Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Receptor-binding cancer antigen expressed on SiSo cells

Gene

EBAG9

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May participate in suppression of cell proliferation and induces apoptotic cell death through activation of interleukin-1-beta converting enzyme (ICE)-like proteases.3 Publications

Miscellaneous

May serve as a prognostic marker for cancers such as adenocarcinomas of the lung and breast cancers. It is present and overexpressed in many patients suffering from breast carcinomas, its level of expression correlates with tumor grade, suggesting that it may be involved in cancer immune escape. According to PubMed:12672804, it is however not directly a tumor-associated antigen, but it rather modulates surface expression of tumor-associated O-linked glycan Tn when it is overexpressed, suggesting that it contributes indirectly to the antigenicity of tumor cells.

Caution

It was initially reported to be a ligand for some putative receptor present on T-, B-, natural killer (NK) cells and various human cell lines. However, PubMed:12672804 showed that it does not bind any receptor.Curated

GO - Molecular functioni

  • peptidase activator activity involved in apoptotic process Source: UniProtKB

GO - Biological processi

  • regulation of cell growth Source: UniProtKB

Keywordsi

Biological processApoptosis

Names & Taxonomyi

Protein namesi
Recommended name:
Receptor-binding cancer antigen expressed on SiSo cells
Alternative name(s):
Cancer-associated surface antigen RCAS1
Estrogen receptor-binding fragment-associated gene 9 protein
Gene namesi
Name:EBAG9
Synonyms:RCAS1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 8

Organism-specific databases

EuPathDBiHostDB:ENSG00000147654.14
HGNCiHGNC:3123 EBAG9
MIMi605772 gene
neXtProtiNX_O00559

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 6ExtracellularSequence analysis6
Transmembranei7 – 27Helical; Signal-anchor for type III membrane proteinSequence analysisAdd BLAST21
Topological domaini28 – 213CytoplasmicSequence analysisAdd BLAST186

Keywords - Cellular componenti

Golgi apparatus, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi9166
OpenTargetsiENSG00000147654
PharmGKBiPA27581

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000971951 – 213Receptor-binding cancer antigen expressed on SiSo cellsAdd BLAST213

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei36PhosphoserineCombined sources1
Modified residuei41PhosphothreonineCombined sources1
Modified residuei94PhosphotyrosineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiO00559
MaxQBiO00559
PaxDbiO00559
PeptideAtlasiO00559
PRIDEiO00559

PTM databases

iPTMnetiO00559
PhosphoSitePlusiO00559
SwissPalmiO00559

Expressioni

Tissue specificityi

Widely expressed. Expressed in ovary, testis, prostate, thymus, muscle and heart, but not in small intestine, colon, lymph nodes, or peripherical blood lymphocytes. The protein is not detected in any of the above organs.

Inductioni

By estrogen.

Gene expression databases

BgeeiENSG00000147654
CleanExiHS_EBAG9
ExpressionAtlasiO00559 baseline and differential
GenevisibleiO00559 HS

Organism-specific databases

HPAiCAB072810
CAB072811
CAB072812
HPA021153
HPA021154

Interactioni

Subunit structurei

Homodimer.

Protein-protein interaction databases

BioGridi1146073 interactors.
IntActiO00559 3 interactors.
STRINGi9606.ENSP00000337675

Structurei

3D structure databases

ProteinModelPortaliO00559
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili163 – 211Sequence analysisAdd BLAST49

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi160 – 163Poly-Glu4

Domaini

The coiled coil domain is necessary for the homodimerization.

Keywords - Domaini

Coiled coil, Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IE57 Eukaryota
ENOG41101KS LUCA
GeneTreeiENSGT00390000004040
HOGENOMiHOG000073537
HOVERGENiHBG059707
InParanoidiO00559
KOiK22455
OMAiFRLFKIC
OrthoDBiEOG091G0L0F
PhylomeDBiO00559
TreeFamiTF326584

Family and domain databases

InterProiView protein in InterPro
IPR017025 Cancer-assoc_antigen_RCAS1
PANTHERiPTHR15208 PTHR15208, 1 hit
PIRSFiPIRSF034247 RCAS1, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O00559-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAITQFRLFK FCTCLATVFS FLKRLICRSG RGRKLSGDQI TLPTTVDYSS
60 70 80 90 100
VPKQTDVEEW TSWDEDAPTS VKIEGGNGNV ATQQNSLEQL EPDYFKDMTP
110 120 130 140 150
TIRKTQKIVI KKREPLNFGI PDGSTGFSSR LAATQDLPFI HQSSELGDLD
160 170 180 190 200
TWQENTNAWE EEEDAAWQAE EVLRQQKLAD REKRAAEQQR KKMEKEAQRL
210
MKKEQNKIGV KLS
Length:213
Mass (Da):24,377
Last modified:July 1, 1997 - v1
Checksum:iB115E741E23891C5
GO
Isoform 2 (identifier: O00559-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     174-174: R → RSRTNVCLLCSLLFHHPTPTSTPYINQSVKIERVSLGQWSYGKSKE

Show »
Length:258
Mass (Da):29,466
Checksum:i98ECCBCEA9BA1B9C
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti183K → E in AAH05249 (PubMed:15489334).Curated1
Sequence conflicti199R → Q in BAF83340 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_055503174R → RSRTNVCLLCSLLFHHPTPT STPYINQSVKIERVSLGQWS YGKSKE in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF006265 mRNA Translation: AAB61617.1
AB007619 mRNA Translation: BAA22572.1
AY653072 mRNA Translation: AAU85838.1
AK290651 mRNA Translation: BAF83340.1
CR456984 mRNA Translation: CAG33265.1
AC079061 Genomic DNA No translation available.
AP000427 Genomic DNA No translation available.
BC005249 mRNA Translation: AAH05249.1
BC017729 mRNA Translation: AAH17729.1
BC022506 mRNA Translation: AAH22506.1
CCDSiCCDS6313.1 [O00559-1]
RefSeqiNP_001265867.1, NM_001278938.1 [O00559-1]
NP_004206.1, NM_004215.4 [O00559-1]
NP_936056.1, NM_198120.2 [O00559-1]
XP_016869449.1, XM_017013960.1 [O00559-1]
UniGeneiHs.409368
Hs.632960

Genome annotation databases

EnsembliENST00000337573; ENSP00000337675; ENSG00000147654 [O00559-1]
ENST00000395785; ENSP00000379131; ENSG00000147654 [O00559-1]
ENST00000531677; ENSP00000432082; ENSG00000147654 [O00559-2]
ENST00000614147; ENSP00000477734; ENSG00000147654 [O00559-2]
ENST00000620557; ENSP00000477645; ENSG00000147654 [O00559-1]
GeneIDi9166
KEGGihsa:9166
UCSCiuc003ynf.5 human [O00559-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiRCAS1_HUMAN
AccessioniPrimary (citable) accession number: O00559
Secondary accession number(s): A8K3N6
, Q5Y8C7, Q6IB20, Q9BS76
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: July 1, 1997
Last modified: April 25, 2018
This is version 147 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome