Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Receptor-binding cancer antigen expressed on SiSo cells

Gene

EBAG9

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May participate in suppression of cell proliferation and induces apoptotic cell death through activation of interleukin-1-beta converting enzyme (ICE)-like proteases.3 Publications

GO - Molecular functioni

  • peptidase activator activity involved in apoptotic process Source: UniProtKB

GO - Biological processi

  • regulation of cell growth Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Apoptosis

Enzyme and pathway databases

BioCyciZFISH:ENSG00000147654-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Receptor-binding cancer antigen expressed on SiSo cells
Alternative name(s):
Cancer-associated surface antigen RCAS1
Estrogen receptor-binding fragment-associated gene 9 protein
Gene namesi
Name:EBAG9
Synonyms:RCAS1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 8

Organism-specific databases

HGNCiHGNC:3123. EBAG9.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 6ExtracellularSequence analysis6
Transmembranei7 – 27Helical; Signal-anchor for type III membrane proteinSequence analysisAdd BLAST21
Topological domaini28 – 213CytoplasmicSequence analysisAdd BLAST186

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Golgi apparatus, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi9166.
OpenTargetsiENSG00000147654.
PharmGKBiPA27581.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000971951 – 213Receptor-binding cancer antigen expressed on SiSo cellsAdd BLAST213

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei36PhosphoserineCombined sources1
Modified residuei41PhosphothreonineCombined sources1
Modified residuei94PhosphotyrosineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiO00559.
MaxQBiO00559.
PaxDbiO00559.
PeptideAtlasiO00559.
PRIDEiO00559.

PTM databases

iPTMnetiO00559.
PhosphoSitePlusiO00559.
SwissPalmiO00559.

Expressioni

Tissue specificityi

Widely expressed. Expressed in ovary, testis, prostate, thymus, muscle and heart, but not in small intestine, colon, lymph nodes, or peripherical blood lymphocytes. The protein is not detected in any of the above organs.

Inductioni

By estrogen.

Gene expression databases

BgeeiENSG00000147654.
CleanExiHS_EBAG9.
ExpressionAtlasiO00559. baseline and differential.
GenevisibleiO00559. HS.

Organism-specific databases

HPAiCAB072810.
CAB072811.
CAB072812.
HPA021153.
HPA021154.

Interactioni

Subunit structurei

Homodimer.

Protein-protein interaction databases

BioGridi114607. 3 interactors.
IntActiO00559. 3 interactors.
STRINGi9606.ENSP00000337675.

Structurei

3D structure databases

ProteinModelPortaliO00559.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili163 – 211Sequence analysisAdd BLAST49

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi160 – 163Poly-Glu4

Domaini

The coiled coil domain is necessary for the homodimerization.

Keywords - Domaini

Coiled coil, Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IE57. Eukaryota.
ENOG41101KS. LUCA.
GeneTreeiENSGT00390000004040.
HOGENOMiHOG000073537.
HOVERGENiHBG059707.
InParanoidiO00559.
OMAiFRLFKIC.
OrthoDBiEOG091G0L0F.
PhylomeDBiO00559.
TreeFamiTF326584.

Family and domain databases

InterProiIPR017025. Cancer-assoc_antigen_RCAS1.
[Graphical view]
PANTHERiPTHR15208. PTHR15208. 1 hit.
PIRSFiPIRSF034247. RCAS1. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O00559-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAITQFRLFK FCTCLATVFS FLKRLICRSG RGRKLSGDQI TLPTTVDYSS
60 70 80 90 100
VPKQTDVEEW TSWDEDAPTS VKIEGGNGNV ATQQNSLEQL EPDYFKDMTP
110 120 130 140 150
TIRKTQKIVI KKREPLNFGI PDGSTGFSSR LAATQDLPFI HQSSELGDLD
160 170 180 190 200
TWQENTNAWE EEEDAAWQAE EVLRQQKLAD REKRAAEQQR KKMEKEAQRL
210
MKKEQNKIGV KLS
Length:213
Mass (Da):24,377
Last modified:July 1, 1997 - v1
Checksum:iB115E741E23891C5
GO
Isoform 2 (identifier: O00559-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     174-174: R → RSRTNVCLLCSLLFHHPTPTSTPYINQSVKIERVSLGQWSYGKSKE

Show »
Length:258
Mass (Da):29,466
Checksum:i98ECCBCEA9BA1B9C
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti183K → E in AAH05249 (PubMed:15489334).Curated1
Sequence conflicti199R → Q in BAF83340 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_055503174R → RSRTNVCLLCSLLFHHPTPT STPYINQSVKIERVSLGQWS YGKSKE in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF006265 mRNA. Translation: AAB61617.1.
AB007619 mRNA. Translation: BAA22572.1.
AY653072 mRNA. Translation: AAU85838.1.
AK290651 mRNA. Translation: BAF83340.1.
CR456984 mRNA. Translation: CAG33265.1.
AC079061 Genomic DNA. No translation available.
AP000427 Genomic DNA. No translation available.
BC005249 mRNA. Translation: AAH05249.1.
BC017729 mRNA. Translation: AAH17729.1.
BC022506 mRNA. Translation: AAH22506.1.
CCDSiCCDS6313.1. [O00559-1]
RefSeqiNP_001265867.1. NM_001278938.1. [O00559-1]
NP_004206.1. NM_004215.4. [O00559-1]
NP_936056.1. NM_198120.2. [O00559-1]
XP_016869449.1. XM_017013960.1. [O00559-1]
UniGeneiHs.409368.
Hs.632960.

Genome annotation databases

EnsembliENST00000337573; ENSP00000337675; ENSG00000147654. [O00559-1]
ENST00000395785; ENSP00000379131; ENSG00000147654. [O00559-1]
ENST00000531677; ENSP00000432082; ENSG00000147654. [O00559-2]
ENST00000614147; ENSP00000477734; ENSG00000147654. [O00559-2]
ENST00000620557; ENSP00000477645; ENSG00000147654. [O00559-1]
GeneIDi9166.
KEGGihsa:9166.
UCSCiuc003ynf.5. human. [O00559-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF006265 mRNA. Translation: AAB61617.1.
AB007619 mRNA. Translation: BAA22572.1.
AY653072 mRNA. Translation: AAU85838.1.
AK290651 mRNA. Translation: BAF83340.1.
CR456984 mRNA. Translation: CAG33265.1.
AC079061 Genomic DNA. No translation available.
AP000427 Genomic DNA. No translation available.
BC005249 mRNA. Translation: AAH05249.1.
BC017729 mRNA. Translation: AAH17729.1.
BC022506 mRNA. Translation: AAH22506.1.
CCDSiCCDS6313.1. [O00559-1]
RefSeqiNP_001265867.1. NM_001278938.1. [O00559-1]
NP_004206.1. NM_004215.4. [O00559-1]
NP_936056.1. NM_198120.2. [O00559-1]
XP_016869449.1. XM_017013960.1. [O00559-1]
UniGeneiHs.409368.
Hs.632960.

3D structure databases

ProteinModelPortaliO00559.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114607. 3 interactors.
IntActiO00559. 3 interactors.
STRINGi9606.ENSP00000337675.

PTM databases

iPTMnetiO00559.
PhosphoSitePlusiO00559.
SwissPalmiO00559.

Proteomic databases

EPDiO00559.
MaxQBiO00559.
PaxDbiO00559.
PeptideAtlasiO00559.
PRIDEiO00559.

Protocols and materials databases

DNASUi9166.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000337573; ENSP00000337675; ENSG00000147654. [O00559-1]
ENST00000395785; ENSP00000379131; ENSG00000147654. [O00559-1]
ENST00000531677; ENSP00000432082; ENSG00000147654. [O00559-2]
ENST00000614147; ENSP00000477734; ENSG00000147654. [O00559-2]
ENST00000620557; ENSP00000477645; ENSG00000147654. [O00559-1]
GeneIDi9166.
KEGGihsa:9166.
UCSCiuc003ynf.5. human. [O00559-1]

Organism-specific databases

CTDi9166.
DisGeNETi9166.
GeneCardsiEBAG9.
HGNCiHGNC:3123. EBAG9.
HPAiCAB072810.
CAB072811.
CAB072812.
HPA021153.
HPA021154.
MIMi605772. gene.
neXtProtiNX_O00559.
OpenTargetsiENSG00000147654.
PharmGKBiPA27581.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IE57. Eukaryota.
ENOG41101KS. LUCA.
GeneTreeiENSGT00390000004040.
HOGENOMiHOG000073537.
HOVERGENiHBG059707.
InParanoidiO00559.
OMAiFRLFKIC.
OrthoDBiEOG091G0L0F.
PhylomeDBiO00559.
TreeFamiTF326584.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000147654-MONOMER.

Miscellaneous databases

ChiTaRSiEBAG9. human.
GeneWikiiEBAG9.
GenomeRNAii9166.
PROiO00559.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000147654.
CleanExiHS_EBAG9.
ExpressionAtlasiO00559. baseline and differential.
GenevisibleiO00559. HS.

Family and domain databases

InterProiIPR017025. Cancer-assoc_antigen_RCAS1.
[Graphical view]
PANTHERiPTHR15208. PTHR15208. 1 hit.
PIRSFiPIRSF034247. RCAS1. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiRCAS1_HUMAN
AccessioniPrimary (citable) accession number: O00559
Secondary accession number(s): A8K3N6
, Q5Y8C7, Q6IB20, Q9BS76
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: July 1, 1997
Last modified: November 2, 2016
This is version 143 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

May serve as a prognostic marker for cancers such as adenocarcinomas of the lung and breast cancers. It is present and overexpressed in many patients suffering from breast carcinomas, its level of expression correlates with tumor grade, suggesting that it may be involved in cancer immune escape. According to PubMed:12672804, it is however not directly a tumor-associated antigen, but it rather modulates surface expression of tumor-associated O-linked glycan Tn when it is overexpressed, suggesting that it contributes indirectly to the antigenicity of tumor cells.

Caution

It was initially reported to be a ligand for some putative receptor present on T-, B-, natural killer (NK) cells and various human cell lines. However, PubMed:12672804 showed that it does not bind any receptor.Curated

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.