Reviewed,
UniProtKB/Swiss-Prot O00555 (CAC1A_HUMAN)
Last modified
January 19, 2010.
Version 106.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Voltage-dependent P/Q-type calcium channel subunit alpha-1A Alternative name(s): Voltage-gated calcium channel subunit alpha Cav2.1 Calcium channel, L type, alpha-1 polypeptide isoform 4 Brain calcium channel I Short name=BI | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 2505 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. The isoform alpha-1A gives rise to P and/or Q-type calcium currents. P/Q-type calcium channels belong to the 'high-voltage activated' (HVA) group and are blocked by the funnel toxin (Ftx) and by the omega-agatoxin-IVA (omega-Aga-IVA). They are however insensitive to dihydropyridines (DHP), and omega-conotoxin-GVIA (omega-CTx-GVIA). |
| Subunit structure | Voltage-dependent calcium channels are multisubunit complexes, consisting of alpha-1, alpha-2, beta and delta subunits in a 1:1:1:1 ratio. The channel activity is directed by the pore-forming and voltage-sensitive alpha-1 subunit. In many cases, this subunit is sufficient to generate voltage-sensitive calcium channel activity. The auxiliary subunits beta and alpha-2/delta linked by a disulfide bridge regulate the channel activity. Interact (via C-terminal CDB motif) with CABP1 in the pre- and postsynaptic membranes. |
| Subcellular location | |
| Tissue specificity | Brain specific; mainly found in cerebellum, cerebral cortex, thalamus and hypothalamus. Expressed in the small cell lung carcinoma cell line SCC-9. No expression in heart, kidney, liver or muscle. Purkinje cells contain predominantly P-type VSCC, the Q-type being a prominent calcium current in cerebellar granule cells. Ref.6 |
| Domain | Each of the four internal repeats contains five hydrophobic transmembrane segments (S1, S2, S3, S5, S6) and one positively charged transmembrane segment (S4). S4 segments probably represent the voltage-sensor and are characterized by a series of positively charged amino acids at every third position. |
| Polymorphism | The poly-Gln region of CACNA1A is polymorphic: 6 to 17 repeats in the normal population, expanded to about 21 to 30 repeats in SCA6. Repeat expansion has been reported also in a EA2 family. |
| Involvement in disease | Defects in CACNA1A are the cause of spinocerebellar ataxia type 6 (SCA6) [MIM:183086]. Spinocerebellar ataxia is a clinically and genetically heterogeneous group of cerebellar disorders. Patients show progressive incoordination of gait and often poor coordination of hands, speech and eye movements, due to degeneration of the cerebellum with variable involvement of the brainstem and spinal cord. SCA6 is mainly caused by expansion of a CAG repeat in the coding region of CACNA1A. There seems to be a correlation between the repeat number and earlier onset of the disorder. Ref.3 Ref.10 Ref.11 Defects in CACNA1A are the cause of familial hemiplegic migraine (FHM) [MIM:141500]; also known as migraine familial hemiplegic 1 (MHP1). FHM, a rare autosomal dominant subtype of migraine with aura, is associated with ictal hemiparesis and, in some families, progressive cerebellar atrophy. Ref.2 Ref.13 Ref.14 Ref.16 Ref.20 Defects in CACNA1A are the cause of episodic ataxia type 2 (EA2) [MIM:108500]; also known as acetazolamide-responsive hereditary paroxysmal cerebellar ataxia (APCA). EA2 is an autosomal dominant disorder characterized by acetozolamide-responsive attacks of ataxia, migraine-like symptoms, interictal nystagmus, and cerebellar atrophy. Ref.11 Ref.2 Ref.12 Ref.15 Ref.17 Ref.18 Ref.19 Ref.21 Ref.22 |
| Sequence similarities | Belongs to the calcium channel alpha-1 subunit (TC 1.A.1.11) family. [View classification] |
Ontologies
Alternative products
| This entry describes 7 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform 1 (identifier: O00555-1) Also known as: 1A-1; BI-1-GGCAG; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O00555-2) Also known as: 1A-2,BI-1; The sequence of this isoform differs from the canonical sequence as follows: 2262-2505: Missing. | ||||||
| Isoform 3 (identifier: O00555-3) Also known as: BI-1(V1); The sequence of this isoform differs from the canonical sequence as follows: 1844-1875: WGRMPYLDMYQMLRHMSPPLGLGKKCPARVAY → CGRIHYKDMYSLLRVISPPLGLGKKCPHRVAC 2262-2505: Missing. | ||||||
| Isoform 4 (identifier: O00555-4) Also known as: BI-1(V1)-GGCAG; The sequence of this isoform differs from the canonical sequence as follows: 1844-1875: WGRMPYLDMYQMLRHMSPPLGLGKKCPARVAY → CGRIHYKDMYSLLRVISPPLGLGKKCPHRVAC | ||||||
| Isoform 5 (identifier: O00555-5) Also known as: BI-1(V2); The sequence of this isoform differs from the canonical sequence as follows: 2103-2114: Missing. 2262-2505: Missing. | ||||||
| Isoform 6 (identifier: O00555-6) Also known as: BI-1(V2)-GGCAG; The sequence of this isoform differs from the canonical sequence as follows: 2103-2114: Missing. | ||||||
| Isoform 7 (identifier: O00555-7) Also known as: BI-1(V2,V3); The sequence of this isoform differs from the canonical sequence as follows: 2220-2240: HPPPPDKDRYAQERPDHGRAR → RFLCFFFPFFLPCLKTVGLGL 2241-2505: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 2505 | 2505 | Voltage-dependent P/Q-type calcium channel subunit alpha-1A | PRO_0000053916 | |||||||
Regions | |||||||||||
| Topological domain | 1 – 98 | 98 | Cytoplasmic Potential | ||||||||
| Transmembrane | 99 – 117 | 19 | S1 of repeat I Potential | ||||||||
| Topological domain | 118 – 135 | 18 | Extracellular Potential | ||||||||
| Transmembrane | 136 – 155 | 20 | S2 of repeat I Potential | ||||||||
| Topological domain | 156 – 167 | 12 | Cytoplasmic Potential | ||||||||
| Transmembrane | 168 – 185 | 18 | S3 of repeat I Potential | ||||||||
| Topological domain | 186 – 190 | 5 | Extracellular Potential | ||||||||
| Transmembrane | 191 – 209 | 19 | S4 of repeat I Potential | ||||||||
| Topological domain | 210 – 228 | 19 | Cytoplasmic Potential | ||||||||
| Transmembrane | 229 – 248 | 20 | S5 of repeat I Potential | ||||||||
| Topological domain | 249 – 335 | 87 | Extracellular Potential | ||||||||
| Transmembrane | 336 – 360 | 25 | S6 of repeat I Potential | ||||||||
| Topological domain | 361 – 487 | 127 | Cytoplasmic Potential | ||||||||
| Transmembrane | 488 – 506 | 19 | S1 of repeat II Potential | ||||||||
| Topological domain | 507 – 521 | 15 | Extracellular Potential | ||||||||
| Transmembrane | 522 – 541 | 20 | S2 of repeat II Potential | ||||||||
| Topological domain | 542 – 549 | 8 | Cytoplasmic Potential | ||||||||
| Transmembrane | 550 – 568 | 19 | S3 of repeat II Potential | ||||||||
| Topological domain | 569 – 578 | 10 | Extracellular Potential | ||||||||
| Transmembrane | 579 – 597 | 19 | S4 of repeat II Potential | ||||||||
| Topological domain | 598 – 616 | 19 | Cytoplasmic Potential | ||||||||
| Transmembrane | 617 – 636 | 20 | S5 of repeat II Potential | ||||||||
| Topological domain | 637 – 689 | 53 | Extracellular Potential | ||||||||
| Transmembrane | 690 – 714 | 25 | S6 of repeat II Potential | ||||||||
| Topological domain | 715 – 1242 | 528 | Cytoplasmic Potential | ||||||||
| Transmembrane | 1243 – 1261 | 19 | S1 of repeat III Potential | ||||||||
| Topological domain | 1262 – 1277 | 16 | Extracellular Potential | ||||||||
| Transmembrane | 1278 – 1297 | 20 | S2 of repeat III Potential | ||||||||
| Topological domain | 1298 – 1309 | 12 | Cytoplasmic Potential | ||||||||
| Transmembrane | 1310 – 1328 | 19 | S3 of repeat III Potential | ||||||||
| Topological domain | 1329 – 1339 | 11 | Extracellular Potential | ||||||||
| Transmembrane | 1340 – 1358 | 19 | S4 of repeat III Potential | ||||||||
| Topological domain | 1359 – 1377 | 19 | Cytoplasmic Potential | ||||||||
| Transmembrane | 1378 – 1397 | 20 | S5 of repeat III Potential | ||||||||
| Topological domain | 1398 – 1484 | 87 | Extracellular Potential | ||||||||
| Transmembrane | 1485 – 1509 | 25 | S6 of repeat III Potential | ||||||||
| Topological domain | 1510 – 1564 | 55 | Cytoplasmic Potential | ||||||||
| Transmembrane | 1565 – 1593 | 29 | S1 of repeat IV Potential | ||||||||
| Topological domain | 1594 – 1598 | 5 | Extracellular Potential | ||||||||
| Transmembrane | 1599 – 1618 | 20 | S2 of repeat IV Potential | ||||||||
| Topological domain | 1619 – 1626 | 8 | Cytoplasmic Potential | ||||||||
| Transmembrane | 1627 – 1645 | 19 | S3 of repeat IV Potential | ||||||||
| Topological domain | 1646 – 1652 | 7 | Extracellular Potential | ||||||||
| Transmembrane | 1653 – 1671 | 19 | S4 of repeat IV Potential | ||||||||
| Topological domain | 1672 – 1690 | 19 | Cytoplasmic Potential | ||||||||
| Transmembrane | 1691 – 1710 | 20 | S5 of repeat IV Potential | ||||||||
| Topological domain | 1711 – 1782 | 72 | Extracellular Potential | ||||||||
| Transmembrane | 1783 – 1807 | 25 | S6 of repeat IV Potential | ||||||||
| Topological domain | 1808 – 2505 | 698 | Cytoplasmic Potential | ||||||||
| Repeat | 85 – 363 | 279 | I | ||||||||
| Repeat | 473 – 717 | 245 | II | ||||||||
| Repeat | 1231 – 1514 | 284 | III | ||||||||
| Repeat | 1551 – 1814 | 264 | IV | ||||||||
| Calcium binding | 1840 – 1851 | 12 | By similarity | ||||||||
| Region | 383 – 400 | 18 | Binding to the beta subunit By similarity | ||||||||
| Compositional bias | 13 – 18 | 6 | Poly-Gly | ||||||||
| Compositional bias | 727 – 732 | 6 | Poly-Glu | ||||||||
| Compositional bias | 1002 – 1007 | 6 | Poly-Arg | ||||||||
| Compositional bias | 1204 – 1207 | 4 | Poly-Glu | ||||||||
| Compositional bias | 2211 – 2220 | 10 | Poly-His | ||||||||
| Compositional bias | 2221 – 2224 | 4 | Poly-Pro | ||||||||
| Compositional bias | 2314 – 2324 | 11 | Poly-Gln | ||||||||
Sites | |||||||||||
| Site | 318 | 1 | Calcium ion selectivity and permeability By similarity | ||||||||
| Site | 668 | 1 | Calcium ion selectivity and permeability By similarity | ||||||||
| Site | 1460 | 1 | Calcium ion selectivity and permeability By similarity | ||||||||
| Site | 1756 | 1 | Calcium ion selectivity and permeability By similarity | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 750 | 1 | Phosphoserine By similarity | ||||||||
| Modified residue | 1822 | 1 | Phosphoserine; by PKA Potential | ||||||||
| Modified residue | 2030 | 1 | Phosphoserine By similarity | ||||||||
| Modified residue | 2076 | 1 | Phosphotyrosine By similarity | ||||||||
| Modified residue | 2269 | 1 | Phosphoserine By similarity | ||||||||
| Modified residue | 2378 | 1 | Phosphoserine By similarity | ||||||||
| Glycosylation | 283 | 1 | N-linked (GlcNAc...) Potential | ||||||||
Natural variations | |||||||||||
| Alternative sequence | 1844 – 1875 | 32 | WGRMP…ARVAY → CGRIHYKDMYSLLRVISPPL GLGKKCPHRVAC in isoform 3 and isoform 4. | VSP_000871 | |||||||
| Alternative sequence | 2103 – 2114 | 12 | Missing in isoform 5 and isoform 6. | VSP_000872 | |||||||
| Alternative sequence | 2220 – 2240 | 21 | HPPPP…HGRAR → RFLCFFFPFFLPCLKTVGLG L in isoform 7. | VSP_000873 | |||||||
| Alternative sequence | 2241 – 2505 | 265 | Missing in isoform 7. | VSP_000874 | |||||||
| Alternative sequence | 2262 – 2505 | 244 | Missing in isoform 2, isoform 3 and isoform 5. | VSP_000875 | |||||||
| Natural variant | 21 | 1 | A → V: dbSNP rs15999. | VAR_014456 | |||||||
| Natural variant | 192 | 1 | R → Q in FHM. | VAR_001491 | |||||||
| Natural variant | 195 | 1 | R → K in FHM. Ref.16 | VAR_043820 | |||||||
| Natural variant | 218 | 1 | S → L in FHM. Ref.14 | VAR_043821 | |||||||
| Natural variant | 253 | 1 | H → Y in EA2. Ref.18 | VAR_043822 | |||||||
| Natural variant | 256 | 1 | C → R in EA2. Ref.21 | VAR_043823 | |||||||
| Natural variant | 287 | 1 | C → Y in EA2. Ref.22 | VAR_043824 | |||||||
| Natural variant | 293 | 1 | G → R in EA2 and SCA6. Ref.10 Ref.22 | VAR_043825 | |||||||
| Natural variant | 583 | 1 | R → Q in FHM. Ref.16 | VAR_043826 | |||||||
| Natural variant | 666 | 1 | T → M in FHM and EA2. Ref.16 Ref.22 | VAR_001492 | |||||||
| Natural variant | 714 | 1 | V → A in FHM. | VAR_001493 | |||||||
| Natural variant | 715 | 1 | D → E in FHM. Ref.16 | VAR_043827 | |||||||
| Natural variant | 732 | 1 | E → A: dbSNP rs16019. | VAR_059221 | |||||||
| Natural variant | 914 | 1 | P → S: dbSNP rs16020. | VAR_014458 | |||||||
| Natural variant | 918 | 1 | E → D: dbSNP rs16022. | VAR_014459 | |||||||
| Natural variant | 993 | 1 | E → V: dbSNP rs16023. Ref.13 | VAR_043828 | |||||||
| Natural variant | 1015 | 1 | E → K: dbSNP rs16024. | VAR_014461 | |||||||
| Natural variant | 1105 | 1 | G → S: dbSNP rs16027. | VAR_014462 | |||||||
| Natural variant | 1173 | 1 | P → L: dbSNP rs16028. | VAR_059222 | |||||||
| Natural variant | 1335 | 1 | K → E in FHM. Ref.16 | VAR_043829 | |||||||
| Natural variant | 1346 | 1 | R → Q in FHM; with progressive cerebellar ataxia. Ref.20 | VAR_043830 | |||||||
| Natural variant | 1384 | 1 | Y → C in FHM. Ref.16 | VAR_043831 | |||||||
| Natural variant | 1404 | 1 | F → C in EA2; loss of function. Ref.17 | VAR_043832 | |||||||
| Natural variant | 1456 | 1 | V → L in FHM. Ref.13 | VAR_043833 | |||||||
| Natural variant | 1482 | 1 | G → R in EA2. Ref.21 | VAR_043834 | |||||||
| Natural variant | 1490 | 1 | F → S in EA2. Ref.21 | VAR_043835 | |||||||
| Natural variant | 1493 | 1 | V → I in EA2. Ref.21 | VAR_043836 | |||||||
| Natural variant | 1661 | 1 | R → H in EA2. Ref.12 | VAR_043837 | |||||||
| Natural variant | 1667 | 1 | R → W in FHM. Ref.16 | VAR_043838 | |||||||
| Natural variant | 1683 | 1 | W → R in FHM. Ref.16 | VAR_043839 | |||||||
| Natural variant | 1736 | 1 | H → L in EA2. Ref.19 | VAR_043840 | |||||||
| Natural variant | 1756 | 1 | E → K in EA2. Ref.15 | VAR_043841 | |||||||
| Natural variant | 1810 | 1 | I → L in FHM. | VAR_001494 | |||||||
| Natural variant | 2135 | 1 | R → C in EA2. Ref.21 | VAR_043842 | |||||||
| Natural variant | 2394 | 1 | P → S: dbSNP rs16056. | VAR_014463 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 725 | 1 | K → KVEA in AAB61613. Ref.1 | ||||||||
| Sequence conflict | 725 | 1 | K → KVEA in AAB61612. Ref.1 | ||||||||
| Sequence conflict | 896 | 1 | G → D in CAA68172. Ref.2 | ||||||||
| Sequence conflict | 1207 | 1 | E → EE in CAA68172. Ref.2 | ||||||||
| Sequence conflict | 1313 – 1315 | 3 | WNI → ILP in AAB49674. Ref.3 | ||||||||
| Sequence conflict | 1313 – 1315 | 3 | WNI → ILP in AAB49675. Ref.3 | ||||||||
| Sequence conflict | 1313 – 1315 | 3 | WNI → ILP in AAB49676. Ref.3 | ||||||||
| Sequence conflict | 1313 – 1315 | 3 | WNI → ILP in AAB49677. Ref.3 | ||||||||
| Sequence conflict | 1313 – 1315 | 3 | WNI → ILP in AAB49678. Ref.3 | ||||||||
| Sequence conflict | 1459 | 1 | G → A in CAA68172. Ref.2 | ||||||||
| Sequence conflict | 1604 | 1 | V → A in CAA68172. Ref.2 | ||||||||
| Sequence conflict | 1617 | 1 | V → A in CAA68172. Ref.2 | ||||||||
| Sequence conflict | 1651 | 1 | G → GNP in AAB61613. Ref.1 | ||||||||
| Sequence conflict | 1651 | 1 | G → GNP in AAB61612. Ref.1 | ||||||||
| Sequence conflict | 1693 | 1 | P → A in AAB33068. Ref.5 | ||||||||
| Sequence conflict | 2038 | 1 | E → G in U06702. Ref.7 | ||||||||
| Sequence conflict | 2314 | 1 | Q → QQ in AAB49676. Ref.3 | ||||||||
Secondary structure | |||||||||||
Helix Strand Turn | |||||||||||
| Helix | 1956 – 1970 | 15 | |||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Structural elements in domain IV that influence biophysical and pharmacological properties of human alpha1A-containing high-voltage-activated calcium channels." Hans M., Urrutia A., Deal C., Brust P.F., Stauderman K., Ellis S.B., Harpold M.M., Johnson E.C., Williams M.E. Biophys. J. 76:1384-1400(1999) [PubMed: 10049321] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). Tissue: Neuron. |
| [2] | "Familial hemiplegic migraine and episodic ataxia type-2 are caused by mutations in the Ca2+ channel gene CACNL1A4." Ophoff R.A., Terwindt G.M., Vergouwe M.N., van Eijk R., Oefner P.J., Hoffman S.M.G., Lamerdin J.E., Mohrenweiser H.W., Bulman D.E., Ferrari M., Haan J., Lindhout D., van Ommen G.-J.B., Hofker M.H., Ferrari M.D., Frants R.R. Cell 87:543-552(1996) [PubMed: 8898206] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 3), VARIANTS FHM, INVOLVEMENT IN EA2. Tissue: Cerebellum. |
| [3] | "Autosomal dominant cerebellar ataxia (SCA6) associated with small polyglutamine expansions in the alpha 1A-voltage-dependent calcium channel." Zhuchenko O., Bailey J., Bonnen P.E., Ashizawa T., Stockton D.W., Amos C., Dobyns W.B., Subramony S.H., Zoghbi H.Y., Lee C.C. Nat. Genet. 15:62-69(1997) [PubMed: 8988170] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), NUCLEOTIDE SEQUENCE [MRNA] OF 1313-2505 (ISOFORMS 1; 2; 3; 6 AND 7), ALTERNATIVE SPLICING, INVOLVEMENT IN SCA6. Tissue: Brain. |
| [4] | "The DNA sequence and biology of human chromosome 19." Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V. Lucas S.M.Nature 428:529-535(2004) [PubMed: 15057824] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "Expression and antibody inhibition of P-type calcium channels in human small-cell lung carcinoma cells." Barry E.L.R., Viglione M.P., Kim Y.I., Froehner S.C. J. Neurosci. 15:274-283(1995) [PubMed: 7823133] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1693-1807. Tissue: Lung carcinoma. |
| [6] | "Molecular diversity of neuronal-type calcium channels identified in small cell lung carcinoma." Oguro-Okano M., Griesmann G.E., Wieben E.D., Slaymaker S.J., Snutch T.P., Lennon V.A. Mayo Clin. Proc. 67:1150-1159(1992) [PubMed: 1335101] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1702-1822, TISSUE SPECIFICITY. Tissue: Lung carcinoma. |
| [7] | "Characterization of cDNA clones containing CCA trinucleotide repeats derived from human brain." Margolis R.L., Breschel T.S., Li S.H., Kidwai A.S., Antonarakis S.E., McInnis M.G., Ross C.A. Somat. Cell Mol. Genet. 21:279-284(1995) [PubMed: 8525433] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 2038-2258 (ISOFORMS 1/2/3/4). Tissue: Frontal cortex. |
| [8] | "Differential modulation of Ca(v)2.1 channels by calmodulin and Ca2+-binding protein 1." Lee A., Westenbroek R.E., Haeseleer F., Palczewski K., Scheuer T., Catterall W.A. Nat. Neurosci. 5:210-217(2002) [PubMed: 11865310] [Abstract] Cited for: INTERACTION WITH CABP1. |
| [9] | "Crystal structure of the CaV2 IQ domain in complex with Ca2+/calmodulin: high-resolution mechanistic implications for channel regulation by Ca2+." Mori M.X., Vander Kooi C.W., Leahy D.J., Yue D.T. Structure 16:607-620(2008) [PubMed: 18400181] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.55 ANGSTROMS) OF 1955-1975. |
| [10] | "Progressive ataxia due to a missense mutation in a calcium-channel gene." Yue Q., Jen J.C., Nelson S.F., Baloh R.W. Am. J. Hum. Genet. 61:1078-1087(1997) [PubMed: 9345107] [Abstract] Cited for: VARIANT SCA6 ARG-293. |
| [11] | "Episodic ataxia type 2 (EA2) and spinocerebellar ataxia type 6 (SCA6) due to CAG repeat expansion in the CACNA1A gene on chromosome 19p." Jodice C., Mantuano E., Veneziano L., Trettel F., Sabbadini G., Calandriello L., Francia A., Spadaro M., Pierelli F., Salvi F., Ophoff R.A., Frants R.R., Frontali M. Hum. Mol. Genet. 6:1973-1978(1997) [PubMed: 9302278] [Abstract] Cited for: POLYMORPHISM, INVOLVEMENT IN SCA6 AND EA2. |
| [12] | "Detection of a novel missense mutation and second recurrent mutation in the CACNA1A gene in individuals with EA-2 and FHM." Friend K.L., Crimmins D., Phan T.G., Sue C.M., Colley A., Fung V.S., Morris J.G., Sutherland G.R., Richards R.I. Hum. Genet. 105:261-265(1999) [PubMed: 10987655] [Abstract] Cited for: VARIANT EA2 HIS-1661. |
| [13] | "Genetic heterogeneity in Italian families with familial hemiplegic migraine." Carrera P., Piatti M., Stenirri S., Grimaldi L.M., Marchioni E., Curcio M., Righetti P.G., Ferrari M., Gelfi C. Neurology 53:26-33(1999) [PubMed: 10408532] [Abstract] Cited for: VARIANT VAL-993, VARIANT FHM LEU-1456. |
| [14] | "Delayed cerebral edema and fatal coma after minor head trauma: role of the CACNA1A calcium channel subunit gene and relationship with familial hemiplegic migraine." Kors E.E., Terwindt G.M., Vermeulen F.L., Fitzsimons R.B., Jardine P.E., Heywood P., Love S., van den Maagdenberg A.M., Haan J., Frants R.R., Ferrari M.D. Ann. Neurol. 49:753-760(2001) [PubMed: 11409427] [Abstract] Cited for: VARIANT FHM LEU-218. |
| [15] | "Missense CACNA1A mutation causing episodic ataxia type 2." Denier C., Ducros A., Durr A., Eymard B., Chassande B., Tournier-Lasserve E. Arch. Neurol. 58:292-295(2001) [PubMed: 11176968] [Abstract] Cited for: VARIANT EA2 LYS-1756. |
| [16] | "The clinical spectrum of familial hemiplegic migraine associated with mutations in a neuronal calcium channel." Ducros A., Denier C., Joutel A., Cecillon M., Lescoat C., Vahedi K., Darcel F., Vicaut E., Bousser M.G., Tournier-Lasserve E. N. Engl. J. Med. 345:17-24(2001) [PubMed: 11439943] [Abstract] Cited for: VARIANTS FHM LYS-195; GLN-583; MET-666; GLU-715; GLU-1335; CYS-1384; TRP-1667 AND ARG-1683. |
| [17] | "Loss-of-function EA2 mutations are associated with impaired neuromuscular transmission." Jen J., Wan J., Graves M., Yu H., Mock A.F., Coulin C.J., Kim G., Yue Q., Papazian D.M., Baloh R.W. Neurology 57:1843-1848(2001) [PubMed: 11723274] [Abstract] Cited for: VARIANT EA2 CYS-1404, CHARACTERIZATION OF VARIANT EA2 CYS-1404. |
| [18] | "Episodic ataxia type 2. Three novel truncating mutations and one novel missense mutation in the CACNA1A gene." van den Maagdenberg A.M., Kors E.E., Brunt E.R., van Paesschen W., Pascual J., Ravine D., Keeling S., Vanmolkot K.R., Vermeulen F.L., Terwindt G.M., Haan J., Frants R.R., Ferrari M.D. J. Neurol. 249:1515-1519(2002) [PubMed: 12420090] [Abstract] Cited for: VARIANT EA2 TYR-253. |
| [19] | "Functional implications of a novel EA2 mutation in the P/Q-type calcium channel." Spacey S.D., Hildebrand M.E., Materek L.A., Bird T.D., Snutch T.P. Ann. Neurol. 56:213-220(2004) [PubMed: 15293273] [Abstract] Cited for: VARIANT EA2 LEU-1736. |
| [20] | "A novel R1347Q mutation in the predicted voltage sensor segment of the P/Q-type calcium-channel alpha-subunit in a family with progressive cerebellar ataxia and hemiplegic migraine." Alonso I., Barros J., Tuna A., Seixas A., Coutinho P., Sequeiros J., Silveira I. Clin. Genet. 65:70-72(2004) [PubMed: 15032980] [Abstract] Cited for: VARIANT FHM GLN-1346. |
| [21] | "Clusters of non-truncating mutations of P/Q type Ca2+ channel subunit Ca(v)2.1 causing episodic ataxia 2." Mantuano E., Veneziano L., Spadaro M., Giunti P., Guida S., Leggio M.G., Verriello L., Wood N., Jodice C., Frontali M. J. Med. Genet. 41:E82-E82(2004) [PubMed: 15173248] [Abstract] Cited for: VARIANTS EA2 ARG-256; ARG-1482; SER-1490; ILE-1493 AND CYS-2135. |
| [22] | "Clinical spectrum of episodic ataxia type 2." Jen J., Kim G.W., Baloh R.W. Neurology 62:17-22(2004) [PubMed: 14718690] [Abstract] Cited for: VARIANTS EA2 TYR-287; ARG-293 AND MET-666. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF004883 mRNA. Translation: AAB61612.1. AF004884 mRNA. Translation: AAB61613.1. X99897 mRNA. Translation: CAA68172.1. Z80114 Genomic DNA. No translation available. Z80115 Genomic DNA. No translation available. U79663 mRNA. Translation: AAB49674.1. U79664 mRNA. Translation: AAB49675.1. U79665 mRNA. Translation: AAB49676.1. U79666 mRNA. Translation: AAB64179.1. U79667 mRNA. Translation: AAB49677.1. U79668 mRNA. Translation: AAB49678.1. AC005305 Genomic DNA. Translation: AAC26839.1. AC008540 Genomic DNA. No translation available. AC011446 Genomic DNA. No translation available. AC022436 Genomic DNA. No translation available. AC026805 Genomic DNA. No translation available. AC098781 Genomic DNA. No translation available. AC124224 Genomic DNA. No translation available. S76537 mRNA. Translation: AAB33068.1. U06702 mRNA. No translation available. | ||||||||||||
| IPI | IPI00012136. IPI00217497. IPI00217498. IPI00217499. IPI00291347. IPI00397553. IPI00397554. | ||||||||||||
| RefSeq | NP_001120693.1. NP_001120694.1. | ||||||||||||
| UniGene | Hs.501632 | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| SMR | O00555. Positions 1242-1318, 1559-1690. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| STRING | O00555. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | O00555. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | O00555. | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000360228; ENSP00000353362; ENSG00000141837; Homo sapiens. [Genome view] | ||||||||||||
| GeneID | 773. | ||||||||||||
| KEGG | hsa:773. | ||||||||||||
| UCSC | uc002mwy.2. human. uc010dzc.1. human. uc010dze.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 773. | ||||||||||||
| GeneCards | GC19M013178. | ||||||||||||
| H-InvDB | HIX0039929. | ||||||||||||
| HGNC | HGNC:1388. CACNA1A. | ||||||||||||
| MIM | 108500. phenotype. 141500. phenotype. 183086. phenotype. 601011. gene. | ||||||||||||
| Orphanet | 97. Ataxia, familial paroxysmal. 98758. Ataxia, spinocerebellar, type 6. 71518. Benign paroxysmal torticollis of infancy. 569. Hemiplegic migraine, familial or sporadic. | ||||||||||||
| PharmGKB | PA26007. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | prNOG19834. | ||||||||||||
| HOVERGEN | O00555. | ||||||||||||
| InParanoid | O00555. | ||||||||||||
| OrthoDB | EOG9DBWZW. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Reactome | REACT_13685. Synaptic Transmission. REACT_1505. Integration of energy metabolism. REACT_15380. Diabetes pathways. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | O00555. | ||||||||||||
| Bgee | O00555. | ||||||||||||
| Genevestigator | O00555. | ||||||||||||
| GermOnline | ENSG00000141837. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR005821. Ion_trans. IPR014873. VDCC_a1su_IQ. IPR005448. VDCC_P/Q_a1su. IPR002077. VDCCAlpha1. [Graphical view] | ||||||||||||
| PANTHER | PTHR10037:SF59. PQVDCCAlpha1. 1 hit. | ||||||||||||
| Pfam | PF08763. Ca_chan_IQ. 1 hit. PF00520. Ion_trans. 4 hits. [Graphical view] | ||||||||||||
| PRINTS | PR00167. CACHANNEL. PR01632. PQVDCCALPHA1. | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other Resources | |||||||||||||
| DrugBank | DB01244. Bepridil. DB00568. Cinnarizine. DB00836. Loperamide. DB00401. Nisoldipine. DB00230. Pregabalin. | ||||||||||||
| NextBio | 3122. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | CAC1A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O00555 Secondary accession number(s): P78510 Q9UDC4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 19 Human chromosome 19: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


