Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sodium-dependent phosphate transport protein 3

Gene

SLC17A2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

May be involved in actively transporting phosphate into cells via Na+ cotransport.By similarity

GO - Molecular functioni

GO - Biological processi

  • phosphate-containing compound metabolic process Source: ProtInc
  • phosphate ion transmembrane transport Source: GOC
  • sodium-dependent phosphate transport Source: GOC
  • sodium ion transmembrane transport Source: GOC
  • sodium ion transport Source: ProtInc
Complete GO annotation...

Keywords - Biological processi

Ion transport, Sodium transport, Symport, Transport

Keywords - Ligandi

Sodium

Protein family/group databases

TCDBi2.A.1.14.29. the major facilitator superfamily (mfs).

Names & Taxonomyi

Protein namesi
Recommended name:
Sodium-dependent phosphate transport protein 3
Alternative name(s):
Na(+)/PI cotransporter 3
Sodium/phosphate cotransporter 3
Solute carrier family 17 member 2
Gene namesi
Name:SLC17A2
Synonyms:NPT3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:10930. SLC17A2.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei98 – 11821HelicalSequence analysisAdd
BLAST
Transmembranei130 – 15021HelicalSequence analysisAdd
BLAST
Transmembranei183 – 20321HelicalSequence analysisAdd
BLAST
Transmembranei211 – 23121HelicalSequence analysisAdd
BLAST
Transmembranei273 – 29321HelicalSequence analysisAdd
BLAST
Transmembranei317 – 33721HelicalSequence analysisAdd
BLAST
Transmembranei350 – 36920HelicalSequence analysisAdd
BLAST
Transmembranei374 – 39623HelicalSequence analysisAdd
BLAST
Transmembranei415 – 43521HelicalSequence analysisAdd
BLAST

GO - Cellular componenti

  • integral component of plasma membrane Source: ProtInc
  • membrane Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

MalaCardsiSLC17A2.
PharmGKBiPA35821.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 439439Sodium-dependent phosphate transport protein 3PRO_0000220940Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi47 – 471N-linked (GlcNAc...)Sequence analysis
Glycosylationi56 – 561N-linked (GlcNAc...)Sequence analysis
Glycosylationi68 – 681N-linked (GlcNAc...)Sequence analysis
Glycosylationi69 – 691N-linked (GlcNAc...)Sequence analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiO00624.
PRIDEiO00624.

Expressioni

Tissue specificityi

Expressed in the small intestine, kidney, spleen and testis. Not detected in fetal brain, bone marrow, and mammary gland.1 Publication

Gene expression databases

BgeeiO00624.
CleanExiHS_SLC17A2.
ExpressionAtlasiO00624. baseline and differential.
GenevisibleiO00624. HS.

Organism-specific databases

HPAiHPA038270.

Interactioni

Protein-protein interaction databases

BioGridi115540. 51 interactions.
STRINGi9606.ENSP00000353677.

Structurei

3D structure databases

ProteinModelPortaliO00624.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG2532. Eukaryota.
ENOG410XPWC. LUCA.
GeneTreeiENSGT00760000119079.
HOGENOMiHOG000230813.
HOVERGENiHBG008834.
InParanoidiO00624.
KOiK12300.
OMAiFYIFGST.
OrthoDBiEOG7F7W8N.
PhylomeDBiO00624.
TreeFamiTF313535.

Family and domain databases

InterProiIPR011701. MFS.
IPR020846. MFS_dom.
[Graphical view]
PfamiPF07690. MFS_1. 1 hit.
[Graphical view]
SUPFAMiSSF103473. SSF103473. 2 hits.
PROSITEiPS50850. MFS. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O00624-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDGKPATRKG PDFCSLRYGL ALIMHFSNFT MITQRVSLSI AIIAMVNTTQ
60 70 80 90 100
QQGLSNASTE GPVADAFNNS SISIKEFDTK ASVYQWSPET QGIIFSSINY
110 120 130 140 150
GIILTLIPSG YLAGIFGAKK MLGAGLLISS LLTLFTPLAA DFGVILVIMV
160 170 180 190 200
RTVQGMAQGM AWTGQFTIWA KWAPPLERSK LTTIAGSGSA FGSFIILCVG
210 220 230 240 250
GLISQALSWP FIFYIFGSTG CVCCLLWFTV IYDDPMHHPC ISVREKEHIL
260 270 280 290 300
SSLAQQPSSP GRAVPIKAMV TCLPLWAIFL GFFSHFWLCT IILTYLPTYI
310 320 330 340 350
STLLHVNIRD SGVLSSLPFI AAASCTILGG QLADFLLSRN LLRLITVRKL
360 370 380 390 400
FSSLGLLLPS ICAVALPFVA SSYVITIILL ILIPGTSNLC DSGFIINTLD
410 420 430
IAPRYASFLM GISRGFGLIA GIISSTATGF LISQVGPVY
Length:439
Mass (Da):47,277
Last modified:September 19, 2006 - v2
Checksum:i67494C6E00EABB54
GO
Isoform 2 (identifier: O00624-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     355-439: GLLLPSICAV...FLISQVGPVY → DMQVSSWESQ...PASEDIKLQT

Show »
Length:436
Mass (Da):47,350
Checksum:iDF02F618E83A572F
GO
Isoform 3 (identifier: O00624-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     435-439: VGPVY → DFESGWRNVFFLSAAVNMFGLVFYLTFGQAELQDWAKERTLTRL

Note: No experimental confirmation available.
Show »
Length:478
Mass (Da):51,919
Checksum:i72E5FF8F3498D28D
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei355 – 43985GLLLP…VGPVY → DMQVSSWESQGDLGSSQESS LPLPLDSSSVRILSLVGGMS FSCLLQSTCLAWSFTSRLDK QNFKTGPKRGPLPASEDIKL QT in isoform 2. 2 PublicationsVSP_020638Add
BLAST
Alternative sequencei435 – 4395VGPVY → DFESGWRNVFFLSAAVNMFG LVFYLTFGQAELQDWAKERT LTRL in isoform 3. 1 PublicationVSP_054712

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U91328 Genomic DNA. Translation: AAB82085.1.
U90544 mRNA. Translation: AAB53422.1.
AL138726 Genomic DNA. Translation: CAC69101.1.
AL138726 Genomic DNA. Translation: CAI19542.1.
CH471087 Genomic DNA. Translation: EAW55498.1.
CH471087 Genomic DNA. Translation: EAW55499.1.
BC104822 mRNA. Translation: AAI04823.1.
BC112033 mRNA. Translation: AAI12034.1.
BC143323 mRNA. No translation available.
CCDSiCCDS4567.1. [O00624-2]
CCDS69060.1. [O00624-3]
RefSeqiNP_001273052.1. NM_001286123.1. [O00624-3]
NP_001273054.1. NM_001286125.1.
NP_005826.1. NM_005835.3. [O00624-2]
XP_005248841.1. XM_005248784.2. [O00624-3]
XP_006715012.1. XM_006714949.2. [O00624-3]
XP_011512529.1. XM_011514227.1. [O00624-1]
UniGeneiHs.591802.

Genome annotation databases

EnsembliENST00000265425; ENSP00000265425; ENSG00000112337. [O00624-1]
ENST00000360488; ENSP00000353677; ENSG00000112337. [O00624-2]
ENST00000377850; ENSP00000367081; ENSG00000112337. [O00624-3]
GeneIDi10246.
KEGGihsa:10246.
UCSCiuc003nfl.5. human. [O00624-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U91328 Genomic DNA. Translation: AAB82085.1.
U90544 mRNA. Translation: AAB53422.1.
AL138726 Genomic DNA. Translation: CAC69101.1.
AL138726 Genomic DNA. Translation: CAI19542.1.
CH471087 Genomic DNA. Translation: EAW55498.1.
CH471087 Genomic DNA. Translation: EAW55499.1.
BC104822 mRNA. Translation: AAI04823.1.
BC112033 mRNA. Translation: AAI12034.1.
BC143323 mRNA. No translation available.
CCDSiCCDS4567.1. [O00624-2]
CCDS69060.1. [O00624-3]
RefSeqiNP_001273052.1. NM_001286123.1. [O00624-3]
NP_001273054.1. NM_001286125.1.
NP_005826.1. NM_005835.3. [O00624-2]
XP_005248841.1. XM_005248784.2. [O00624-3]
XP_006715012.1. XM_006714949.2. [O00624-3]
XP_011512529.1. XM_011514227.1. [O00624-1]
UniGeneiHs.591802.

3D structure databases

ProteinModelPortaliO00624.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115540. 51 interactions.
STRINGi9606.ENSP00000353677.

Protein family/group databases

TCDBi2.A.1.14.29. the major facilitator superfamily (mfs).

Proteomic databases

PaxDbiO00624.
PRIDEiO00624.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000265425; ENSP00000265425; ENSG00000112337. [O00624-1]
ENST00000360488; ENSP00000353677; ENSG00000112337. [O00624-2]
ENST00000377850; ENSP00000367081; ENSG00000112337. [O00624-3]
GeneIDi10246.
KEGGihsa:10246.
UCSCiuc003nfl.5. human. [O00624-1]

Organism-specific databases

CTDi10246.
GeneCardsiSLC17A2.
H-InvDBHIX0122218.
HGNCiHGNC:10930. SLC17A2.
HPAiHPA038270.
MalaCardsiSLC17A2.
MIMi611049. gene.
neXtProtiNX_O00624.
PharmGKBiPA35821.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2532. Eukaryota.
ENOG410XPWC. LUCA.
GeneTreeiENSGT00760000119079.
HOGENOMiHOG000230813.
HOVERGENiHBG008834.
InParanoidiO00624.
KOiK12300.
OMAiFYIFGST.
OrthoDBiEOG7F7W8N.
PhylomeDBiO00624.
TreeFamiTF313535.

Miscellaneous databases

GenomeRNAii10246.
PROiO00624.
SOURCEiSearch...

Gene expression databases

BgeeiO00624.
CleanExiHS_SLC17A2.
ExpressionAtlasiO00624. baseline and differential.
GenevisibleiO00624. HS.

Family and domain databases

InterProiIPR011701. MFS.
IPR020846. MFS_dom.
[Graphical view]
PfamiPF07690. MFS_1. 1 hit.
[Graphical view]
SUPFAMiSSF103473. SSF103473. 2 hits.
PROSITEiPS50850. MFS. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 2), TISSUE SPECIFICITY.
  2. "The DNA sequence and analysis of human chromosome 6."
    Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
    Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
    Tissue: Liver.

Entry informationi

Entry nameiNPT3_HUMAN
AccessioniPrimary (citable) accession number: O00624
Secondary accession number(s): A6NK81
, A6NLD6, Q5TB84, Q76P85
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: September 19, 2006
Last modified: June 8, 2016
This is version 120 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.