O00555 (CAC1A_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 137.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Voltage-dependent P/Q-type calcium channel subunit alpha-1A Alternative name(s): Brain calcium channel I Short name=BI Calcium channel, L type, alpha-1 polypeptide isoform 4 Voltage-gated calcium channel subunit alpha Cav2.1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 2505 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. The isoform alpha-1A gives rise to P and/or Q-type calcium currents. P/Q-type calcium channels belong to the 'high-voltage activated' (HVA) group and are blocked by the funnel toxin (Ftx) and by the omega-agatoxin-IVA (omega-Aga-IVA). They are however insensitive to dihydropyridines (DHP), and omega-conotoxin-GVIA (omega-CTx-GVIA). |
| Subunit structure | Voltage-dependent calcium channels are multisubunit complexes, consisting of alpha-1, alpha-2, beta and delta subunits in a 1:1:1:1 ratio. The channel activity is directed by the pore-forming and voltage-sensitive alpha-1 subunit. In many cases, this subunit is sufficient to generate voltage-sensitive calcium channel activity. The auxiliary subunits beta and alpha-2/delta linked by a disulfide bridge regulate the channel activity. Interact (via C-terminal CDB motif) with CABP1 in the pre- and postsynaptic membranes. |
| Subcellular location | |
| Tissue specificity | Brain specific; mainly found in cerebellum, cerebral cortex, thalamus and hypothalamus. Expressed in the small cell lung carcinoma cell line SCC-9. No expression in heart, kidney, liver or muscle. Purkinje cells contain predominantly P-type VSCC, the Q-type being a prominent calcium current in cerebellar granule cells. Ref.7 |
| Domain | Each of the four internal repeats contains five hydrophobic transmembrane segments (S1, S2, S3, S5, S6) and one positively charged transmembrane segment (S4). S4 segments probably represent the voltage-sensor and are characterized by a series of positively charged amino acids at every third position. |
| Polymorphism | The poly-Gln region of CACNA1A is polymorphic: 6 to 17 repeats in the normal population, expanded to about 21 to 30 repeats in SCA6. Repeat expansion has been reported also in a EA2 family. |
| Involvement in disease | Spinocerebellar ataxia 6 (SCA6) [MIM:183086]: Spinocerebellar ataxia is a clinically and genetically heterogeneous group of cerebellar disorders. Patients show progressive incoordination of gait and often poor coordination of hands, speech and eye movements, due to degeneration of the cerebellum with variable involvement of the brainstem and spinal cord. SCA6 is an autosomal dominant cerebellar ataxia (ADCA), mainly caused by expansion of a CAG repeat in the coding region of CACNA1A. There seems to be a correlation between the repeat number and earlier onset of the disorder. Familial hemiplegic migraine 1 (FHM1) [MIM:141500]: A subtype of migraine with aura associated with ictal hemiparesis and, in some families, cerebellar ataxia and atrophy. Migraine is a disabling symptom complex of periodic headaches, usually temporal and unilateral. Headaches are often accompanied by irritability, nausea, vomiting and photobia, preceded by constriction of the cranial arteries. Migraine with aura is characterized by recurrent attacks of reversible neurological symptoms (aura) that precede or accompany the headache. Aura may include a combination of sensory disturbances, such as blurred vision, hallucinations, vertigo, numbness and difficulty in concentrating and speaking. Episodic ataxia 2 (EA2) [MIM:108500]: An autosomal dominant disorder characterized by acetozolamide-responsive attacks of ataxia, migraine-like symptoms, interictal nystagmus, and cerebellar atrophy. |
| Sequence similarities | Belongs to the calcium channel alpha-1 subunit (TC 1.A.1.11) family. CACNA1A subfamily. [View classification] |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| ABI1 | Q8IZP0 | 2 | EBI-766279,EBI-375446 | |
| AMIGO2 | Q86SJ2 | 2 | EBI-766279,EBI-3866830 | |
| ARHGAP22 | Q7Z5H3 | 2 | EBI-766279,EBI-3866859 | |
| BZRAP1 | O95153 | 2 | EBI-766279,EBI-5915931 | |
| CSNK2B | P67870 | 2 | EBI-766279,EBI-348169 | |
| DNAJB5 | O75953 | 2 | EBI-766279,EBI-5655937 | |
| GRN | P28799 | 2 | EBI-766279,EBI-747754 | |
| HIVEP1 | P15822 | 2 | EBI-766279,EBI-722264 | |
| LPHN1 | O94910 | 2 | EBI-766279,EBI-3389315 | |
| LTBP4 | Q8N2S1 | 2 | EBI-766279,EBI-947718 | |
| MATN2 | O00339 | 2 | EBI-766279,EBI-949020 | |
| MEGF6 | O75095 | 2 | EBI-766279,EBI-947597 | |
| MEGF8 | Q7Z7M0 | 2 | EBI-766279,EBI-947617 | |
| PUF60 | Q9UHX1 | 2 | EBI-766279,EBI-1053259 | |
| RBM12B | Q8IXT5 | 2 | EBI-766279,EBI-3044077 | |
| TUBB2B | Q9BVA1 | 2 | EBI-766279,EBI-355665 | |
| UQCRC2 | P22695 | 2 | EBI-766279,EBI-1051424 | |
| YLPM1 | P49750 | 2 | EBI-766279,EBI-712871 |
Alternative products
| This entry describes 8 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform 1 (identifier: O00555-1) Also known as: 1A-1; BI-1-GGCAG; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O00555-2) Also known as: 1A-2,BI-1; The sequence of this isoform differs from the canonical sequence as follows: 2262-2505: Missing. | ||||||
| Isoform 3 (identifier: O00555-3) Also known as: BI-1(V1); The sequence of this isoform differs from the canonical sequence as follows: 1844-1875: WGRMPYLDMYQMLRHMSPPLGLGKKCPARVAY → CGRIHYKDMYSLLRVISPPLGLGKKCPHRVAC 2262-2505: Missing. | ||||||
| Isoform 4 (identifier: O00555-4) Also known as: BI-1(V1)-GGCAG; The sequence of this isoform differs from the canonical sequence as follows: 1844-1875: WGRMPYLDMYQMLRHMSPPLGLGKKCPARVAY → CGRIHYKDMYSLLRVISPPLGLGKKCPHRVAC | ||||||
| Isoform 5 (identifier: O00555-5) Also known as: BI-1(V2); The sequence of this isoform differs from the canonical sequence as follows: 2103-2114: Missing. 2262-2505: Missing. | ||||||
| Isoform 6 (identifier: O00555-6) Also known as: BI-1(V2)-GGCAG; The sequence of this isoform differs from the canonical sequence as follows: 2103-2114: Missing. | ||||||
| Isoform 7 (identifier: O00555-7) Also known as: BI-1(V2,V3); The sequence of this isoform differs from the canonical sequence as follows: 2220-2240: HPPPPDKDRYAQERPDHGRAR → RFLCFFFPFFLPCLKTVGLGL 2241-2505: Missing. | ||||||
| Isoform 8 (identifier: O00555-8) The sequence of this isoform differs from the canonical sequence as follows: 419-419: Missing. 2314-2314: Q → QQQ |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 2505 | 2505 | Voltage-dependent P/Q-type calcium channel subunit alpha-1A | PRO_0000053916 | |||||||
Regions | |||||||||||
| Topological domain | 1 – 98 | 98 | Cytoplasmic Potential | ||||||||
| Transmembrane | 99 – 117 | 19 | Helical; Name=S1 of repeat I; Potential | ||||||||
| Topological domain | 118 – 135 | 18 | Extracellular Potential | ||||||||
| Transmembrane | 136 – 155 | 20 | Helical; Name=S2 of repeat I; Potential | ||||||||
| Topological domain | 156 – 167 | 12 | Cytoplasmic Potential | ||||||||
| Transmembrane | 168 – 185 | 18 | Helical; Name=S3 of repeat I; Potential | ||||||||
| Topological domain | 186 – 190 | 5 | Extracellular Potential | ||||||||
| Transmembrane | 191 – 209 | 19 | Helical; Name=S4 of repeat I; Potential | ||||||||
| Topological domain | 210 – 228 | 19 | Cytoplasmic Potential | ||||||||
| Transmembrane | 229 – 248 | 20 | Helical; Name=S5 of repeat I; Potential | ||||||||
| Topological domain | 249 – 335 | 87 | Extracellular Potential | ||||||||
| Transmembrane | 336 – 360 | 25 | Helical; Name=S6 of repeat I; Potential | ||||||||
| Topological domain | 361 – 487 | 127 | Cytoplasmic Potential | ||||||||
| Transmembrane | 488 – 506 | 19 | Helical; Name=S1 of repeat II; Potential | ||||||||
| Topological domain | 507 – 521 | 15 | Extracellular Potential | ||||||||
| Transmembrane | 522 – 541 | 20 | Helical; Name=S2 of repeat II; Potential | ||||||||
| Topological domain | 542 – 549 | 8 | Cytoplasmic Potential | ||||||||
| Transmembrane | 550 – 568 | 19 | Helical; Name=S3 of repeat II; Potential | ||||||||
| Topological domain | 569 – 578 | 10 | Extracellular Potential | ||||||||
| Transmembrane | 579 – 597 | 19 | Helical; Name=S4 of repeat II; Potential | ||||||||
| Topological domain | 598 – 616 | 19 | Cytoplasmic Potential | ||||||||
| Transmembrane | 617 – 636 | 20 | Helical; Name=S5 of repeat II; Potential | ||||||||
| Topological domain | 637 – 689 | 53 | Extracellular Potential | ||||||||
| Transmembrane | 690 – 714 | 25 | Helical; Name=S6 of repeat II; Potential | ||||||||
| Topological domain | 715 – 1242 | 528 | Cytoplasmic Potential | ||||||||
| Transmembrane | 1243 – 1261 | 19 | Helical; Name=S1 of repeat III; Potential | ||||||||
| Topological domain | 1262 – 1277 | 16 | Extracellular Potential | ||||||||
| Transmembrane | 1278 – 1297 | 20 | Helical; Name=S2 of repeat III; Potential | ||||||||
| Topological domain | 1298 – 1309 | 12 | Cytoplasmic Potential | ||||||||
| Transmembrane | 1310 – 1328 | 19 | Helical; Name=S3 of repeat III; Potential | ||||||||
| Topological domain | 1329 – 1339 | 11 | Extracellular Potential | ||||||||
| Transmembrane | 1340 – 1358 | 19 | Helical; Name=S4 of repeat III; Potential | ||||||||
| Topological domain | 1359 – 1377 | 19 | Cytoplasmic Potential | ||||||||
| Transmembrane | 1378 – 1397 | 20 | Helical; Name=S5 of repeat III; Potential | ||||||||
| Topological domain | 1398 – 1484 | 87 | Extracellular Potential | ||||||||
| Transmembrane | 1485 – 1509 | 25 | Helical; Name=S6 of repeat III; Potential | ||||||||
| Topological domain | 1510 – 1564 | 55 | Cytoplasmic Potential | ||||||||
| Transmembrane | 1565 – 1593 | 29 | Helical; Name=S1 of repeat IV; Potential | ||||||||
| Topological domain | 1594 – 1598 | 5 | Extracellular Potential | ||||||||
| Transmembrane | 1599 – 1618 | 20 | Helical; Name=S2 of repeat IV; Potential | ||||||||
| Topological domain | 1619 – 1626 | 8 | Cytoplasmic Potential | ||||||||
| Transmembrane | 1627 – 1645 | 19 | Helical; Name=S3 of repeat IV; Potential | ||||||||
| Topological domain | 1646 – 1652 | 7 | Extracellular Potential | ||||||||
| Transmembrane | 1653 – 1671 | 19 | Helical; Name=S4 of repeat IV; Potential | ||||||||
| Topological domain | 1672 – 1690 | 19 | Cytoplasmic Potential | ||||||||
| Transmembrane | 1691 – 1710 | 20 | Helical; Name=S5 of repeat IV; Potential | ||||||||
| Topological domain | 1711 – 1782 | 72 | Extracellular Potential | ||||||||
| Transmembrane | 1783 – 1807 | 25 | Helical; Name=S6 of repeat IV; Potential | ||||||||
| Topological domain | 1808 – 2505 | 698 | Cytoplasmic Potential | ||||||||
| Repeat | 85 – 363 | 279 | I | ||||||||
| Repeat | 473 – 717 | 245 | II | ||||||||
| Repeat | 1231 – 1514 | 284 | III | ||||||||
| Repeat | 1551 – 1814 | 264 | IV | ||||||||
| Calcium binding | 1840 – 1851 | 12 | By similarity | ||||||||
| Region | 383 – 400 | 18 | Binding to the beta subunit By similarity | ||||||||
| Compositional bias | 13 – 18 | 6 | Poly-Gly | ||||||||
| Compositional bias | 727 – 732 | 6 | Poly-Glu | ||||||||
| Compositional bias | 1002 – 1007 | 6 | Poly-Arg | ||||||||
| Compositional bias | 1204 – 1207 | 4 | Poly-Glu | ||||||||
| Compositional bias | 2211 – 2220 | 10 | Poly-His | ||||||||
| Compositional bias | 2221 – 2224 | 4 | Poly-Pro | ||||||||
| Compositional bias | 2314 – 2324 | 11 | Poly-Gln | ||||||||
Sites | |||||||||||
| Site | 318 | 1 | Calcium ion selectivity and permeability By similarity | ||||||||
| Site | 668 | 1 | Calcium ion selectivity and permeability By similarity | ||||||||
| Site | 1460 | 1 | Calcium ion selectivity and permeability By similarity | ||||||||
| Site | 1649 | 1 | Binds to omega-Aga-IVA By similarity | ||||||||
| Site | 1756 | 1 | Calcium ion selectivity and permeability By similarity | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 750 | 1 | Phosphoserine By similarity | ||||||||
| Modified residue | 1822 | 1 | Phosphoserine; by PKA Potential | ||||||||
| Modified residue | 2030 | 1 | Phosphoserine By similarity | ||||||||
| Modified residue | 2076 | 1 | Phosphotyrosine By similarity | ||||||||
| Modified residue | 2269 | 1 | Phosphoserine By similarity | ||||||||
| Modified residue | 2378 | 1 | Phosphoserine By similarity | ||||||||
| Glycosylation | 283 | 1 | N-linked (GlcNAc...) Potential | ||||||||
Natural variations | |||||||||||
| Alternative sequence | 419 | 1 | Missing in isoform 8. | VSP_046165 | |||||||
| Alternative sequence | 1844 – 1875 | 32 | WGRMP…ARVAY → CGRIHYKDMYSLLRVISPPL GLGKKCPHRVAC in isoform 3 and isoform 4. | VSP_000871 | |||||||
| Alternative sequence | 2103 – 2114 | 12 | Missing in isoform 5 and isoform 6. | VSP_000872 | |||||||
| Alternative sequence | 2220 – 2240 | 21 | HPPPP…HGRAR → RFLCFFFPFFLPCLKTVGLG L in isoform 7. | VSP_000873 | |||||||
| Alternative sequence | 2241 – 2505 | 265 | Missing in isoform 7. | VSP_000874 | |||||||
| Alternative sequence | 2262 – 2505 | 244 | Missing in isoform 2, isoform 3 and isoform 5. | VSP_000875 | |||||||
| Alternative sequence | 2314 | 1 | Q → QQQ in isoform 8. | VSP_046166 | |||||||
| Natural variant | 21 | 1 | A → V. Corresponds to variant rs15999 [ dbSNP | Ensembl ]. | VAR_014456 | |||||||
| Natural variant | 192 | 1 | R → Q in FHM1. Ref.2 Corresponds to variant rs121908211 [ dbSNP | Ensembl ]. | VAR_001491 | |||||||
| Natural variant | 195 | 1 | R → K in FHM1. Ref.17 Corresponds to variant rs121908222 [ dbSNP | Ensembl ]. | VAR_043820 | |||||||
| Natural variant | 218 | 1 | S → L in FHM1. Ref.15 Corresponds to variant rs121908225 [ dbSNP | Ensembl ]. | VAR_043821 | |||||||
| Natural variant | 248 | 1 | Y → C in EA2. Ref.27 Corresponds to variant rs121908238 [ dbSNP | Ensembl ]. | VAR_063683 | |||||||
| Natural variant | 253 | 1 | H → Y in EA2. Ref.19 Corresponds to variant rs121908228 [ dbSNP | Ensembl ]. | VAR_043822 | |||||||
| Natural variant | 256 | 1 | C → R in EA2. Ref.22 Corresponds to variant rs121908231 [ dbSNP | Ensembl ]. | VAR_043823 | |||||||
| Natural variant | 287 | 1 | C → Y in EA2. Ref.23 Corresponds to variant rs121908236 [ dbSNP | Ensembl ]. | VAR_043824 | |||||||
| Natural variant | 293 | 1 | G → R in EA2 and SCA6. Ref.11 Ref.23 Corresponds to variant rs121908215 [ dbSNP | Ensembl ]. | VAR_043825 | |||||||
| Natural variant | 388 | 1 | E → K in EA2. Ref.32 | VAR_067342 | |||||||
| Natural variant | 389 | 1 | L → F in EA2. Ref.31 Corresponds to variant rs121908239 [ dbSNP | Ensembl ]. | VAR_063684 | |||||||
| Natural variant | 405 | 1 | A → T in SCA6. Ref.30 Corresponds to variant rs1219082456 [ dbSNP | Ensembl ]. | VAR_063685 | |||||||
| Natural variant | 454 | 1 | A → T. Ref.2 Corresponds to variant rs41276886 [ dbSNP | Ensembl ]. | VAR_063686 | |||||||
| Natural variant | 501 | 1 | T → M in EA2. Ref.31 Corresponds to variant rs121908240 [ dbSNP | Ensembl ]. | VAR_063687 | |||||||
| Natural variant | 583 | 1 | R → Q in FHM1. Ref.17 Corresponds to variant rs121908217 [ dbSNP | Ensembl ]. | VAR_043826 | |||||||
| Natural variant | 638 | 1 | G → D in EA2; reduces P/Q current densities. Ref.28 Corresponds to variant rs121908246 [ dbSNP | Ensembl ]. | VAR_063688 | |||||||
| Natural variant | 666 | 1 | T → M in FHM1 and EA2. Ref.2 Ref.17 Ref.23 Corresponds to variant rs121908212 [ dbSNP | Ensembl ]. | VAR_001492 | |||||||
| Natural variant | 714 | 1 | V → A in FHM1. Ref.2 Corresponds to variant rs121908213 [ dbSNP | Ensembl ]. | VAR_001493 | |||||||
| Natural variant | 715 | 1 | D → E in FHM1. Ref.17 Corresponds to variant rs121908218 [ dbSNP | Ensembl ]. | VAR_043827 | |||||||
| Natural variant | 732 | 1 | E → A. Corresponds to variant rs16019 [ dbSNP | Ensembl ]. | VAR_059221 | |||||||
| Natural variant | 798 | 1 | M → T in EA2. Ref.31 Corresponds to variant rs121908241 [ dbSNP | Ensembl ]. | VAR_063689 | |||||||
| Natural variant | 897 | 1 | P → R in EA2. Ref.31 Corresponds to variant rs121908242 [ dbSNP | Ensembl ]. | VAR_063690 | |||||||
| Natural variant | 914 | 1 | P → S. Corresponds to variant rs16020 [ dbSNP | Ensembl ]. | VAR_014458 | |||||||
| Natural variant | 918 | 1 | E → D. Ref.24 Ref.29 Corresponds to variant rs16022 [ dbSNP | Ensembl ]. | VAR_014459 | |||||||
| Natural variant | 993 | 1 | E → V. Ref.14 Ref.24 Ref.29 Corresponds to variant rs16023 [ dbSNP | Ensembl ]. | VAR_043828 | |||||||
| Natural variant | 1015 | 1 | E → K. Corresponds to variant rs16024 [ dbSNP | Ensembl ]. | VAR_014461 | |||||||
| Natural variant | 1105 | 1 | G → S. Ref.4 Ref.24 Corresponds to variant rs16027 [ dbSNP | Ensembl ]. | VAR_014462 | |||||||
| Natural variant | 1173 | 1 | P → L. Corresponds to variant rs16028 [ dbSNP | Ensembl ]. | VAR_059222 | |||||||
| Natural variant | 1335 | 1 | K → E in FHM1. Ref.17 Corresponds to variant rs121908223 [ dbSNP | Ensembl ]. | VAR_043829 | |||||||
| Natural variant | 1346 | 1 | R → Q in FHM1; with progressive cerebellar ataxia. Ref.21 Ref.26 Corresponds to variant rs121908230 [ dbSNP | Ensembl ]. | VAR_043830 | |||||||
| Natural variant | 1384 | 1 | Y → C in FHM1. Ref.17 Corresponds to variant rs121908219 [ dbSNP | Ensembl ]. | VAR_043831 | |||||||
| Natural variant | 1403 | 1 | F → C in EA2; loss of function. Ref.18 Corresponds to variant rs121908227 [ dbSNP | Ensembl ]. | VAR_043832 | |||||||
| Natural variant | 1456 | 1 | V → L in FHM1. Ref.14 Corresponds to variant rs121908237 [ dbSNP | Ensembl ]. | VAR_043833 | |||||||
| Natural variant | 1482 | 1 | G → R in EA2. Ref.22 Corresponds to variant rs121908232 [ dbSNP | Ensembl ]. | VAR_043834 | |||||||
| Natural variant | 1490 | 1 | F → S in EA2. Ref.22 Corresponds to variant rs121908233 [ dbSNP | Ensembl ]. | VAR_043835 | |||||||
| Natural variant | 1493 | 1 | V → I in EA2. Ref.22 Corresponds to variant rs121908234 [ dbSNP | Ensembl ]. | VAR_043836 | |||||||
| Natural variant | 1661 | 1 | R → H in EA2. Ref.13 Corresponds to variant rs121908216 [ dbSNP | Ensembl ]. | VAR_043837 | |||||||
| Natural variant | 1664 | 1 | R → Q in SCA6. Ref.25 Corresponds to variant rs121908247 [ dbSNP | Ensembl ]. | VAR_063691 | |||||||
| Natural variant | 1667 | 1 | R → W in FHM1. Ref.17 Corresponds to variant rs121908220 [ dbSNP | Ensembl ]. | VAR_043838 | |||||||
| Natural variant | 1679 | 1 | R → C in EA2. Ref.31 Corresponds to variant rs121908243 [ dbSNP | Ensembl ]. | VAR_063692 | |||||||
| Natural variant | 1683 | 1 | W → R in FHM1. Ref.17 Corresponds to variant rs121908221 [ dbSNP | Ensembl ]. | VAR_043839 | |||||||
| Natural variant | 1695 | 1 | V → I in FHM1. Ref.17 Corresponds to variant rs121908224 [ dbSNP | Ensembl ]. | VAR_063706 | |||||||
| Natural variant | 1736 | 1 | H → L in EA2. Ref.20 Corresponds to variant rs121908229 [ dbSNP | Ensembl ]. | VAR_043840 | |||||||
| Natural variant | 1756 | 1 | E → K in EA2. Ref.16 Corresponds to variant rs121908226 [ dbSNP | Ensembl ]. | VAR_043841 | |||||||
| Natural variant | 1810 | 1 | I → L in FHM1. Ref.2 Corresponds to variant rs121908214 [ dbSNP | Ensembl ]. | VAR_001494 | |||||||
| Natural variant | 1869 | 1 | C → R in EA2. Ref.31 Corresponds to variant rs121908244 [ dbSNP | Ensembl ]. | VAR_063693 | |||||||
| Natural variant | 2135 | 1 | R → C in EA2. Ref.22 Corresponds to variant rs121908235 [ dbSNP | Ensembl ]. | VAR_043842 | |||||||
| Natural variant | 2394 | 1 | P → S. Corresponds to variant rs16056 [ dbSNP | Ensembl ]. | VAR_014463 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 725 | 1 | K → KVEA in AAB61613. Ref.1 | ||||||||
| Sequence conflict | 725 | 1 | K → KVEA in AAB61612. Ref.1 | ||||||||
| Sequence conflict | 896 | 1 | G → D in CAA68172. Ref.2 | ||||||||
| Sequence conflict | 896 | 1 | G → D in BAA94766. Ref.4 | ||||||||
| Sequence conflict | 953 | 1 | D → N in BAA94766. Ref.4 | ||||||||
| Sequence conflict | 964 | 1 | R → S in BAA94766. Ref.4 | ||||||||
| Sequence conflict | 1207 | 1 | E → EE in CAA68172. Ref.2 | ||||||||
| Sequence conflict | 1313 – 1315 | 3 | WNI → ILP in AAB49674. Ref.3 | ||||||||
| Sequence conflict | 1313 – 1315 | 3 | WNI → ILP in AAB49675. Ref.3 | ||||||||
| Sequence conflict | 1313 – 1315 | 3 | WNI → ILP in AAB49676. Ref.3 | ||||||||
| Sequence conflict | 1313 – 1315 | 3 | WNI → ILP in AAB49677. Ref.3 | ||||||||
| Sequence conflict | 1313 – 1315 | 3 | WNI → ILP in AAB49678. Ref.3 | ||||||||
| Sequence conflict | 1459 | 1 | G → A in CAA68172. Ref.2 | ||||||||
| Sequence conflict | 1604 | 1 | V → A in CAA68172. Ref.2 | ||||||||
| Sequence conflict | 1617 | 1 | V → A in CAA68172. Ref.2 | ||||||||
| Sequence conflict | 1651 | 1 | G → GNP in AAB61613. Ref.1 | ||||||||
| Sequence conflict | 1651 | 1 | G → GNP in AAB61612. Ref.1 | ||||||||
| Sequence conflict | 1693 | 1 | P → A in AAB33068. Ref.6 | ||||||||
| Sequence conflict | 2038 | 1 | E → G in U06702. Ref.8 | ||||||||
| Sequence conflict | 2314 | 1 | Q → QQ in AAB49676. Ref.3 | ||||||||
Secondary structure | |||||||||||
Helix Strand Turn | |||||||||||
| Helix | 1956 – 1970 | 15 | |||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Structural elements in domain IV that influence biophysical and pharmacological properties of human alpha1A-containing high-voltage-activated calcium channels." Hans M., Urrutia A., Deal C., Brust P.F., Stauderman K., Ellis S.B., Harpold M.M., Johnson E.C., Williams M.E. Biophys. J. 76:1384-1400(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). Tissue: Neuron. |
| [2] | "Familial hemiplegic migraine and episodic ataxia type-2 are caused by mutations in the Ca2+ channel gene CACNL1A4." Ophoff R.A., Terwindt G.M., Vergouwe M.N., van Eijk R., Oefner P.J., Hoffman S.M.G., Lamerdin J.E., Mohrenweiser H.W., Bulman D.E., Ferrari M., Haan J., Lindhout D., van Ommen G.-J.B., Hofker M.H., Ferrari M.D., Frants R.R. Cell 87:543-552(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 3), VARIANTS FHM1 GLN-192; MET-666; ALA-714 AND LEU-1810, VARIANT THR-454, INVOLVEMENT IN EA2. Tissue: Cerebellum. |
| [3] | "Autosomal dominant cerebellar ataxia (SCA6) associated with small polyglutamine expansions in the alpha 1A-voltage-dependent calcium channel." Zhuchenko O., Bailey J., Bonnen P.E., Ashizawa T., Stockton D.W., Amos C., Dobyns W.B., Subramony S.H., Zoghbi H.Y., Lee C.C. Nat. Genet. 15:62-69(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), NUCLEOTIDE SEQUENCE [MRNA] OF 1313-2505 (ISOFORMS 1; 2; 3; 6 AND 7), ALTERNATIVE SPLICING, INVOLVEMENT IN SCA6. Tissue: Brain. |
| [4] | "Spinocerebellar ataxia type 6 mutation alters P-type calcium channel function." Toru S., Murakoshi T., Ishikawa K., Saegusa H., Fujigasaki H., Uchihara T., Nagayama S., Osanai M., Mizusawa H., Tanabe T. J. Biol. Chem. 275:10893-10898(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 8), VARIANT SER-1105. Tissue: Cerebellum. |
| [5] | "The DNA sequence and biology of human chromosome 19." Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V. Lucas S.M.Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "Expression and antibody inhibition of P-type calcium channels in human small-cell lung carcinoma cells." Barry E.L.R., Viglione M.P., Kim Y.I., Froehner S.C. J. Neurosci. 15:274-283(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1693-1807. Tissue: Lung carcinoma. |
| [7] | "Molecular diversity of neuronal-type calcium channels identified in small cell lung carcinoma." Oguro-Okano M., Griesmann G.E., Wieben E.D., Slaymaker S.J., Snutch T.P., Lennon V.A. Mayo Clin. Proc. 67:1150-1159(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1702-1822, TISSUE SPECIFICITY. Tissue: Lung carcinoma. |
| [8] | "Characterization of cDNA clones containing CCA trinucleotide repeats derived from human brain." Margolis R.L., Breschel T.S., Li S.H., Kidwai A.S., Antonarakis S.E., McInnis M.G., Ross C.A. Somat. Cell Mol. Genet. 21:279-284(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 2038-2258 (ISOFORMS 1/2/3/4). Tissue: Frontal cortex. |
| [9] | "Differential modulation of Ca(v)2.1 channels by calmodulin and Ca2+-binding protein 1." Lee A., Westenbroek R.E., Haeseleer F., Palczewski K., Scheuer T., Catterall W.A. Nat. Neurosci. 5:210-217(2002) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CABP1. |
| [10] | "Crystal structure of the CaV2 IQ domain in complex with Ca2+/calmodulin: high-resolution mechanistic implications for channel regulation by Ca2+." Mori M.X., Vander Kooi C.W., Leahy D.J., Yue D.T. Structure 16:607-620(2008) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.55 ANGSTROMS) OF 1955-1975. |
| [11] | "Progressive ataxia due to a missense mutation in a calcium-channel gene." Yue Q., Jen J.C., Nelson S.F., Baloh R.W. Am. J. Hum. Genet. 61:1078-1087(1997) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT SCA6 ARG-293. |
| [12] | "Episodic ataxia type 2 (EA2) and spinocerebellar ataxia type 6 (SCA6) due to CAG repeat expansion in the CACNA1A gene on chromosome 19p." Jodice C., Mantuano E., Veneziano L., Trettel F., Sabbadini G., Calandriello L., Francia A., Spadaro M., Pierelli F., Salvi F., Ophoff R.A., Frants R.R., Frontali M. Hum. Mol. Genet. 6:1973-1978(1997) [PubMed] [Europe PMC] [Abstract] Cited for: POLYMORPHISM, INVOLVEMENT IN SCA6 AND EA2. |
| [13] | "Detection of a novel missense mutation and second recurrent mutation in the CACNA1A gene in individuals with EA-2 and FHM." Friend K.L., Crimmins D., Phan T.G., Sue C.M., Colley A., Fung V.S., Morris J.G., Sutherland G.R., Richards R.I. Hum. Genet. 105:261-265(1999) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT EA2 HIS-1661. |
| [14] | "Genetic heterogeneity in Italian families with familial hemiplegic migraine." Carrera P., Piatti M., Stenirri S., Grimaldi L.M., Marchioni E., Curcio M., Righetti P.G., Ferrari M., Gelfi C. Neurology 53:26-33(1999) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT VAL-993, VARIANT FHM1 LEU-1456. |
| [15] | "Delayed cerebral edema and fatal coma after minor head trauma: role of the CACNA1A calcium channel subunit gene and relationship with familial hemiplegic migraine." Kors E.E., Terwindt G.M., Vermeulen F.L., Fitzsimons R.B., Jardine P.E., Heywood P., Love S., van den Maagdenberg A.M., Haan J., Frants R.R., Ferrari M.D. Ann. Neurol. 49:753-760(2001) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT FHM1 LEU-218. |
| [16] | "Missense CACNA1A mutation causing episodic ataxia type 2." Denier C., Ducros A., Durr A., Eymard B., Chassande B., Tournier-Lasserve E. Arch. Neurol. 58:292-295(2001) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT EA2 LYS-1756. |
| [17] | "The clinical spectrum of familial hemiplegic migraine associated with mutations in a neuronal calcium channel." Ducros A., Denier C., Joutel A., Cecillon M., Lescoat C., Vahedi K., Darcel F., Vicaut E., Bousser M.G., Tournier-Lasserve E. N. Engl. J. Med. 345:17-24(2001) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS FHM1 LYS-195; GLN-583; MET-666; GLU-715; GLU-1335; CYS-1384; TRP-1667; ARG-1683 AND ILE-1695. |
| [18] | "Loss-of-function EA2 mutations are associated with impaired neuromuscular transmission." Jen J., Wan J., Graves M., Yu H., Mock A.F., Coulin C.J., Kim G., Yue Q., Papazian D.M., Baloh R.W. Neurology 57:1843-1848(2001) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT EA2 CYS-1403, CHARACTERIZATION OF VARIANT EA2 CYS-1403. |
| [19] | "Episodic ataxia type 2. Three novel truncating mutations and one novel missense mutation in the CACNA1A gene." van den Maagdenberg A.M., Kors E.E., Brunt E.R., van Paesschen W., Pascual J., Ravine D., Keeling S., Vanmolkot K.R., Vermeulen F.L., Terwindt G.M., Haan J., Frants R.R., Ferrari M.D. J. Neurol. 249:1515-1519(2002) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT EA2 TYR-253. |
| [20] | "Functional implications of a novel EA2 mutation in the P/Q-type calcium channel." Spacey S.D., Hildebrand M.E., Materek L.A., Bird T.D., Snutch T.P. Ann. Neurol. 56:213-220(2004) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT EA2 LEU-1736. |
| [21] | "A novel R1347Q mutation in the predicted voltage sensor segment of the P/Q-type calcium-channel alpha-subunit in a family with progressive cerebellar ataxia and hemiplegic migraine." Alonso I., Barros J., Tuna A., Seixas A., Coutinho P., Sequeiros J., Silveira I. Clin. Genet. 65:70-72(2004) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT FHM1 GLN-1346. |
| [22] | "Clusters of non-truncating mutations of P/Q type Ca2+ channel subunit Ca(v)2.1 causing episodic ataxia 2." Mantuano E., Veneziano L., Spadaro M., Giunti P., Guida S., Leggio M.G., Verriello L., Wood N., Jodice C., Frontali M. J. Med. Genet. 41:E82-E82(2004) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS EA2 ARG-256; ARG-1482; SER-1490; ILE-1493 AND CYS-2135. |
| [23] | "Clinical spectrum of episodic ataxia type 2." Jen J., Kim G.W., Baloh R.W. Neurology 62:17-22(2004) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS EA2 TYR-287; ARG-293 AND MET-666. |
| [24] | "Migrainous vertigo: mutation analysis of the candidate genes CACNA1A, ATP1A2, SCN1A, and CACNB4." von Brevern M., Ta N., Shankar A., Wiste A., Siegel A., Radtke A., Sander T., Escayg A. Headache 46:1136-1141(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS ASP-918; VAL-993 AND SER-1105. |
| [25] | "Early onset, non fluctuating spinocerebellar ataxia and a novel missense mutation in CACNA1A gene." Tonelli A., D'Angelo M.G., Salati R., Villa L., Germinasi C., Frattini T., Meola G., Turconi A.C., Bresolin N., Bassi M.T. J. Neurol. Sci. 241:13-17(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT SCA6 GLN-1664. |
| [26] | "CACNA1A R1347Q: a frequent recurrent mutation in hemiplegic migraine." Stam A.H., Vanmolkot K.R., Kremer H.P., Gartner J., Brown J., Leshinsky-Silver E., Gilad R., Kors E.E., Frankhuizen W.S., Ginjaar H.B., Haan J., Frants R.R., Ferrari M.D., van den Maagdenberg A.M., Terwindt G.M. Clin. Genet. 74:481-485(2008) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT FHM1 GLN-1346. |
| [27] | "Episodic ataxia type 2 showing ictal hyperhidrosis with hypothermia and interictal chronic diarrhea due to a novel CACNA1A mutation." Zafeiriou D.I., Lehmann-Horn F., Vargiami E., Teflioudi E., Ververi A., Jurkat-Rott K. Eur. J. Paediatr. Neurol. 13:191-193(2009) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT EA2 CYS-248. |
| [28] | "Late-onset episodic ataxia type 2 associated with a novel loss-of-function mutation in the CACNA1A gene." Cuenca-Leon E., Banchs I., Serra S.A., Latorre P., Fernandez-Castillo N., Corominas R., Valverde M.A., Volpini V., Fernandez-Fernandez J.M., Macaya A., Cormand B. J. Neurol. Sci. 280:10-14(2009) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT EA2 ASP-638, CHARACTERIZATION OF VARIANT EA2 ASP-638. |
| [29] | "The interplay of two single nucleotide polymorphisms in the CACNA1A gene may contribute to migraine susceptibility." D'Onofrio M., Ambrosini A., Di Mambro A., Arisi I., Santorelli F.M., Grieco G.S., Nicoletti F., Nappi G., Pierelli F., Schoenen J., Buzzi M.G. Neurosci. Lett. 453:12-15(2009) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS ASP-918 AND VAL-993. |
| [30] | "A wide spectrum of clinical, neurophysiological and neuroradiological abnormalities in a family with a novel CACNA1A mutation." Romaniello R., Zucca C., Tonelli A., Bonato S., Baschirotto C., Zanotta N., Epifanio R., Righini A., Bresolin N., Bassi M.T., Borgatti R. J. Neurol. Neurosurg. Psych. 81:840-843(2010) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT SCA6 THR-405. |
| [31] | "Identification of novel and recurrent CACNA1A gene mutations in fifteen patients with episodic ataxia type 2." Mantuano E., Romano S., Veneziano L., Gellera C., Castellotti B., Caimi S., Testa D., Estienne M., Zorzi G., Bugiani M., Rajabally Y.A., Barcina M.J., Servidei S., Panico A., Frontali M., Mariotti C. J. Neurol. Sci. 291:30-36(2010) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS EA2 PHE-389; MET-501; THR-798; ARG-897; CYS-1679 AND ARG-1869. |
| [32] | "New mutation of CACNA1A gene in episodic ataxia type 2." Nikaido K., Tachi N., Ohya K., Wada T., Tsutsumi H. Pediatr. Int. 53:415-416(2011) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT EA2 LYS-388. |
| + | Additional computationally mapped references. |
Web resources
| GeneReviews |
| Calcium channel, voltage-dependent, P/Q type, alpha 1A subunit (CACNA1A) Leiden Open Variation Database (LOVD) |
| Familial hemiplegic migraine (FHM) variation database, calcium channel, voltage-dependent, P/Q type, alpha 1A subunit (CACNA1A) Leiden Open Variation Database (LOVD) |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF004883 mRNA. Translation: AAB61612.1. AF004884 mRNA. Translation: AAB61613.1. X99897 mRNA. Translation: CAA68172.1. Z80114 Genomic DNA. No translation available. Z80115 Genomic DNA. No translation available. U79663 mRNA. Translation: AAB49674.1. U79664 mRNA. Translation: AAB49675.1. U79665 mRNA. Translation: AAB49676.1. U79666 mRNA. Translation: AAB64179.1. U79667 mRNA. Translation: AAB49677.1. U79668 mRNA. Translation: AAB49678.1. AB035727 mRNA. Translation: BAA94766.2. AC005305 Genomic DNA. Translation: AAC26839.1. AC005513 Genomic DNA. No translation available. AC008540 Genomic DNA. No translation available. AC011446 Genomic DNA. No translation available. AC022436 Genomic DNA. No translation available. AC026805 Genomic DNA. No translation available. AC093062 Genomic DNA. No translation available. AC098781 Genomic DNA. No translation available. AC124224 Genomic DNA. No translation available. S76537 mRNA. Translation: AAB33068.1. U06702 mRNA. No translation available. | ||||||||||||
| IPI | IPI00012136. IPI00217497. IPI00217498. IPI00217499. IPI00291347. IPI00397553. IPI00397554. | ||||||||||||
| RefSeq | NP_000059.3. NM_000068.3. NP_001120693.1. NM_001127221.1. NP_001120694.1. NM_001127222.1. NP_001167551.1. NM_001174080.1. NP_075461.2. NM_023035.2. | ||||||||||||
| UniGene | Hs.501632. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | O00555. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | O00555. 89 interactions. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | O00555. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | O00555. | ||||||||||||
| PRIDE | O00555. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 773. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000325084; ENSP00000317661; ENSG00000141837. ENST00000360228; ENSP00000353362; ENSG00000141837. | ||||||||||||
| GeneID | 773. | ||||||||||||
| KEGG | hsa:773. | ||||||||||||
| UCSC | uc002mwy.3. human. uc010dzc.2. human. uc010dze.2. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 773. | ||||||||||||
| GeneCards | GC19M013317. | ||||||||||||
| HGNC | HGNC:1388. CACNA1A. | ||||||||||||
| MIM | 108500. phenotype. 141500. phenotype. 183086. phenotype. 601011. gene. | ||||||||||||
| neXtProt | NX_O00555. | ||||||||||||
| Orphanet | 2131. Alternating hemiplegia of childhood. 71518. Benign paroxysmal torticollis of infancy. 569. Familial or sporadic hemiplegic migraine. 97. Familial paroxysmal ataxia. 98758. Spinocerebellar ataxia type 6. | ||||||||||||
| PharmGKB | PA26007. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | COG1226. | ||||||||||||
| HOVERGEN | HBG050763. | ||||||||||||
| InParanoid | O00555. | ||||||||||||
| KO | K04344. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Reactome | REACT_111217. Metabolism. REACT_13685. Neuronal System. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | O00555. | ||||||||||||
| Bgee | O00555. | ||||||||||||
| Genevestigator | O00555. | ||||||||||||
| GermOnline | ENSG00000141837. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 1.20.120.350. 4 hits. | ||||||||||||
| InterPro | IPR005821. Ion_trans_dom. IPR027359. K_channel_four-helix_dom. IPR014873. VDCC_a1su_IQ. IPR005448. VDCC_P/Q_a1su. IPR002077. VDCCAlpha1. [Graphical view] | ||||||||||||
| PANTHER | PTHR10037:SF59. PTHR10037:SF59. 1 hit. | ||||||||||||
| Pfam | PF08763. Ca_chan_IQ. 1 hit. PF00520. Ion_trans. 4 hits. [Graphical view] | ||||||||||||
| PRINTS | PR00167. CACHANNEL. PR01632. PQVDCCALPHA1. | ||||||||||||
| SMART | SM01062. Ca_chan_IQ. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| BindingDB | O00555. | ||||||||||||
| ChEMBL | CHEMBL4266. | ||||||||||||
| ChiTaRS | CACNA1A. human. | ||||||||||||
| DrugBank | DB01244. Bepridil. DB00568. Cinnarizine. DB00836. Loperamide. DB00401. Nisoldipine. DB00230. Pregabalin. | ||||||||||||
| EvolutionaryTrace | O00555. | ||||||||||||
| GenomeRNAi | 773. | ||||||||||||
| NextBio | 3122. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | CAC1A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O00555 Secondary accession number(s): J3KP41 Q9UDC4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 19 Human chromosome 19: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
