
3D structure databases | |
| ProteinModelPortal | O00712. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000370346. |
PTM databases | |
| PhosphoSite | O00712. |
Proteomic databases | |
| PaxDb | O00712. |
| PRIDE | O00712. |
Protocols and materials databases | |
| DNASU | 4781. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000380953; ENSP00000370340; ENSG00000147862. ENST00000380959; ENSP00000370346; ENSG00000147862. |
| GeneID | 4781. |
| KEGG | hsa:4781. |
| UCSC | uc003zle.3. human. |
Organism-specific databases | |
| CTD | 4781. |
| GeneCards | GC09M014077. |
| HGNC | HGNC:7785. NFIB. |
| HPA | HPA003956. |
| MIM | 600728. gene. |
| neXtProt | NX_O00712. |
| PharmGKB | PA31591. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG252172. |
| HOVERGEN | HBG006561. |
| KO | K09169. |
Enzyme and pathway databases | |
| Pathway_Interaction_DB | hnf3apathway. FOXA1 transcription factor network. |
Gene expression databases | |
| ArrayExpress | O00712. |
| Bgee | O00712. |
| CleanEx | HS_NFIB. |
| Genevestigator | O00712. |
| GermOnline | ENSG00000147862. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR000647. CTF/NFI. IPR020604. CTF/NFI_DNA-bd-dom. IPR019739. CTF/NFI_DNA-bd_CS. IPR019548. CTF/NFI_DNA-bd_N. IPR003619. MAD_homology1_Dwarfin-type. [Graphical view] |
| PANTHER | PTHR11492. PTHR11492. 1 hit. |
| Pfam | PF00859. CTF_NFI. 1 hit. PF03165. MH1. 1 hit. PF10524. NfI_DNAbd_pre-N. 1 hit. [Graphical view] |
| SMART | SM00523. DWA. 1 hit. [Graphical view] |
| PROSITE | PS00349. CTF_NFI_1. 1 hit. PS51080. CTF_NFI_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | NFIB. human. |
| GenomeRNAi | 4781. |
| NextBio | 18436. |
| SOURCE | Search... |
Entry information
| Entry name | NFIB_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O00712 Secondary accession number(s): H7BYE8 Q96J45 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 9 Human chromosome 9: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
