Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nuclear factor 1 B-type

Gene

NFIB

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
DNA bindingi1 – 195195CTF/NF-IPROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  1. DNA binding Source: UniProtKB
  2. double-stranded DNA binding Source: Ensembl
  3. RNA polymerase II core promoter proximal region sequence-specific DNA binding Source: NTNU_SB
  4. RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription Source: NTNU_SB
  5. RNA polymerase II transcription corepressor activity Source: UniProtKB
  6. sequence-specific DNA binding RNA polymerase II transcription factor activity Source: UniProtKB

GO - Biological processi

  1. anterior commissure morphogenesis Source: UniProtKB
  2. chondrocyte differentiation Source: UniProtKB
  3. Clara cell differentiation Source: UniProtKB
  4. commissural neuron axon guidance Source: UniProtKB
  5. DNA replication Source: UniProtKB-KW
  6. glial cell differentiation Source: UniProtKB
  7. hindbrain development Source: Ensembl
  8. lung ciliated cell differentiation Source: UniProtKB
  9. negative regulation of DNA binding Source: UniProtKB
  10. negative regulation of epithelial cell proliferation involved in lung morphogenesis Source: UniProtKB
  11. negative regulation of mesenchymal cell proliferation involved in lung development Source: UniProtKB
  12. negative regulation of transcription from RNA polymerase II promoter Source: UniProtKB
  13. positive regulation of transcription from RNA polymerase II promoter Source: UniProtKB
  14. principal sensory nucleus of trigeminal nerve development Source: UniProtKB
  15. transcription from RNA polymerase II promoter Source: GOC
  16. Type II pneumocyte differentiation Source: UniProtKB
  17. Type I pneumocyte differentiation Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Activator

Keywords - Biological processi

DNA replication, Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Enzyme and pathway databases

ReactomeiREACT_22339. RNA Polymerase III Abortive And Retractive Initiation.
REACT_63. RNA Polymerase III Transcription Termination.
SignaLinkiO00712.

Names & Taxonomyi

Protein namesi
Recommended name:
Nuclear factor 1 B-type
Short name:
NF1-B
Short name:
Nuclear factor 1/B
Alternative name(s):
CCAAT-box-binding transcription factor
Short name:
CTF
Nuclear factor I/B
Short name:
NF-I/B
Short name:
NFI-B
TGGCA-binding protein
Gene namesi
Name:NFIB
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 9

Organism-specific databases

HGNCiHGNC:7785. NFIB.

Subcellular locationi

GO - Cellular componenti

  1. cerebellar mossy fiber Source: UniProtKB
  2. nucleolus Source: HPA
  3. nucleoplasm Source: HPA
  4. nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA31591.

Polymorphism and mutation databases

BioMutaiNFIB.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 420420Nuclear factor 1 B-typePRO_0000100195Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei264 – 2641Phosphoserine1 Publication
Modified residuei292 – 2921Phosphoserine1 Publication
Modified residuei295 – 2951Phosphoserine1 Publication
Modified residuei312 – 3121Phosphoserine1 Publication
Modified residuei328 – 3281Phosphoserine2 Publications
Modified residuei333 – 3331Phosphoserine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiO00712.
PaxDbiO00712.
PRIDEiO00712.

PTM databases

PhosphoSiteiO00712.

Expressioni

Gene expression databases

BgeeiO00712.
CleanExiHS_NFIB.
ExpressionAtlasiO00712. baseline and differential.
GenevestigatoriO00712.

Organism-specific databases

HPAiHPA003956.

Interactioni

Subunit structurei

Binds DNA as a homodimer.

Protein-protein interaction databases

BioGridi110853. 9 interactions.
STRINGi9606.ENSP00000370346.

Structurei

3D structure databases

ProteinModelPortaliO00712.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the CTF/NF-I family.PROSITE-ProRule annotation
Contains 1 CTF/NF-I DNA-binding domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiNOG252172.
GeneTreeiENSGT00390000009905.
HOGENOMiHOG000013028.
HOVERGENiHBG006561.
InParanoidiO00712.
KOiK09169.
PhylomeDBiO00712.
TreeFamiTF313889.

Family and domain databases

InterProiIPR000647. CTF/NFI.
IPR020604. CTF/NFI_DNA-bd-dom.
IPR019739. CTF/NFI_DNA-bd_CS.
IPR019548. CTF/NFI_DNA-bd_N.
IPR003619. MAD_homology1_Dwarfin-type.
[Graphical view]
PANTHERiPTHR11492. PTHR11492. 1 hit.
PfamiPF00859. CTF_NFI. 1 hit.
PF03165. MH1. 1 hit.
PF10524. NfI_DNAbd_pre-N. 1 hit.
[Graphical view]
SMARTiSM00523. DWA. 1 hit.
[Graphical view]
PROSITEiPS00349. CTF_NFI_1. 1 hit.
PS51080. CTF_NFI_2. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.

Isoform 1 (identifier: O00712-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MMYSPICLTQ DEFHPFIEAL LPHVRAIAYT WFNLQARKRK YFKKHEKRMS
60 70 80 90 100
KDEERAVKDE LLSEKPEIKQ KWASRLLAKL RKDIRQEYRE DFVLTVTGKK
110 120 130 140 150
HPCCVLSNPD QKGKIRRIDC LRQADKVWRL DLVMVILFKG IPLESTDGER
160 170 180 190 200
LMKSPHCTNP ALCVQPHHIT VSVKELDLFL AYYVQEQDSG QSGSPSHNDP
210 220 230 240 250
AKNPPGYLED SFVKSGVFNV SELVRVSRTP ITQGTGVNFP IGEIPSQPYY
260 270 280 290 300
HDMNSGVNLQ RSLSSPPSSK RPKTISIDEN MEPSPTGDFY PSPSSPAAGS
310 320 330 340 350
RTWHERDQDM SSPTTMKKPE KPLFSSASPQ DSSPRLSTFP QHHHPGIPGV
360 370 380 390 400
AHSVISTRTP PPPSPLPFPT QAILPPAPSS YFSHPTIRYP PHLNPQDTLK
410 420
NYVPSYDPSS PQTSQSWYLG
Length:420
Mass (Da):47,442
Last modified:March 15, 2004 - v2
Checksum:i0F71635FE9D64FA4
GO
Isoform 2 (identifier: O00712-3)

Sequence is not available
Length:
Mass (Da):
Isoform 3 (identifier: O00712-2) [UniParc]FASTAAdd to basket

Also known as: NFI-B3

The sequence of this isoform differs from the canonical sequence as follows:
     187-188: QD → AR
     189-420: Missing.

Show »
Length:188
Mass (Da):22,251
Checksum:iC718698597C13336
GO
Isoform 4 (identifier: O00712-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-10: MMYSPICLTQ → MERIPVSVDFWVVCCAVLKCNPGIPMERIPVSVDFWVVCCAVLKCNPGIPKRMSTLCFGFS

Note: No experimental confirmation available.

Show »
Length:471
Mass (Da):53,049
Checksum:iD2797FFB1527C066
GO
Isoform 5 (identifier: O00712-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     416-416: S → PNGSGQVVGK...DPSFLHQQQS

Note: No experimental confirmation available.

Show »
Length:494
Mass (Da):55,181
Checksum:i55BE3377EEEA2C07
GO
Isoform 6 (identifier: O00712-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-252: Missing.
     416-420: SWYLG → PNGSGQVVGK...EPFLQAETSN

Note: No experimental confirmation available.

Show »
Length:309
Mass (Da):33,525
Checksum:i8DA70FF7F8A8CEEF
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti17 – 171I → M in AAB41899 (PubMed:9484777).Curated
Sequence conflicti37 – 371R → G in BAD18416 (PubMed:14702039).Curated
Sequence conflicti74 – 741S → F in BX648845 (PubMed:17974005).Curated
Sequence conflicti198 – 1981N → S in BAD18416 (PubMed:14702039).Curated
Sequence conflicti284 – 2841S → R in BX648845 (PubMed:17974005).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 252252Missing in isoform 6. 1 PublicationVSP_054713Add
BLAST
Alternative sequencei1 – 1010MMYSPICLTQ → MERIPVSVDFWVVCCAVLKC NPGIPMERIPVSVDFWVVCC AVLKCNPGIPKRMSTLCFGF S in isoform 4. 1 PublicationVSP_044462
Alternative sequencei187 – 1882QD → AR in isoform 3. 1 PublicationVSP_003545
Alternative sequencei189 – 420232Missing in isoform 3. 1 PublicationVSP_003546Add
BLAST
Alternative sequencei416 – 4205SWYLG → PNGSGQVVGKVPGHFTPVLA PSPHPSAVRPVTLSMTDTKP ITTSTEAYTASGTSQANRYV GLSPRDPSFLHQQQLRICDW TMNQNGRHLYPSTSEDTLGI TWQSPGTWASLVPFQVSNRT PILPANVQNYGLNIIGEPFL QAETSN in isoform 6. 1 PublicationVSP_054714
Alternative sequencei416 – 4161S → PNGSGQVVGKVPGHFTPVLA PSPHPSAVRPVTLSMTDTKP ITTSTEAYTASGTSQANRYV GLSPRDPSFLHQQQS in isoform 5. 1 PublicationVSP_045065

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U85193 mRNA. Translation: AAB41899.1.
U70862 mRNA. Translation: AAB51197.1.
BT007266 mRNA. Translation: AAP35930.1.
AK131233 mRNA. Translation: BAD18416.1.
BX648416 mRNA. Translation: CAH56156.1.
BX648845 mRNA. No translation available.
AL441963, AL136366 Genomic DNA. Translation: CAH71971.1.
AL136366, AL441963 Genomic DNA. Translation: CAH73585.1.
AL137017 Genomic DNA. No translation available.
AL449443 Genomic DNA. No translation available.
CH471071 Genomic DNA. Translation: EAW58697.1.
CH471071 Genomic DNA. Translation: EAW58699.1.
BC001283 mRNA. Translation: AAH01283.1.
U07810 mRNA. Translation: AAA93125.1.
CCDSiCCDS55291.1. [O00712-5]
CCDS6474.1. [O00712-1]
CCDS65007.1. [O00712-6]
RefSeqiNP_001177666.1. NM_001190737.1. [O00712-5]
NP_001177667.1. NM_001190738.1.
NP_001269716.1. NM_001282787.1. [O00712-6]
NP_005587.2. NM_005596.3. [O00712-1]
UniGeneiHs.644095.

Genome annotation databases

EnsembliENST00000380953; ENSP00000370340; ENSG00000147862. [O00712-5]
ENST00000380959; ENSP00000370346; ENSG00000147862. [O00712-1]
ENST00000543693; ENSP00000442888; ENSG00000147862. [O00712-6]
ENST00000622101; ENSP00000480557; ENSG00000147862. [O00712-6]
GeneIDi4781.
KEGGihsa:4781.
UCSCiuc003zld.3. human.
uc003zle.3. human. [O00712-1]
uc003zlf.3. human.
uc022bdp.1. human. [O00712-4]

Polymorphism and mutation databases

BioMutaiNFIB.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U85193 mRNA. Translation: AAB41899.1.
U70862 mRNA. Translation: AAB51197.1.
BT007266 mRNA. Translation: AAP35930.1.
AK131233 mRNA. Translation: BAD18416.1.
BX648416 mRNA. Translation: CAH56156.1.
BX648845 mRNA. No translation available.
AL441963, AL136366 Genomic DNA. Translation: CAH71971.1.
AL136366, AL441963 Genomic DNA. Translation: CAH73585.1.
AL137017 Genomic DNA. No translation available.
AL449443 Genomic DNA. No translation available.
CH471071 Genomic DNA. Translation: EAW58697.1.
CH471071 Genomic DNA. Translation: EAW58699.1.
BC001283 mRNA. Translation: AAH01283.1.
U07810 mRNA. Translation: AAA93125.1.
CCDSiCCDS55291.1. [O00712-5]
CCDS6474.1. [O00712-1]
CCDS65007.1. [O00712-6]
RefSeqiNP_001177666.1. NM_001190737.1. [O00712-5]
NP_001177667.1. NM_001190738.1.
NP_001269716.1. NM_001282787.1. [O00712-6]
NP_005587.2. NM_005596.3. [O00712-1]
UniGeneiHs.644095.

3D structure databases

ProteinModelPortaliO00712.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110853. 9 interactions.
STRINGi9606.ENSP00000370346.

PTM databases

PhosphoSiteiO00712.

Polymorphism and mutation databases

BioMutaiNFIB.

Proteomic databases

MaxQBiO00712.
PaxDbiO00712.
PRIDEiO00712.

Protocols and materials databases

DNASUi4781.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000380953; ENSP00000370340; ENSG00000147862. [O00712-5]
ENST00000380959; ENSP00000370346; ENSG00000147862. [O00712-1]
ENST00000543693; ENSP00000442888; ENSG00000147862. [O00712-6]
ENST00000622101; ENSP00000480557; ENSG00000147862. [O00712-6]
GeneIDi4781.
KEGGihsa:4781.
UCSCiuc003zld.3. human.
uc003zle.3. human. [O00712-1]
uc003zlf.3. human.
uc022bdp.1. human. [O00712-4]

Organism-specific databases

CTDi4781.
GeneCardsiGC09M014077.
HGNCiHGNC:7785. NFIB.
HPAiHPA003956.
MIMi600728. gene.
neXtProtiNX_O00712.
PharmGKBiPA31591.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG252172.
GeneTreeiENSGT00390000009905.
HOGENOMiHOG000013028.
HOVERGENiHBG006561.
InParanoidiO00712.
KOiK09169.
PhylomeDBiO00712.
TreeFamiTF313889.

Enzyme and pathway databases

ReactomeiREACT_22339. RNA Polymerase III Abortive And Retractive Initiation.
REACT_63. RNA Polymerase III Transcription Termination.
SignaLinkiO00712.

Miscellaneous databases

ChiTaRSiNFIB. human.
GeneWikiiNFIB_(gene).
GenomeRNAii4781.
NextBioi18436.
PROiO00712.
SOURCEiSearch...

Gene expression databases

BgeeiO00712.
CleanExiHS_NFIB.
ExpressionAtlasiO00712. baseline and differential.
GenevestigatoriO00712.

Family and domain databases

InterProiIPR000647. CTF/NFI.
IPR020604. CTF/NFI_DNA-bd-dom.
IPR019739. CTF/NFI_DNA-bd_CS.
IPR019548. CTF/NFI_DNA-bd_N.
IPR003619. MAD_homology1_Dwarfin-type.
[Graphical view]
PANTHERiPTHR11492. PTHR11492. 1 hit.
PfamiPF00859. CTF_NFI. 1 hit.
PF03165. MH1. 1 hit.
PF10524. NfI_DNAbd_pre-N. 1 hit.
[Graphical view]
SMARTiSM00523. DWA. 1 hit.
[Graphical view]
PROSITEiPS00349. CTF_NFI_1. 1 hit.
PS51080. CTF_NFI_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of NFIB as recurrent translocation partner gene of HMGIC in pleomorphic adenomas."
    Geurts J.M.W., Schoenmakers E.F.P.M., Roijer E., Astroem A.-K., Stenman G., van de Ven W.J.M.
    Oncogene 16:865-872(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "NFI-B3, a novel transcriptional repressor of the nuclear factor I family, is generated by alternative RNA processing."
    Liu Y., Bernard H.U., Apt D.
    J. Biol. Chem. 272:10739-10745(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
    Tissue: Foreskin.
  3. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
    Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
    Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Amygdala.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 5 AND 6).
    Tissue: Colon epithelium.
  6. "DNA sequence and analysis of human chromosome 9."
    Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L.
    , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
    Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Cervix.
  9. "Chromosomal localization of the four genes (NFIA, B, C, and X) for the human transcription factor nuclear factor I by FISH."
    Qian F., Kruse U., Lichter P., Sippel A.E.
    Genomics 28:66-73(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 20-283.
  10. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-264 AND SER-328, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  11. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-312; SER-328 AND SER-333, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  12. "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome."
    Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.
    J. Proteomics 96:253-262(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-292 AND SER-295, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.

Entry informationi

Entry nameiNFIB_HUMAN
AccessioniPrimary (citable) accession number: O00712
Secondary accession number(s): G3V1P1
, H7BYE8, O00166, Q12858, Q5VW29, Q63HM5, Q6ZNF9, Q96J45
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 1, 2001
Last sequence update: March 15, 2004
Last modified: April 29, 2015
This is version 138 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.